F457438

General Info

Members Datasets Scaffolds Average Seq Length
512 265 489 368

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10065858|Ga0268266_100658583
Length 382
Sequence LRLKLDSLRLYNRRMTQGPLDFTLARSTKPASDDVRAEILADPGFGRFHTDHMVSIDYRAGQGWHNAQVLPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPEANAARLQTSAERLAIPPLPKDAFLDSLRQLIAVDADWVPAAGGEESLYLRPFIFATEPGLGVRPSEEYRYMVIASPAGAYFKGGLKPVSVWLSTEYVRASPGGTGAAKFGGNYAASLLAQAQAADHGCDQVVWLDAIERRYVEEMGGMNLFFVLGSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKKAAEGEITEVFACGTAAVITPVSHVKFTEGEFTIGDGAPGEVTVALRDTLTGIQRGKFADTHGWMTRLG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
11 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
12 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
13 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
14 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
15 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
16 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
17 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
18 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
19 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
20 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
25 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
162 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
257 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
258 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.06
Nodule 0.2
Rhizoplane 13.67
Rhizosphere 58.01
Stem 0
Stem Tuber 0
Unclassified 14.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1475941 2162886007 Bacteria 1490
2 LJNas_1003678 3300000546 Bacteria 1750
3 JGI24737J22298_10012613 3300001990 Bacteria 2755
4 JGI24748J21848_1001167 3300002074 Bacteria 2868
5 JGI24744J21845_10001002 3300002077 Bacteria 5412
6 JGI24742J22300_10002567 3300002244 Bacteria 2902
7 JGI24751J29686_10005117 3300002459 Bacteria 2669
8 rootH2_10035322 3300003320 Bacteria 23945
9 rootH2_10073720 3300003320 Bacteria 11217
10 Ga0055540_1000675 3300003792 Bacteria 23724
11 Ga0055540_1004498 3300003792 Bacteria 6252
12 Ga0065704_10071183 3300005289 Bacteria 12624
13 Ga0070690_100016349 3300005330 Bacteria 4443
14 Ga0070666_10068923 3300005335 Bacteria 2404
15 Ga0070682_100000620 3300005337 Bacteria 21599
16 Ga0070682_100002412 3300005337 Bacteria 10350
17 Ga0070682_100073048 3300005337 Bacteria 2199
18 Ga0070682_100101275 3300005337 Bacteria 1902
19 Ga0070691_10025793 3300005341 Bacteria 2738
20 Ga0070668_100002504 3300005347 Bacteria 13529
21 Ga0070668_100018841 3300005347 Bacteria 5186
22 Ga0070669_100000080 3300005353 Bacteria 92960
23 Ga0070669_100001642 3300005353 Bacteria 16209
24 Ga0070675_100134313 3300005354 Bacteria 2111
25 Ga0070671_100002010 3300005355 Bacteria 15628
26 Ga0070671_100008938 3300005355 Bacteria 8039
27 Ga0070674_100000840 3300005356 Bacteria 15910
28 Ga0070674_100057733 3300005356 Bacteria 2695
29 Ga0070667_100000226 3300005367 Bacteria 64893
30 Ga0070667_100000249 3300005367 Bacteria 61169
31 Ga0070667_100000903 3300005367 Bacteria 27436
