F457437

General Info

Members Datasets Scaffolds Average Seq Length
512 287 1024 373

Family's Representative Sequence

Representative Sequence 3300027552|Ga0209982_1005646|Ga0209982_10056462
Length 416
Sequence VLQFRFDNQPYRVKLEFSVRESTMTLPATPLPRSKAPASKIAVRLTGLWKTYPGGTNPAVKDLSIDVLDGEILTLLGPSGCGKTTTLRMVAGLETPDAGDIFFGDQAVVMSSRQVSLPPNKRNVGMVFQSYAIWPHMTVAENVAFPLKARRFPKKEIKERVLRALDLVGLTGFEDRPGPLLSGGQQQRVAFARALVTEPRVLLLDEPFSNLDAKLREQMRISVKLLQKRLNIAMLFVTHDQIEALSLSNRIALMNFGVVQQQGDPRLLYEAPVNEFVRDFVGRTLLFKGTVHTSTPSGMIVIALAGARDCVVFGRSYNPAGVTAGESVYIGVRPEDVEIRAALGGEVPSGMIGGKVEAALFVGERIEYQVEVDGQGLIFIYGERHEPIEEGNKVWLKLRSEGHSAWSSDWSHKVEC

Samples

Sample ID Description Type Environment
1 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
106 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
107 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
108 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
111 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
256 2508501050 Microvirga lupini Lut6 Isolate Nodule
257 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
258 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
259 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
260 2773857925 Microvirga vignae BR3299 Isolate Unclassified
261 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
262 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
263 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
264 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
265 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
266 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
267 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
268 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
269 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
270 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
271 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
272 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
273 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
274 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
275 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
276 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
277 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
278 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
279 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
280 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
281 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
282 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
283 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
284 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
285 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
286 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
287 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 5.08
Rhizoplane 2.73
Rhizosphere 86.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209982_1005646 3300027552 Bacteria 1809
2 JGI25155J39150_1000038 3300002704 Bacteria 93696
3 JGI25156J39149_1000048 3300002705 Bacteria 93954
4 JGI25154J39366_1000071 3300002738 Bacteria 93822
5 JGI25157J39369_1000200 3300002741 Bacteria 50803
6 Ga0055532_1000571 3300003758 Bacteria 15378
7 Ga0065712_10069080 3300005290 Bacteria 8070
8 Ga0065715_10006436 3300005293 Bacteria 4500
9 Ga0065707_10091530 3300005295 Bacteria 3926
10 Ga0070658_10097657 3300005327 Bacteria 2425
11 Ga0070676_10011517 3300005328 Bacteria 4808
12 Ga0070683_100302758 3300005329 Bacteria 1521
13 Ga0070690_100021474 3300005330 Bacteria 3942
14 Ga0070670_100004243 3300005331 Bacteria 11991
15 Ga0068869_100015958 3300005334 Bacteria 5055
16 Ga0068869_100174757 3300005334 Bacteria 1680
17 Ga0070666_10103591 3300005335 Bacteria 1963
18 Ga0070680_100034644 3300005336 Bacteria 4071
19 Ga0070682_100007427 3300005337 Bacteria 6181
20 Ga0070682_100085807 3300005337 Bacteria 2049
21 Ga0068868_100141818 3300005338 Bacteria 1973
22 Ga0070689_100079293 3300005340 Bacteria 2575
23 Ga0070689_100231494 3300005340 Bacteria 1519
24 Ga0070691_10000599 3300005341 Bacteria 13800
25 Ga0070661_100003346 3300005344 Bacteria 11057
26 Ga0070668_100134959 3300005347 Bacteria 1984
27 Ga0070669_100005285 3300005353 Bacteria 9323
28 Ga0070671_100001934 3300005355 Bacteria 15879
29 Ga0070674_100129389 3300005356 Bacteria 1880
30 Ga0070673_100009901 3300005364 Bacteria 6422
31 Ga0070659_100194416 3300005366 Bacteria 1668
32 Ga0070709_10003006 3300005434 Bacteria 9077
33 Ga0070709_10016401 3300005434 Bacteria 4227
34 Ga0070709_10023291 3300005434 Bacteria 3633
35 Ga0070714_100000685 3300005435 Bacteria 23915
36 Ga0070714_100002782 3300005435 Bacteria 12896
37 Ga0070714_100024528 3300005435 Bacteria 4968
38 Ga0070714_100060953 3300005435 Bacteria 3239
39 Ga0070714_100163950 3300005435 Bacteria 2013
40 Ga0070713_100001510 3300005436 Bacteria 14826
41 Ga0070713_100016356 3300005436 Bacteria 5577
42 Ga0070713_100289661 3300005436 Bacteria 1504
43 Ga0070710_10006866 3300005437 Bacteria 5493
44 Ga0070710_10019725 3300005437 Bacteria 3489
45 Ga0070710_10221697 3300005437 Bacteria 1203
46 Ga0070701_10018993 3300005438 Bacteria 3241
47 Ga0070711_100028250 3300005439 Bacteria 3690
48 Ga0070705_100007985 3300005440 Bacteria 5229
49 Ga0070705_100026520 3300005440 Bacteria 3155
50 Ga0070705_100190249 3300005440 Bacteria 1398
51 Ga0070708_100000483 3300005445 Bacteria 30274
52 Ga0070708_100235473 3300005445 Bacteria 1718
53 Ga0070663_100001526 3300005455 Bacteria 12739
54 Ga0070678_100000819 3300005456 Bacteria 15745
55 Ga0070662_100170608 3300005457 Bacteria 1708
56 Ga0070681_10011623 3300005458 Bacteria 8716
57 Ga0070681_10013597 3300005458 Bacteria 8099
58 Ga0070681_10016898 3300005458 Bacteria 7289
59 Ga0070706_100273935 3300005467 Bacteria 1575
60 Ga0070706_100276707 3300005467 Bacteria 1566
61 Ga0070707_100031310 3300005468 Bacteria 5066
62 Ga0070707_100087944 3300005468 Bacteria 3005
63 Ga0070707_100094001 3300005468 Bacteria 2903
64 Ga0070707_100202276 3300005468 Bacteria 1936
65 Ga0070698_100003141 3300005471 Bacteria 18205
66 Ga0070698_100005255 3300005471 Bacteria 14163
67 Ga0070698_100054670 3300005471 Bacteria 4052
68 Ga0070698_100213710 3300005471 Bacteria 1863
69 Ga0070698_100286171 3300005471 Bacteria 1579
70 Ga0070698_100311550 3300005471 Bacteria 1505
71 Ga0070699_100000935 3300005518 Bacteria 27244
72 Ga0070699_100003959 3300005518 Bacteria 13091
73 Ga0070699_100169348 3300005518 Bacteria 1935
74 Ga0070679_100213460 3300005530 Bacteria 1893
75 Ga0070684_100003117 3300005535 Bacteria 12382
76 Ga0070684_100042987 3300005535 Bacteria 3902
77 Ga0070697_100026677 3300005536 Bacteria 4618
78 Ga0070697_100028158 3300005536 Bacteria 4498
79 Ga0070697_100248584 3300005536 Bacteria 1520
80 Ga0070686_100012410 3300005544 Bacteria 4852
81 Ga0070686_100026173 3300005544 Bacteria 3518
82 Ga0070695_100031805 3300005545 Bacteria 3295
83 Ga0070696_100014749 3300005546 Bacteria 5243
84 Ga0070696_100021766 3300005546 Bacteria 4349
85 Ga0070696_100065228 3300005546 Bacteria 2553
86 Ga0070693_100003252 3300005547 Bacteria 7541
87 Ga0070665_100016729 3300005548 Bacteria 7351
88 Ga0070665_100032848 3300005548 Bacteria 5221
89 Ga0070665_100105818 3300005548 Bacteria 2815
90 Ga0070704_100006328 3300005549 Bacteria 6975
91 Ga0070704_100010427 3300005549 Bacteria 5653
92 Ga0068855_100030721 3300005563 Bacteria 6422
93 Ga0068855_100114948 3300005563 Bacteria 3085
94 Ga0070664_100035094 3300005564 Bacteria 4209
95 Ga0070664_100156761 3300005564 Bacteria 2012
96 Ga0068857_100003486 3300005577 Bacteria 13122
97 Ga0068857_100077164 3300005577 Bacteria 2972
98 Ga0068857_100219050 3300005577 Bacteria 1738
99 Ga0068854_100012499 3300005578 Bacteria 5563
100 Ga0068854_100079494 3300005578 Bacteria 2417
101 Ga0068856_100020387 3300005614 Bacteria 6438
102 Ga0068852_100037571 3300005616 Bacteria 4061
103 Ga0068859_100172167 3300005617 Bacteria 2246
104 Ga0068858_100079346 3300005842 Bacteria 3050
105 Ga0068862_100006607 3300005844 Bacteria 9618
106 Ga0068862_100116579 3300005844 Bacteria 2350
107 Ga0081455_10001305 3300005937 Bacteria 30946
108 Ga0081455_10002371 3300005937 Bacteria 22500
109 Ga0081455_10008070 3300005937 Bacteria 10994
110 Ga0081538_10003737 3300005981 Bacteria 14254
111 Ga0081539_10000288 3300005985 Bacteria 113905
112 Ga0081539_10010690 3300005985 Bacteria 7400
113 Ga0070717_10074245 3300006028 Bacteria 2842
114 Ga0070717_10102792 3300006028 Bacteria 2428
115 Ga0070717_10183398 3300006028 Bacteria 1825
116 Ga0070716_100024985 3300006173 Bacteria 3182
117 Ga0070716_100029678 3300006173 Bacteria 2959
118 Ga0070716_100118598 3300006173 Bacteria 1652
119 Ga0070716_100144421 3300006173 Bacteria 1522
120 Ga0070712_100048992 3300006175 Bacteria 2931
121 Ga0075369_10007038 3300006186 Bacteria 4274
122 Ga0097621_100014750 3300006237 Bacteria 5858
123 Ga0068871_100002232 3300006358 Bacteria 13153
124 Ga0075428_100001507 3300006844 Bacteria 24923
125 Ga0075430_100069695 3300006846 Bacteria 2950
126 Ga0075431_100012063 3300006847 Bacteria 8720
127 Ga0075431_100015569 3300006847 Bacteria 7707
128 Ga0075431_100145166 3300006847 Bacteria 2445
129 Ga0075433_10016879 3300006852 Bacteria 6034
130 Ga0075433_10026648 3300006852 Bacteria 4897
131 Ga0075433_10058748 3300006852 Bacteria 3364
132 Ga0075433_10075909 3300006852 Bacteria 2959
133 Ga0075433_10094788 3300006852 Bacteria 2641
134 Ga0075434_100003058 3300006871 Bacteria 14892
135 Ga0075434_100003204 3300006871 Bacteria 14593
136 Ga0075434_100025717 3300006871 Bacteria 5761
137 Ga0075434_100043898 3300006871 Bacteria 4434
138 Ga0075434_100131500 3300006871 Bacteria 2522
139 Ga0075434_100142332 3300006871 Bacteria 2418
140 Ga0068865_100016403 3300006881 Bacteria 4739
141 Ga0097620_100172169 3300006931 Bacteria 2246
142 Ga0079104_1002622 3300006946 Bacteria 9400
143 Ga0075435_100003095 3300007076 Bacteria 11236
144 Ga0075435_100056142 3300007076 Bacteria 3183
145 Ga0075435_100130174 3300007076 Bacteria 2105
146 Ga0099794_10019870 3300007265 Bacteria 3034
147 Ga0099795_10033353 3300007788 Bacteria 1787
148 Ga0105240_10112128 3300009093 Bacteria 3298