32 Ga0070667_100058969 3300005367 Bacteria 3246
33 Ga0070714_100236729 3300005435 Bacteria 1684
34 Ga0070713_100049762 3300005436 Bacteria 3459
35 Ga0070710_10003939 3300005437 Bacteria 7035
36 Ga0070701_10010903 3300005438 Bacteria 4037
37 Ga0070711_100000208 3300005439 Bacteria 31129
38 Ga0070711_100028313 3300005439 Bacteria 3686
39 Ga0070663_100010341 3300005455 Bacteria 5817
40 Ga0070662_100008785 3300005457 Bacteria 6589
41 Ga0068867_100023096 3300005459 Bacteria 4451
42 Ga0070679_100110863 3300005530 Bacteria 2730
43 Ga0068853_100057874 3300005539 Bacteria 3346
44 Ga0070695_100038255 3300005545 Bacteria 3026
45 Ga0070665_100001980 3300005548 Bacteria 23047
46 Ga0070665_100088107 3300005548 Bacteria 3110
47 Ga0070704_100000212 3300005549 Bacteria 24326
48 Ga0070704_100144089 3300005549 Bacteria 1864
49 Ga0068859_100000266 3300005617 Bacteria 52170
50 Ga0068864_100043810 3300005618 Bacteria 3833
51 Ga0068866_10000357 3300005718 Bacteria 21454
52 Ga0068861_100000249 3300005719 Bacteria 29767
53 Ga0068863_100000843 3300005841 Bacteria 30754
54 Ga0068863_100019121 3300005841 Bacteria 6557
55 Ga0068863_100335592 3300005841 Bacteria 1470
56 Ga0068858_100004695 3300005842 Bacteria 13393
57 Ga0068858_100085357 3300005842 Bacteria 2937
58 Ga0068858_100138025 3300005842 Bacteria 2288
59 Ga0068860_100000166 3300005843 Bacteria 108310
60 Ga0068860_100027360 3300005843 Bacteria 5494
61 Ga0068860_100090950 3300005843 Bacteria 2907
62 Ga0068862_100000247 3300005844 Bacteria 60325
63 Ga0068862_100002938 3300005844 Bacteria 14900
64 Ga0068862_100127103 3300005844 Bacteria 2251
65 Ga0075365_10019706 3300006038 Bacteria 4170
66 Ga0075365_10070315 3300006038 Bacteria 2354
67 Ga0075363_100001777 3300006048 Bacteria 8434
68 Ga0075363_100003454 3300006048 Bacteria 6720
69 Ga0075363_100004998 3300006048 Bacteria 5864
70 Ga0075363_100020072 3300006048 Bacteria 3348
71 Ga0075363_100085021 3300006048 Bacteria 1735
72 Ga0075364_10000511 3300006051 Bacteria 19734
73 Ga0075364_10002993 3300006051 Bacteria 9545
74 Ga0075364_10005981 3300006051 Bacteria 7110
75 Ga0075364_10014207 3300006051 Bacteria 4915
76 Ga0075364_10033231 3300006051 Bacteria 3320
77 Ga0075364_10085331 3300006051 Bacteria 2091
78 Ga0070715_10000525 3300006163 Bacteria 10028
79 Ga0070712_100008387 3300006175 Bacteria 6498
80 Ga0075367_10011891 3300006178 Bacteria 4623
81 Ga0075369_10001636 3300006186 Bacteria 7723
82 Ga0075369_10002674 3300006186 Bacteria 6384
83 Ga0075369_10005726 3300006186 Bacteria 4663
84 Ga0075369_10022448 3300006186 Bacteria 2603
85 Ga0075369_10038448 3300006186 Bacteria 2041
86 Ga0075369_10069864 3300006186 Bacteria 1545
87 Ga0075369_10090161 3300006186 Bacteria 1367
88 Ga0075370_10014913 3300006353 Bacteria 4153
89 Ga0075370_10023935 3300006353 Bacteria 3369
90 Ga0075370_10079950 3300006353 Bacteria 1878
91 Ga0075370_10089116 3300006353 Bacteria 1779
92 Ga0075370_10090454 3300006353 Bacteria 1765
93 Ga0075370_10197735 3300006353 Bacteria 1185
94 Ga0075428_100002487 3300006844 Bacteria 20006