149 Ga0111539_10001442 3300009094 Bacteria 31728
150 Ga0111539_10033206 3300009094 Bacteria 6267
151 Ga0111539_10115331 3300009094 Bacteria 3150
152 Ga0105245_10016162 3300009098 Bacteria 6503
153 Ga0105247_10011587 3300009101 Bacteria 5311
154 Ga0114129_10155161 3300009147 Bacteria 3131
155 Ga0105243_10030670 3300009148 Bacteria 4142
156 Ga0105243_10151277 3300009148 Bacteria 1991
157 Ga0105241_10004489 3300009174 Bacteria 10320
158 Ga0105241_10160996 3300009174 Bacteria 1845
159 Ga0105242_10058460 3300009176 Bacteria 3161
160 Ga0105248_10026140 3300009177 Bacteria 6494
161 Ga0105248_10221599 3300009177 Bacteria 2129
162 Ga0105237_10022216 3300009545 Bacteria 6510
163 Ga0105249_10032128 3300009553 Bacteria 4748
164 Ga0105249_10034017 3300009553 Bacteria 4616
165 Ga0105249_10074238 3300009553 Bacteria 3147
166 Ga0105249_10095266 3300009553 Bacteria 2791
167 Ga0105246_10003589 3300011119 Bacteria 9385
168 Ga0105246_10078897 3300011119 Bacteria 2340
169 Ga0157373_10016246 3300013100 Bacteria 5432
170 Ga0157369_10047634 3300013105 Bacteria 4653
171 Ga0157374_10012771 3300013296 Bacteria 7318
172 Ga0157374_10013502 3300013296 Bacteria 7128
173 Ga0157378_10231846 3300013297 Bacteria 1760
174 Ga0163162_10026299 3300013306 Bacteria 5751
175 Ga0163162_10027745 3300013306 Bacteria 5600
176 Ga0163162_10042933 3300013306 Bacteria 4526
177 Ga0157372_10052554 3300013307 Bacteria 4537
178 Ga0157375_10173709 3300013308 Bacteria 2303
179 Ga0157375_10470987 3300013308 Bacteria 1421
180 Ga0163163_10014779 3300014325 Bacteria 7185
181 Ga0157377_10008395 3300014745 Bacteria 5036
182 Ga0157376_10003405 3300014969 Bacteria 10944
183 Ga0157376_10008372 3300014969 Bacteria 7459
184 Ga0214544_1012884 3300021320 Bacteria 10561
185 Ga0214542_1012745 3300021321 Bacteria 10603
186 Ga0214545_1014166 3300021324 Bacteria 9419
187 Ga0214543_1013104 3300021327 Bacteria 10603
188 Ga0213876_10004431 3300021384 Bacteria 7875
189 Ga0213876_10055280 3300021384 Bacteria 2096
190 Ga0209435_100030 3300025206 Bacteria 170822
191 Ga0209147_100004 3300025229 Bacteria 1371850
192 Ga0209258_100893 3300025242 Bacteria 15485
193 Ga0209646_1000100 3300025246 Bacteria 170822
194 Ga0209026_1000091 3300025250 Bacteria 171170
195 Ga0209759_1000084 3300025256 Bacteria 169233
196 Ga0207697_10014287 3300025315 Bacteria 3295
197 Ga0207682_10022364 3300025893 Bacteria 2491
198 Ga0207692_10009508 3300025898 Bacteria 4065
199 Ga0207699_10002452 3300025906 Bacteria 8753
200 Ga0207699_10003664 3300025906 Bacteria 7336
201 Ga0207699_10108183 3300025906 Bacteria 1777
202 Ga0207645_10070191 3300025907 Bacteria 2241
203 Ga0207684_10089573 3300025910 Bacteria 2621
204 Ga0207684_10140990 3300025910 Bacteria 2072
205 Ga0207684_10191671 3300025910 Bacteria 1763
206 Ga0207707_10000920 3300025912 Bacteria 28595
207 Ga0207707_10091184 3300025912 Bacteria 2664
208 Ga0207707_10329135 3300025912 Bacteria 1318
209 Ga0207671_10025471 3300025914 Bacteria 4444
210 Ga0207693_10014905 3300025915 Bacteria 6243
211 Ga0207693_10019523 3300025915 Bacteria 5390
212 Ga0207663_10009670 3300025916 Bacteria 5104
213 Ga0207660_10029239 3300025917 Bacteria 3777
214 Ga0207657_10021994 3300025919 Bacteria 5987
215 Ga0207649_10057211 3300025920 Bacteria 2438
216 Ga0207649_10083425 3300025920 Bacteria 2074
217 Ga0207652_10051013 3300025921 Bacteria 3546
218 Ga0207652_10169834 3300025921 Bacteria 1957
219 Ga0207646_10001915 3300025922 Bacteria 25060
220 Ga0207646_10053007 3300025922 Bacteria 3629
221 Ga0207646_10154101 3300025922 Bacteria 2072
222 Ga0207646_10184059 3300025922 Bacteria 1887
223 Ga0207646_10273931 3300025922 Bacteria 1525
224 Ga0207694_10195765 3300025924 Bacteria 1643
225 Ga0207650_10002387 3300025925 Bacteria 13074
226 Ga0207659_10047818 3300025926 Bacteria 3027
227 Ga0207687_10026916 3300025927 Bacteria 3854
228 Ga0207700_10004451 3300025928 Bacteria 8262
229 Ga0207700_10004951 3300025928 Bacteria 7915
230 Ga0207700_10006886 3300025928 Bacteria 6910
231 Ga0207700_10358910 3300025928 Bacteria 1270
232 Ga0207664_10000956 3300025929 Bacteria 19483
233 Ga0207664_10001375 3300025929 Bacteria 15969
234 Ga0207664_10002280 3300025929 Bacteria 12643
235 Ga0207664_10047375 3300025929 Bacteria 3376
236 Ga0207664_10142634 3300025929 Bacteria 2028
237 Ga0207664_10212271 3300025929 Bacteria 1675
238 Ga0207644_10095973 3300025931 Bacteria 2218
239 Ga0207706_10029168 3300025933 Bacteria 4927
240 Ga0207706_10069675 3300025933 Bacteria 3093
241 Ga0207706_10182084 3300025933 Bacteria 1845
242 Ga0207709_10108361 3300025935 Bacteria 1852
243 Ga0207670_10037670 3300025936 Bacteria 3153
244 Ga0207704_10021936 3300025938 Bacteria 3412
245 Ga0207665_10026775 3300025939 Bacteria 3808
246 Ga0207665_10080747 3300025939 Bacteria 2237
247 Ga0207665_10175958 3300025939 Bacteria 1548
248 Ga0207691_10029431 3300025940 Bacteria 5138
249 Ga0207691_10085957 3300025940 Bacteria 2822
250 Ga0207711_10104148 3300025941 Bacteria 2514
251 Ga0207689_10033208 3300025942 Bacteria 4288
252 Ga0207679_10173140 3300025945 Bacteria 1779
253 Ga0207679_10192360 3300025945 Bacteria 1697
254 Ga0207667_10424045 3300025949 Bacteria 1353
255 Ga0207712_10113729 3300025961 Bacteria 2035
256 Ga0207712_10209916 3300025961 Bacteria 1550
257 Ga0207640_10036404 3300025981 Bacteria 3089
258 Ga0207640_10087137 3300025981 Bacteria 2151
259 Ga0207703_10016996 3300026035 Bacteria 5674
260 Ga0207678_10002126 3300026067 Bacteria 17944
261 Ga0207678_10013685 3300026067 Bacteria 7125
262 Ga0207702_10014978 3300026078 Bacteria 6433
263 Ga0207641_10044204 3300026088 Bacteria 3745
264 Ga0207676_10025085 3300026095 Bacteria 4421
265 Ga0207676_10172483 3300026095 Bacteria 1886
266 Ga0207674_10019663 3300026116 Bacteria 7313
267 Ga0207675_100049829 3300026118 Bacteria 3907
268 Ga0207675_100436164 3300026118 Bacteria 1296
269 Ga0207683_10000301 3300026121 Bacteria 44592
270 Ga0209971_1007637 3300027682 Bacteria 2566
271 Ga0209966_1003320 3300027695 Bacteria 2704
272 Ga0209998_10015181 3300027717 Bacteria 1610
273 Ga0209974_10004338 3300027876 Bacteria 5043
274 Ga0209974_10004884 3300027876 Bacteria 4744
275 Ga0207428_10174079 3300027907 Bacteria 1629
276 Ga0268265_10101407 3300028380 Bacteria 2326
277 Ga0268265_10254131 3300028380 Bacteria 1559
278 Ga0268264_10045564 3300028381 Bacteria 3641
279 Ga0268264_10123710 3300028381 Bacteria 2283
280 Ga0268264_10299908 3300028381 Bacteria 1512
281 Ga0265340_10007977 3300031247 Bacteria 5737
282 Ga0265314_10141108 3300031711 Bacteria 1489
283 Ga0307405_10070748 3300031731 Bacteria 2242
284 Ga0307413_10146642 3300031824 Bacteria 1639
285 Ga0307412_10004107 3300031911 Bacteria 8117
286 Ga0307414_10011055 3300032004 Bacteria 5278
287 Ga0373929_0010291 3300035085 Bacteria 1747
288 Ga0373929_0012709 3300035085 Bacteria 1604
289 Ga0373934_0029085 3300035086 Bacteria 2156
290 Ga0373960_0003724 3300035121 Bacteria 3465
291 Ga0373931_0032587 3300035691 Bacteria 2697
292 Ga0395899_0081544 3300037312 Bacteria 2353
293 Ga0395900_0028793 3300037418 Bacteria 5694
294 Ga0395900_0140757 3300037418 Bacteria 2470
295 Ga0395898_0023116 3300037466 Bacteria 6285
296 Ga0395898_0071543 3300037466 Bacteria 3351
297 Ga0395898_0351660 3300037466 Bacteria 1405
298 Ga0395905_0042063 3300037471 Bacteria 4287
299 Ga0395905_0379811 3300037471 Bacteria 1307
300 Ga0436364_0448042 3300037853 Bacteria 59308
301 Ga0395901_0022720 3300038443 Bacteria 6431
302 Ga0395901_0317159 3300038443 Bacteria 1613
303 Ga0436365_0031184 3300039437 Bacteria 25821
304 Ga0436365_0345555 3300039437 Bacteria 1608
305 Ga0436365_1544050 3300039437 Bacteria 19397
306 Ga0436363_1445715 3300039450 Bacteria 4182
307 Ga0436362_0607211 3300039453 Bacteria 2382
308 Ga0439441_014749 3300042001 Bacteria 1374
309 Ga0439449_0028677 3300042007 Bacteria 2075
310 Ga0451577_0078875 3300042876 Bacteria 2935
311 Ga0451577_0266255 3300042876 Bacteria 1552
312 Ga0466972_0046488 3300044658 Bacteria 2101
313 Ga0453683_0035241 3300044673 Bacteria 3154
314 Ga0453684_0107906 3300044712 Bacteria 3389
315 Ga0466960_0003143 3300044901 Bacteria 6331
316 Ga0466960_0072689 3300044901 Bacteria 1715
317 Ga0451576_0034088 3300045051 Bacteria 5409
318 Ga0451576_0122376 3300045051 Bacteria 2709
319 Ga0466967_0048259 3300045976 Bacteria 3717
320 Ga0495580_0002735 3300046472 Bacteria 15211
321 Ga0495580_0110374 3300046472 Bacteria 1910
322 Ga0495652_0091377 3300046529 Bacteria 2489
323 Ga0495645_0026104 3300046543 Bacteria 4240
324 Ga0495633_0137585 3300046558 Bacteria 1130
325 Ga0495674_0004008 3300047319 Bacteria 14266
326 Ga0496100_0001090 3300048903 Bacteria 13118
327 Ga0496101_0005640 3300048904 Bacteria 7985
328 Ga0496103_0022790 3300048906 Bacteria 3772
329 Ga0496105_0002636 3300048908 Bacteria 13055
330 Ga0496106_0012376 3300048909 Bacteria 6298
331 Ga0496107_0010134 3300048910 Bacteria 6537
332 Ga0496108_0003653 3300048911 Bacteria 12340
333 Ga0496109_0014225 3300048912 Bacteria 6920
334 Ga0496109_0133143 3300048912 Bacteria 2322
335 Ga0496110_0021563 3300048913 Bacteria 5457
336 Ga0496112_0032492 3300048915 Bacteria 5068
337 Ga0496113_0020821 3300048916 Bacteria 4618
338 Ga0496113_0092574 3300048916 Bacteria 2332
339 Ga0496115_0010039 3300048918 Bacteria 7057
340 Ga0501031_0007332 3300049568 Bacteria 7192
341 Ga0501031_0034582 3300049568 Bacteria 3298
342 Ga0501031_0123827 3300049568 Bacteria 1689
343 Ga0501032_0008877 3300049569 Bacteria 7309
344 Ga0501033_0009068 3300049570 Bacteria 7675
345 Ga0501033_0072723 3300049570 Bacteria 2524
346 Ga0501036_0013788 3300049572 Bacteria 6723
347 Ga0501036_0016260 3300049572 Bacteria 6214
348 Ga0501036_0034099 3300049572 Bacteria 4305
349 Ga0501036_0197463 3300049572 Bacteria 1692
350 Ga0501037_0028149 3300049573 Bacteria 4151
351 Ga0501037_0055281 3300049573 Bacteria 2902
352 Ga0501038_0003680 3300049574 Bacteria 14280
353 Ga0501038_0009182 3300049574 Bacteria 9075
354 Ga0501038_0018851 3300049574 Bacteria 6230
355 Ga0501038_0036520 3300049574 Bacteria 4311
356 Ga0501039_0001499 3300049575 Bacteria 17176
357 Ga0501039_0047800 3300049575 Bacteria 3308