95 Ga0075430_100055546 3300006846 Bacteria 3330
96 Ga0075431_100269121 3300006847 Bacteria 1727
97 Ga0097620_100000266 3300006931 Bacteria 52170
98 Ga0105250_10043212 3300009092 Bacteria 1806
99 Ga0111539_10092582 3300009094 Bacteria 3552
100 Ga0105245_10001551 3300009098 Bacteria 20833
101 Ga0105245_10188213 3300009098 Bacteria 1976
102 Ga0105247_10000006 3300009101 Bacteria 416061
103 Ga0105247_10001045 3300009101 Bacteria 20770
104 Ga0105247_10122161 3300009101 Bacteria 1689
105 Ga0114129_10016492 3300009147 Bacteria 10517
106 Ga0105241_10005541 3300009174 Bacteria 9330
107 Ga0105241_10008661 3300009174 Bacteria 7479
108 Ga0105242_10000519 3300009176 Bacteria 30234
109 Ga0105248_10000042 3300009177 Bacteria 167583
110 Ga0105248_10015431 3300009177 Bacteria 8421
111 Ga0105248_10023260 3300009177 Bacteria 6881
112 Ga0105248_10124680 3300009177 Bacteria 2906
113 Ga0105237_10006199 3300009545 Bacteria 13344
114 Ga0105238_10418384 3300009551 Bacteria 1335
115 Ga0105249_10000008 3300009553 Bacteria 341271
116 Ga0105249_10236074 3300009553 Bacteria 1806
117 Ga0105239_10007894 3300010375 Bacteria 12165
118 Ga0105239_10031954 3300010375 Bacteria 5784
119 Ga0157378_10000520 3300013297 Bacteria 36656
120 Ga0163162_10019157 3300013306 Bacteria 6711
121 Ga0163162_10022853 3300013306 Bacteria 6165
122 Ga0163162_10141766 3300013306 Bacteria 2517
123 Ga0157372_10127775 3300013307 Bacteria 2923
124 Ga0157372_10288839 3300013307 Bacteria 1907
125 Ga0163163_10181115 3300014325 Bacteria 2154
126 Ga0157379_10113788 3300014968 Bacteria 2432
127 Ga0157376_10044930 3300014969 Bacteria 3634
128 Ga0213876_10004000 3300021384 Bacteria 8301
129 Ga0213876_10032675 3300021384 Bacteria 2744
130 Ga0213876_10099729 3300021384 Bacteria 1539
131 Ga0213875_10016831 3300021388 Bacteria 3541
132 Ga0209673_1007932 3300025273 Bacteria 4797
133 Ga0209051_1000076 3300025303 Bacteria 204355
134 Ga0209051_1001460 3300025303 Bacteria 20038
135 Ga0209051_1001562 3300025303 Bacteria 18944
136 Ga0209051_1006898 3300025303 Bacteria 6308
137 Ga0207713_1012425 3300025735 Bacteria 4554
138 Ga0207692_10015572 3300025898 Bacteria 3349
139 Ga0207642_10000711 3300025899 Bacteria 10291
140 Ga0207642_10049518 3300025899 Bacteria 1889
141 Ga0207710_10000114 3300025900 Bacteria 101498
142 Ga0207710_10047887 3300025900 Bacteria 1912
143 Ga0207680_10141449 3300025903 Bacteria 1595
144 Ga0207647_10023977 3300025904 Bacteria 4028
145 Ga0207647_10103416 3300025904 Bacteria 1689
146 Ga0207671_10012121 3300025914 Bacteria 6960
147 Ga0207693_10000824 3300025915 Bacteria 27611
148 Ga0207693_10001335 3300025915 Bacteria 21801
149 Ga0207663_10001018 3300025916 Bacteria 12845
150 Ga0207663_10059807 3300025916 Bacteria 2412
151 Ga0207660_10116184 3300025917 Bacteria 2021
152 Ga0207662_10151243 3300025918 Bacteria 1476
153 Ga0207681_10000049 3300025923 Bacteria 120296
154 Ga0207681_10009971 3300025923 Bacteria 5813
155 Ga0207659_10107588 3300025926 Bacteria 2114
156 Ga0207687_10000930 3300025927 Bacteria 19965
157 Ga0207664_10077201 3300025929 Bacteria 2698