358 Ga0501039_0075764 3300049575 Bacteria 2615
359 Ga0501040_0000010 3300049576 Bacteria 80841
360 Ga0501040_0001118 3300049576 Bacteria 16987
361 Ga0501040_0015012 3300049576 Bacteria 5117
362 Ga0501040_0024408 3300049576 Bacteria 4057
363 Ga0501040_0041927 3300049576 Bacteria 3117
364 Ga0501040_0189698 3300049576 Bacteria 1458
365 Ga0501040_0250678 3300049576 Bacteria 1263
366 Ga0501041_0000496 3300049577 Bacteria 20203
367 Ga0501041_0005979 3300049577 Bacteria 7119
368 Ga0501041_0025958 3300049577 Bacteria 3522
369 Ga0501041_0117696 3300049577 Bacteria 1650
370 Ga0501042_0002645 3300049578 Bacteria 11016
371 Ga0501042_0004171 3300049578 Bacteria 9184
372 Ga0501042_0016461 3300049578 Bacteria 5074
373 Ga0501042_0050166 3300049578 Bacteria 2976
374 Ga0501043_0005902 3300049579 Bacteria 9851
375 Ga0501043_0012970 3300049579 Bacteria 6513
376 Ga0501043_0084418 3300049579 Bacteria 2496
377 Ga0501046_0033663 3300049580 Bacteria 4138
378 Ga0501046_0079699 3300049580 Bacteria 2531
379 Ga0501046_0083602 3300049580 Bacteria 2463
380 Ga0501047_0019722 3300049581 Bacteria 6471
381 Ga0501048_0001209 3300049582 Bacteria 19566
382 Ga0501048_0010510 3300049582 Bacteria 6908
383 Ga0501048_0077820 3300049582 Bacteria 2341
384 Ga0501068_0002917 3300049584 Bacteria 9101
385 Ga0501070_0026677 3300049586 Bacteria 4846
386 Ga0501070_0102824 3300049586 Bacteria 2363
387 Ga0501071_0001035 3300049587 Bacteria 15367
388 Ga0501071_0003736 3300049587 Bacteria 9562
389 Ga0501071_0030567 3300049587 Bacteria 3811
390 Ga0501071_0049182 3300049587 Bacteria 3034
391 Ga0501071_0058368 3300049587 Bacteria 2790
392 Ga0501072_0002049 3300049588 Bacteria 14985
393 Ga0501072_0026412 3300049588 Bacteria 4528
394 Ga0501072_0041002 3300049588 Bacteria 3635
395 Ga0501072_0180835 3300049588 Bacteria 1682
396 Ga0501073_0042872 3300049589 Bacteria 3192
397 Ga0501074_0000201 3300049590 Bacteria 32529
398 Ga0501074_0005017 3300049590 Bacteria 9497
399 Ga0501074_0010807 3300049590 Bacteria 6629
400 Ga0501074_0018630 3300049590 Bacteria 5044
401 Ga0501075_0000090 3300049591 Bacteria 41736
402 Ga0501075_0010683 3300049591 Bacteria 6461
403 Ga0501075_0032875 3300049591 Bacteria 3857
404 Ga0501075_0110046 3300049591 Bacteria 2094
405 Ga0501075_0153022 3300049591 Bacteria 1758
406 Ga0501076_0015816 3300049592 Bacteria 5708
407 Ga0501076_0027993 3300049592 Bacteria 4372
408 Ga0501076_0037603 3300049592 Bacteria 3797
409 Ga0501076_0046397 3300049592 Bacteria 3433
410 Ga0501076_0107346 3300049592 Bacteria 2254
411 Ga0501076_0288606 3300049592 Bacteria 1344
412 Ga0501077_0000321 3300049593 Bacteria 28664
413 Ga0501077_0001385 3300049593 Bacteria 14609
414 Ga0501077_0037147 3300049593 Bacteria 3103
415 Ga0501079_0000063 3300049741 Bacteria 48461
416 Ga0501079_0000705 3300049741 Bacteria 22580
417 Ga0501079_0004544 3300049741 Bacteria 10294
418 Ga0501079_0034639 3300049741 Bacteria 3885
419 Ga0501080_0003347 3300049742 Bacteria 14158
420 Ga0501080_0003842 3300049742 Bacteria 13268
421 Ga0501080_0046852 3300049742 Bacteria 4024
422 Ga0501080_0061128 3300049742 Bacteria 3507
423 Ga0501081_0000085 3300049743 Bacteria 37187
424 Ga0501081_0000206 3300049743 Bacteria 28944
425 Ga0501081_0011320 3300049743 Bacteria 5836
426 Ga0501083_0016441 3300049744 Bacteria 5179
427 Ga0501083_0017449 3300049744 Bacteria 5003
428 Ga0501035_0011789 3300049822 Bacteria 8093
429 Ga0501035_0138401 3300049822 Bacteria 2118
430 Ga0501044_0014918 3300049823 Bacteria 8378
431 Ga0501044_0160195 3300049823 Bacteria 2228
432 Ga0501045_0000411 3300049824 Bacteria 25957
433 Ga0501045_0001246 3300049824 Bacteria 16923
434 Ga0501045_0016235 3300049824 Bacteria 5285
435 Ga0501045_0113116 3300049824 Bacteria 2013
436 nmdc:mga05p37_219362_c1 3300050507 Bacteria 2296
437 nmdc:mga05p37_57205_c1 3300050507 Bacteria 4803
438 nmdc:mga09592_111883_c1 3300050508 Bacteria 2343
439 nmdc:mga0qj67_135727_c1 3300050509 Bacteria 1994
440 nmdc:mga06r32_35331_c1 3300050510 Bacteria 4716
441 nmdc:mga06r32_70035_c1 3300050510 Bacteria 3391
442 nmdc:mga08y16_115182_c1 3300050511 Bacteria 2798
443 nmdc:mga08y16_33431_c1 3300050511 Bacteria 5401
444 nmdc:mga0n895_117703_c1 3300050512 Bacteria 2677
445 nmdc:mga0n895_165874_c1 3300050512 Bacteria 2240
446 nmdc:mga0n895_18469_c1 3300050512 Bacteria 6453
447 nmdc:mga0n895_282625_c1 3300050512 Bacteria 1683
448 nmdc:mga0n895_3979_c1 3300050512 Bacteria 12016
449 nmdc:mga0n895_966_c1 3300050512 Bacteria 20843
450 nmdc:mga0rr50_176348_c1 3300050513 Bacteria 1745
451 nmdc:mga0rr50_46279_c1 3300050513 Bacteria 3203
452 nmdc:mga0rr50_6292_c1 3300050513 Bacteria 7208
453 nmdc:mga08x19_33482_c1 3300050514 Bacteria 3243
454 nmdc:mga0a205_10356_c1 3300050515 Bacteria 8570
455 nmdc:mga0a205_108914_c1 3300050515 Bacteria 2668
456 nmdc:mga0a205_154808_c1 3300050515 Bacteria 2191
457 nmdc:mga0a205_216701_c1 3300050515 Bacteria 1801
458 nmdc:mga0a205_47548_c1 3300050515 Bacteria 3618
459 nmdc:mga0a205_54994_c1 3300050515 Bacteria 3844
460 nmdc:mga0a205_85665_c1 3300050515 Bacteria 3043
461 nmdc:mga0sz30_618_c1 3300050516 Bacteria 13171
462 Ga0495601_0175771 3300053077 Bacteria 1400
463 Ga0500573_0095416 3300053140 Bacteria 1677
464 Ga0500622_0060047 3300053156 Bacteria 1941
465 Ga0501084_0002692 3300054114 Bacteria 14308
466 Ga0501084_0003324 3300054114 Bacteria 13010
467 Ga0501084_0006990 3300054114 Bacteria 9298
468 Ga0501084_0017417 3300054114 Bacteria 5972
469 Ga0501082_0001750 3300060353 Bacteria 19124
470 Ga0501082_0002602 3300060353 Bacteria 15775
471 Ga0501082_0015564 3300060353 Bacteria 6549
472 Ga0501082_0059694 3300060353 Bacteria 3286
473 Ga0501082_0192310 3300060353 Bacteria 1775
474 Ga0530510_0004298 3300061734 Bacteria 9856
475 Ga0530510_0004782 3300061734 Bacteria 9377
476 Ga0530510_0006183 3300061734 Bacteria 8322
477 Ga0530510_0020612 3300061734 Bacteria 4687
478 Ga0530510_0071580 3300061734 Bacteria 2516
479 Ga0530510_0071696 3300061734 Bacteria 2514
480 Ga0530510_0076849 3300061734 Bacteria 2426
481 2508728412 2508501050 Bacteria 9633614
482 2509078445 2508501114 Bacteria 7082538
483 2511384828 2511231026 Bacteria 5225445
484 2513909436 2513237144 Bacteria 7530820
485 2774873406 2773857925 Bacteria 6472445
486 2776259661 2775506901 Bacteria 9631051
487 2824671573 2824671348 Bacteria 8369588
488 2824688181 2824687955 Bacteria 8360029
489 2824696464 2824696289 Bacteria 8335049
490 2835317889 2835312727 Bacteria 7413381
491 2857592129 2857591370 Bacteria 6569758
492 2861696088 2861691609 Bacteria 5628931
493 2874609976 2874604998 Bacteria 7834745
494 2882458232 2882456835 Bacteria 6863978
495 2884299855 2884298095 Bacteria 3823049
496 2894239700 2894232714 Bacteria 8834183
497 2935711260 2935703347 Bacteria 10242284
498 2935781777 2935777560 Bacteria 8077691
499 2935846954 2935837841 Bacteria 9454360
500 2935916381 2935908558 Bacteria 8568796
501 2935925709 2935916978 Bacteria 9113783
502 2935933788 2935926038 Bacteria 8601059
503 2935942404 2935934488 Bacteria 8602579
504 2935950849 2935942939 Bacteria 8599779
505 2935959305 2935951376 Bacteria 8602333
506 2935967284 2935959822 Bacteria 7869783
507 2935975558 2935967501 Bacteria 8603075
508 3005717007 3005710791 Bacteria 7622528
509 8019585499 8019576017 Bacteria 10049540
510 8019597993 8019597564 Bacteria 10041141
511 8019610388 8019608314 Bacteria 10042931
512 8019692704 8019687851 Bacteria 8712826
513 Ga0209982_1005646
514 JGI25155J39150_1000038
515 JGI25156J39149_1000048
516 JGI25154J39366_1000071
517 JGI25157J39369_1000200
518 Ga0055532_1000571
519 Ga0065712_10069080
520 Ga0065715_10006436
521 Ga0065707_10091530
522 Ga0070658_10097657
523 Ga0070676_10011517
524 Ga0070683_100302758
525 Ga0070690_100021474
526 Ga0070670_100004243
527 Ga0068869_100015958
528 Ga0068869_100174757
529 Ga0070666_10103591
530 Ga0070680_100034644
531 Ga0070682_100007427
532 Ga0070682_100085807
533 Ga0068868_100141818
534 Ga0070689_100079293
535 Ga0070689_100231494
536 Ga0070691_10000599
537 Ga0070661_100003346
538 Ga0070668_100134959
539 Ga0070669_100005285
540 Ga0070671_100001934
541 Ga0070674_100129389
542 Ga0070673_100009901
543 Ga0070659_100194416
544 Ga0070709_10003006
545 Ga0070709_10016401
546 Ga0070709_10023291
547 Ga0070714_100000685
548 Ga0070714_100002782
549 Ga0070714_100024528
550 Ga0070714_100060953
551 Ga0070714_100163950
552 Ga0070713_100001510
553 Ga0070713_100016356
554 Ga0070713_100289661
555 Ga0070710_10006866
556 Ga0070710_10019725
557 Ga0070710_10221697
558 Ga0070701_10018993
559 Ga0070711_100028250
560 Ga0070705_100007985
561 Ga0070705_100026520
562 Ga0070705_100190249
563 Ga0070708_100000483
564 Ga0070708_100235473
565 Ga0070663_100001526
566 Ga0070678_100000819
567 Ga0070662_100170608
568 Ga0070681_10011623
569 Ga0070681_10013597
570 Ga0070681_10016898
571 Ga0070706_100273935
572 Ga0070706_100276707
573 Ga0070707_100031310
574 Ga0070707_100087944
575 Ga0070707_100094001
576 Ga0070707_100202276
577 Ga0070698_100003141
578 Ga0070698_100005255
579 Ga0070698_100054670
580 Ga0070698_100213710
581 Ga0070698_100286171
582 Ga0070698_100311550
583 Ga0070699_100000935
584 Ga0070699_100003959
585 Ga0070699_100169348
586 Ga0070679_100213460
587 Ga0070684_100003117
588 Ga0070684_100042987
589 Ga0070697_100026677
590 Ga0070697_100028158
591 Ga0070697_100248584
592 Ga0070686_100012410
593 Ga0070686_100026173
594 Ga0070695_100031805
595 Ga0070696_100014749
596 Ga0070696_100021766
597 Ga0070696_100065228
598 Ga0070693_100003252
599 Ga0070665_100016729
600 Ga0070665_100032848
601 Ga0070665_100105818
602 Ga0070704_100006328
603 Ga0070704_100010427
604 Ga0068855_100030721
605 Ga0068855_100114948
606 Ga0070664_100035094
607 Ga0070664_100156761
608 Ga0068857_100003486
609 Ga0068857_100077164
610 Ga0068857_100219050
611 Ga0068854_100012499
612 Ga0068854_100079494
613 Ga0068856_100020387
614 Ga0068852_100037571
615 Ga0068859_100172167
616 Ga0068858_100079346
617 Ga0068862_100006607
618 Ga0068862_100116579
619 Ga0081455_10001305
620 Ga0081455_10002371
621 Ga0081455_10008070
622 Ga0081538_10003737
623 Ga0081539_10000288
624 Ga0081539_10010690
625 Ga0070717_10074245
626 Ga0070717_10102792