158 Ga0207644_10003413 3300025931 Bacteria 10253
159 Ga0207644_10019296 3300025931 Bacteria 4623
160 Ga0207644_10024691 3300025931 Bacteria 4128
161 Ga0207686_10008836 3300025934 Bacteria 5448
162 Ga0207709_10001522 3300025935 Bacteria 15990
163 Ga0207669_10001180 3300025937 Bacteria 11077
164 Ga0207669_10050133 3300025937 Bacteria 2493
165 Ga0207704_10000949 3300025938 Bacteria 12819
166 Ga0207691_10090311 3300025940 Bacteria 2746
167 Ga0207691_10355312 3300025940 Bacteria 1253
168 Ga0207711_10001104 3300025941 Bacteria 25766
169 Ga0207711_10014732 3300025941 Bacteria 6497
170 Ga0207689_10005803 3300025942 Bacteria 10952
171 Ga0207667_10000194 3300025949 Bacteria 88799
172 Ga0207667_10026993 3300025949 Bacteria 6264
173 Ga0207651_10127975 3300025960 Bacteria 1939
174 Ga0207712_10000011 3300025961 Bacteria 412321
175 Ga0207712_10003923 3300025961 Bacteria 9397
176 Ga0207712_10097559 3300025961 Bacteria 2178
177 Ga0207668_10061705 3300025972 Bacteria 2637
178 Ga0207640_10000683 3300025981 Bacteria 19708
179 Ga0207658_10000071 3300025986 Bacteria 112481
180 Ga0207658_10001895 3300025986 Bacteria 15654
181 Ga0207658_10003276 3300025986 Bacteria 11500
182 Ga0207658_10039413 3300025986 Bacteria 3408
183 Ga0207658_10265590 3300025986 Bacteria 1464
184 Ga0207703_10016341 3300026035 Bacteria 5785
185 Ga0207703_10067422 3300026035 Bacteria 2945
186 Ga0207639_10043697 3300026041 Bacteria 3366
187 Ga0207639_10048275 3300026041 Bacteria 3221
188 Ga0207678_10008096 3300026067 Bacteria 9269
189 Ga0207678_10087774 3300026067 Bacteria 2658
190 Ga0207678_10221999 3300026067 Bacteria 1618
191 Ga0207708_10018582 3300026075 Bacteria 5235
192 Ga0207641_10000683 3300026088 Bacteria 36606
193 Ga0207641_10008298 3300026088 Bacteria 8583
194 Ga0207641_10322127 3300026088 Bacteria 1466
195 Ga0207676_10078231 3300026095 Bacteria 2678
196 Ga0207675_100011690 3300026118 Bacteria 8208
197 Ga0268266_10014595 3300028379 Bacteria 6750
198 Ga0268266_10034389 3300028379 Bacteria 4310
199 Ga0268266_10065858 3300028379 Bacteria 3132
200 Ga0268266_10264323 3300028379 Bacteria 1595
201 Ga0268265_10000007 3300028380 Bacteria 431817
202 Ga0268265_10023178 3300028380 Bacteria 4372
203 Ga0268264_10000007 3300028381 Bacteria 815790
204 Ga0268264_10001178 3300028381 Bacteria 25373
205 Ga0268264_10020298 3300028381 Bacteria 5430
206 Ga0265326_10005743 3300028558 Bacteria 3900
207 Ga0265332_10039216 3300031238 Bacteria 2052
208 Ga0265340_10000887 3300031247 Bacteria 16943
209 Ga0265339_10000858 3300031249 Bacteria 23395
210 Ga0265316_10006940 3300031344 Bacteria 10740
211 Ga0307508_10110302 3300031616 Bacteria 2351
212 Ga0265314_10000001 3300031711 Bacteria 3792860
213 Ga0316576_10243301 3300031727 Bacteria 1351
214 Ga0307410_10007523 3300031852 Bacteria 5969
215 Ga0307406_10107921 3300031901 Bacteria 1910
216 Ga0307407_10014042 3300031903 Bacteria 3908
217 Ga0307409_100033874 3300031995 Bacteria 3723
218 Ga0307409_100067786 3300031995 Bacteria 2819
219 Ga0307409_100428659 3300031995 Bacteria 1270
220 Ga0307416_100086024 3300032002 Bacteria 2678