627 Ga0070717_10183398
628 Ga0070716_100024985
629 Ga0070716_100029678
630 Ga0070716_100118598
631 Ga0070716_100144421
632 Ga0070712_100048992
633 Ga0075369_10007038
634 Ga0097621_100014750
635 Ga0068871_100002232
636 Ga0075428_100001507
637 Ga0075430_100069695
638 Ga0075431_100012063
639 Ga0075431_100015569
640 Ga0075431_100145166
641 Ga0075433_10016879
642 Ga0075433_10026648
643 Ga0075433_10058748
644 Ga0075433_10075909
645 Ga0075433_10094788
646 Ga0075434_100003058
647 Ga0075434_100003204
648 Ga0075434_100025717
649 Ga0075434_100043898
650 Ga0075434_100131500
651 Ga0075434_100142332
652 Ga0068865_100016403
653 Ga0097620_100172169
654 Ga0079104_1002622
655 Ga0075435_100003095
656 Ga0075435_100056142
657 Ga0075435_100130174
658 Ga0099794_10019870
659 Ga0099795_10033353
660 Ga0105240_10112128
661 Ga0111539_10001442
662 Ga0111539_10033206
663 Ga0111539_10115331
664 Ga0105245_10016162
665 Ga0105247_10011587
666 Ga0114129_10155161
667 Ga0105243_10030670
668 Ga0105243_10151277
669 Ga0105241_10004489
670 Ga0105241_10160996
671 Ga0105242_10058460
672 Ga0105248_10026140
673 Ga0105248_10221599
674 Ga0105237_10022216
675 Ga0105249_10032128
676 Ga0105249_10034017
677 Ga0105249_10074238
678 Ga0105249_10095266
679 Ga0105246_10003589
680 Ga0105246_10078897
681 Ga0157373_10016246
682 Ga0157369_10047634
683 Ga0157374_10012771
684 Ga0157374_10013502
685 Ga0157378_10231846
686 Ga0163162_10026299
687 Ga0163162_10027745
688 Ga0163162_10042933
689 Ga0157372_10052554
690 Ga0157375_10173709
691 Ga0157375_10470987
692 Ga0163163_10014779
693 Ga0157377_10008395
694 Ga0157376_10003405
695 Ga0157376_10008372
696 Ga0214544_1012884
697 Ga0214542_1012745
698 Ga0214545_1014166
699 Ga0214543_1013104
700 Ga0213876_10004431
701 Ga0213876_10055280
702 Ga0209435_100030
703 Ga0209147_100004
704 Ga0209258_100893
705 Ga0209646_1000100
706 Ga0209026_1000091
707 Ga0209759_1000084
708 Ga0207697_10014287
709 Ga0207682_10022364
710 Ga0207692_10009508
711 Ga0207699_10002452
712 Ga0207699_10003664
713 Ga0207699_10108183
714 Ga0207645_10070191
715 Ga0207684_10089573
716 Ga0207684_10140990
717 Ga0207684_10191671
718 Ga0207707_10000920
719 Ga0207707_10091184
720 Ga0207707_10329135
721 Ga0207671_10025471
722 Ga0207693_10014905
723 Ga0207693_10019523
724 Ga0207663_10009670
725 Ga0207660_10029239
726 Ga0207657_10021994
727 Ga0207649_10057211
728 Ga0207649_10083425
729 Ga0207652_10051013
730 Ga0207652_10169834
731 Ga0207646_10001915
732 Ga0207646_10053007
733 Ga0207646_10154101
734 Ga0207646_10184059
735 Ga0207646_10273931
736 Ga0207694_10195765
737 Ga0207650_10002387
738 Ga0207659_10047818
739 Ga0207687_10026916
740 Ga0207700_10004451
741 Ga0207700_10004951
742 Ga0207700_10006886
743 Ga0207700_10358910
744 Ga0207664_10000956
745 Ga0207664_10001375
746 Ga0207664_10002280
747 Ga0207664_10047375
748 Ga0207664_10142634
749 Ga0207664_10212271
750 Ga0207644_10095973
751 Ga0207706_10029168
752 Ga0207706_10069675
753 Ga0207706_10182084
754 Ga0207709_10108361
755 Ga0207670_10037670
756 Ga0207704_10021936
757 Ga0207665_10026775
758 Ga0207665_10080747
759 Ga0207665_10175958
760 Ga0207691_10029431
761 Ga0207691_10085957
762 Ga0207711_10104148
763 Ga0207689_10033208
764 Ga0207679_10173140
765 Ga0207679_10192360
766 Ga0207667_10424045
767 Ga0207712_10113729
768 Ga0207712_10209916
769 Ga0207640_10036404
770 Ga0207640_10087137
771 Ga0207703_10016996
772 Ga0207678_10002126
773 Ga0207678_10013685
774 Ga0207702_10014978
775 Ga0207641_10044204
776 Ga0207676_10025085
777 Ga0207676_10172483
778 Ga0207674_10019663
779 Ga0207675_100049829
780 Ga0207675_100436164
781 Ga0207683_10000301
782 Ga0209971_1007637
783 Ga0209966_1003320
784 Ga0209998_10015181
785 Ga0209974_10004338
786 Ga0209974_10004884
787 Ga0207428_10174079
788 Ga0268265_10101407
789 Ga0268265_10254131
790 Ga0268264_10045564
791 Ga0268264_10123710
792 Ga0268264_10299908
793 Ga0265340_10007977
794 Ga0265314_10141108
795 Ga0307405_10070748
796 Ga0307413_10146642
797 Ga0307412_10004107
798 Ga0307414_10011055
799 Ga0373929_0010291
800 Ga0373929_0012709
801 Ga0373934_0029085
802 Ga0373960_0003724
803 Ga0373931_0032587
804 Ga0395899_0081544
805 Ga0395900_0028793
806 Ga0395900_0140757
807 Ga0395898_0023116
808 Ga0395898_0071543
809 Ga0395898_0351660
810 Ga0395905_0042063
811 Ga0395905_0379811
812 Ga0436364_0448042
813 Ga0395901_0022720
814 Ga0395901_0317159
815 Ga0436365_0031184
816 Ga0436365_0345555
817 Ga0436365_1544050
818 Ga0436363_1445715
819 Ga0436362_0607211
820 Ga0439441_014749
821 Ga0439449_0028677
822 Ga0451577_0078875
823 Ga0451577_0266255
824 Ga0466972_0046488
825 Ga0453683_0035241
826 Ga0453684_0107906
827 Ga0466960_0003143
828 Ga0466960_0072689
829 Ga0451576_0034088
830 Ga0451576_0122376
831 Ga0466967_0048259
832 Ga0495580_0002735
833 Ga0495580_0110374
834 Ga0495652_0091377
835 Ga0495645_0026104
836 Ga0495633_0137585
837 Ga0495674_0004008
838 Ga0496100_0001090
839 Ga0496101_0005640
840 Ga0496103_0022790
841 Ga0496105_0002636
842 Ga0496106_0012376
843 Ga0496107_0010134
844 Ga0496108_0003653
845 Ga0496109_0014225
846 Ga0496109_0133143