221 Ga0307416_100108437 3300032002 Bacteria 2439
222 Ga0307416_100161283 3300032002 Bacteria 2073
223 Ga0307414_10144475 3300032004 Bacteria 1867
224 Ga0307411_10102823 3300032005 Bacteria 2025
225 Ga0373931_0183394 3300035691 Bacteria 1241
226 Ga0316584_0010212 3300036712 Bacteria 6556
227 Ga0395900_0166829 3300037418 Bacteria 2244
228 Ga0395898_0176332 3300037466 Bacteria 2043
229 Ga0436364_0351983 3300037853 Bacteria 9647
230 Ga0395901_0039317 3300038443 Bacteria 4895
231 Ga0436365_0122463 3300039437 Bacteria 10817
232 Ga0436365_1044958 3300039437 Bacteria 21458
233 Ga0436365_1476212 3300039437 Bacteria 20750
234 Ga0436365_1896722 3300039437 Bacteria 34564
235 Ga0436363_1224609 3300039450 Bacteria 1112
236 Ga0436363_1543590 3300039450 Bacteria 1453
237 Ga0436363_1554232 3300039450 Bacteria 1678
238 Ga0439461_0000578 3300041410 Bacteria 5318
239 Ga0439466_0007406 3300041411 Bacteria 4156
240 Ga0439466_0007688 3300041411 Bacteria 4071
241 Ga0439466_0017862 3300041411 Bacteria 2550
242 Ga0439465_0005065 3300041413 Bacteria 4228
243 Ga0439465_0008004 3300041413 Bacteria 3344
244 Ga0439465_0022089 3300041413 Bacteria 1998
245 Ga0451791_0692920 3300041451 Bacteria 1212
246 Ga0451795_0892760 3300041456 Bacteria 1926
247 Ga0451807_1554927 3300041486 Bacteria 4157
248 Ga0451853_1243520 3300041512 Bacteria 21064
249 Ga0439431_0010362 3300041997 Bacteria 2115
250 Ga0439442_014031 3300042002 Bacteria 1648
251 Ga0439445_0002161 3300042004 Bacteria 4356
252 Ga0439445_0013843 3300042004 Bacteria 1956
253 Ga0439445_0019493 3300042004 Bacteria 1691
254 Ga0439434_0010754 3300042435 Bacteria 2700
255 Ga0466972_0011389 3300044658 Bacteria 4463
256 Ga0466972_0028064 3300044658 Bacteria 2780
257 Ga0466972_0035655 3300044658 Bacteria 2435
258 Ga0453683_0011924 3300044673 Bacteria 5714
259 Ga0466965_0001917 3300044683 Bacteria 8674
260 Ga0466965_0021500 3300044683 Bacteria 3106
261 Ga0466966_0003423 3300044684 Bacteria 10465
262 Ga0466966_0023573 3300044684 Bacteria 4028
263 Ga0466966_0055817 3300044684 Bacteria 2499
264 Ga0466961_0021390 3300044693 Bacteria 4164
265 Ga0466961_0064740 3300044693 Bacteria 2323
266 Ga0466961_0067343 3300044693 Bacteria 2274
267 Ga0466963_0048958 3300044694 Bacteria 2794
268 Ga0466963_0049616 3300044694 Bacteria 2776
269 Ga0466963_0097036 3300044694 Bacteria 2014
270 Ga0466964_0064451 3300044706 Bacteria 1533
271 Ga0466971_0026402 3300044719 Bacteria 2595
272 Ga0466968_0012863 3300044735 Bacteria 3283
273 Ga0466968_0052583 3300044735 Bacteria 1743
274 Ga0466970_0035181 3300044765 Bacteria 2653
275 Ga0466970_0043400 3300044765 Bacteria 2392
276 Ga0466970_0051379 3300044765 Bacteria 2199
277 Ga0466970_0171437 3300044765 Bacteria 1203
278 Ga0466957_0016272 3300044842 Bacteria 4350
279 Ga0466957_0048517 3300044842 Bacteria 2581
280 Ga0466957_0167705 3300044842 Bacteria 1429
281 Ga0466960_0002446 3300044901 Bacteria 6994
282 Ga0466960_0006383 3300044901 Bacteria 4729
283 Ga0466959_0000568 3300045049 Bacteria 21516
284 Ga0466959_0027212 3300045049 Bacteria 4241