847 Ga0496110_0021563
848 Ga0496112_0032492
849 Ga0496113_0020821
850 Ga0496113_0092574
851 Ga0496115_0010039
852 Ga0501031_0007332
853 Ga0501031_0034582
854 Ga0501031_0123827
855 Ga0501032_0008877
856 Ga0501033_0009068
857 Ga0501033_0072723
858 Ga0501036_0013788
859 Ga0501036_0016260
860 Ga0501036_0034099
861 Ga0501036_0197463
862 Ga0501037_0028149
863 Ga0501037_0055281
864 Ga0501038_0003680
865 Ga0501038_0009182
866 Ga0501038_0018851
867 Ga0501038_0036520
868 Ga0501039_0001499
869 Ga0501039_0047800
870 Ga0501039_0075764
871 Ga0501040_0000010
872 Ga0501040_0001118
873 Ga0501040_0015012
874 Ga0501040_0024408
875 Ga0501040_0041927
876 Ga0501040_0189698
877 Ga0501040_0250678
878 Ga0501041_0000496
879 Ga0501041_0005979
880 Ga0501041_0025958
881 Ga0501041_0117696
882 Ga0501042_0002645
883 Ga0501042_0004171
884 Ga0501042_0016461
885 Ga0501042_0050166
886 Ga0501043_0005902
887 Ga0501043_0012970
888 Ga0501043_0084418
889 Ga0501046_0033663
890 Ga0501046_0079699
891 Ga0501046_0083602
892 Ga0501047_0019722
893 Ga0501048_0001209
894 Ga0501048_0010510
895 Ga0501048_0077820
896 Ga0501068_0002917
897 Ga0501070_0026677
898 Ga0501070_0102824
899 Ga0501071_0001035
900 Ga0501071_0003736
901 Ga0501071_0030567
902 Ga0501071_0049182
903 Ga0501071_0058368
904 Ga0501072_0002049
905 Ga0501072_0026412
906 Ga0501072_0041002
907 Ga0501072_0180835
908 Ga0501073_0042872
909 Ga0501074_0000201
910 Ga0501074_0005017
911 Ga0501074_0010807
912 Ga0501074_0018630
913 Ga0501075_0000090
914 Ga0501075_0010683
915 Ga0501075_0032875
916 Ga0501075_0110046
917 Ga0501075_0153022
918 Ga0501076_0015816
919 Ga0501076_0027993
920 Ga0501076_0037603
921 Ga0501076_0046397
922 Ga0501076_0107346
923 Ga0501076_0288606
924 Ga0501077_0000321
925 Ga0501077_0001385
926 Ga0501077_0037147
927 Ga0501079_0000063
928 Ga0501079_0000705
929 Ga0501079_0004544
930 Ga0501079_0034639
931 Ga0501080_0003347
932 Ga0501080_0003842
933 Ga0501080_0046852
934 Ga0501080_0061128
935 Ga0501081_0000085
936 Ga0501081_0000206
937 Ga0501081_0011320
938 Ga0501083_0016441
939 Ga0501083_0017449
940 Ga0501035_0011789
941 Ga0501035_0138401
942 Ga0501044_0014918
943 Ga0501044_0160195
944 Ga0501045_0000411
945 Ga0501045_0001246
946 Ga0501045_0016235
947 Ga0501045_0113116
948 nmdc:mga05p37_219362_c1
949 nmdc:mga05p37_57205_c1
950 nmdc:mga09592_111883_c1
951 nmdc:mga0qj67_135727_c1
952 nmdc:mga06r32_35331_c1
953 nmdc:mga06r32_70035_c1
954 nmdc:mga08y16_115182_c1
955 nmdc:mga08y16_33431_c1
956 nmdc:mga0n895_117703_c1
957 nmdc:mga0n895_165874_c1
958 nmdc:mga0n895_18469_c1
959 nmdc:mga0n895_282625_c1
960 nmdc:mga0n895_3979_c1
961 nmdc:mga0n895_966_c1
962 nmdc:mga0rr50_176348_c1
963 nmdc:mga0rr50_46279_c1
964 nmdc:mga0rr50_6292_c1
965 nmdc:mga08x19_33482_c1
966 nmdc:mga0a205_10356_c1
967 nmdc:mga0a205_108914_c1
968 nmdc:mga0a205_154808_c1
969 nmdc:mga0a205_216701_c1
970 nmdc:mga0a205_47548_c1
971 nmdc:mga0a205_54994_c1
972 nmdc:mga0a205_85665_c1
973 nmdc:mga0sz30_618_c1
974 Ga0495601_0175771
975 Ga0500573_0095416
976 Ga0500622_0060047
977 Ga0501084_0002692
978 Ga0501084_0003324
979 Ga0501084_0006990
980 Ga0501084_0017417
981 Ga0501082_0001750
982 Ga0501082_0002602
983 Ga0501082_0015564
984 Ga0501082_0059694
985 Ga0501082_0192310
986 Ga0530510_0004298
987 Ga0530510_0004782
988 Ga0530510_0006183
989 Ga0530510_0020612
990 Ga0530510_0071580
991 Ga0530510_0071696
992 Ga0530510_0076849
993 2508728412
994 2509078445
995 2511384828
996 2513909436
997 2774873406
998 2776259661
999 2824671573
1000 2824688181
1001 2824696464
1002 2835317889
1003 2857592129
1004 2861696088
1005 2874609976
1006 2882458232
1007 2884299855
1008 2894239700
1009 2935711260
1010 2935781777
1011 2935846954
1012 2935916381
1013 2935925709
1014 2935933788
1015 2935942404
1016 2935950849
1017 2935959305
1018 2935967284
1019 2935975558
1020 3005717007
1021 8019585499
1022 8019597993
1023 8019610388
1024 8019692704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

60

209

0.96

PF08402

TOBE_2

TOBE domain

330

405

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9652 8 239
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9437 8 218
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9415 8 223
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9389 6 222
4mki-assembly1.cif.gz_B cobalt transporter atp-binding subunit 0.9372 6 228
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9724 6 223 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 8 242 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 6 223 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 8 241 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9584 8 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9837 8 227 GO:0005524
GO:0016887
GO:0055052
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9804 8 231 GO:0005524
GO:0016887
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9785 2 222 GO:0005524
GO:0016887
AF-A0A519YL00-F1-model_v4 deleted 0.9767 5 239
AF-A6DHY6-F1-model_v4 Putative multiple sugar transport protein 0.9743 8 218 GO:0005524
GO:0016887

Map