285 Ga0466958_0008568 3300045836 Bacteria 5678
286 Ga0466958_0012500 3300045836 Bacteria 4812
287 Ga0466958_0050734 3300045836 Bacteria 2511
288 Ga0466967_0009565 3300045976 Bacteria 7203
289 Ga0466967_0012319 3300045976 Bacteria 6534
290 Ga0466967_0021703 3300045976 Bacteria 5223
291 Ga0466967_0040744 3300045976 Bacteria 4000
292 Ga0466967_0082515 3300045976 Bacteria 2905
293 Ga0466967_0096243 3300045976 Bacteria 2700
294 Ga0466967_0185996 3300045976 Bacteria 1961
295 Ga0466967_0237535 3300045976 Bacteria 1737
296 Ga0495629_0020235 3300046459 Bacteria 4752
297 Ga0495662_0068443 3300046476 Bacteria 1719
298 Ga0495648_0002831 3300046524 Bacteria 15611
299 Ga0495665_0023585 3300046531 Bacteria 3305
300 Ga0495635_0073970 3300046663 Bacteria 2334
301 Ga0495624_0082902 3300046690 Bacteria 1984
302 Ga0495581_0061918 3300047315 Bacteria 2162
303 Ga0495672_0003786 3300047320 Bacteria 12737
304 Ga0495672_0102048 3300047320 Bacteria 1554
305 Ga0495673_0025518 3300047469 Bacteria 2835
306 Ga0495686_0114068 3300047472 Bacteria 1618
307 Ga0495593_0060762 3300047673 Bacteria 1978
308 Ga0495626_0059569 3300048091 Bacteria 1742
309 Ga0496100_0000023 3300048903 Bacteria 121977
310 Ga0496100_0000420 3300048903 Bacteria 20520
311 Ga0496100_0012829 3300048903 Bacteria 4817
312 Ga0496100_0029517 3300048903 Bacteria 3393
313 Ga0496101_0000056 3300048904 Bacteria 135446
314 Ga0496101_0000057 3300048904 Bacteria 134204
315 Ga0496101_0000626 3300048904 Bacteria 21484
316 Ga0496101_0004323 3300048904 Bacteria 8918
317 Ga0496101_0022861 3300048904 Bacteria 4310
318 Ga0496101_0076425 3300048904 Bacteria 2467
319 Ga0496101_0087597 3300048904 Bacteria 2311
320 Ga0496102_0000025 3300048905 Bacteria 227201
321 Ga0496102_0000308 3300048905 Bacteria 62245
322 Ga0496102_0000783 3300048905 Bacteria 30938
323 Ga0496102_0008726 3300048905 Bacteria 8699
324 Ga0496102_0016301 3300048905 Bacteria 6490
325 Ga0496102_0050040 3300048905 Bacteria 3804
326 Ga0496102_0102122 3300048905 Bacteria 2665
327 Ga0496103_0000021 3300048906 Bacteria 229062
328 Ga0496103_0000022 3300048906 Bacteria 227208
329 Ga0496103_0000256 3300048906 Bacteria 51135
330 Ga0496103_0001227 3300048906 Bacteria 17571
331 Ga0496103_0001883 3300048906 Bacteria 13651
332 Ga0496104_0000131 3300048907 Bacteria 69658
333 Ga0496104_0002462 3300048907 Bacteria 15953
334 Ga0496104_0051113 3300048907 Bacteria 3900
335 Ga0496104_0069799 3300048907 Bacteria 3340
336 Ga0496105_0004339 3300048908 Bacteria 10687
337 Ga0496105_0070550 3300048908 Bacteria 2888
338 Ga0496106_0001025 3300048909 Bacteria 20538
339 Ga0496106_0006292 3300048909 Bacteria 8789
340 Ga0496106_0014167 3300048909 Bacteria 5889
341 Ga0496106_0054743 3300048909 Bacteria 3014
342 Ga0496106_0058152 3300048909 Bacteria 2926
343 Ga0496106_0076481 3300048909 Bacteria 2566
344 Ga0496106_0166526 3300048909 Bacteria 1745
345 Ga0496107_0000056 3300048910 Bacteria 60293
346 Ga0496107_0000533 3300048910 Bacteria 21209
347 Ga0496107_0011253 3300048910 Bacteria 6227
348 Ga0496107_0041997 3300048910 Bacteria 3285
349 Ga0496108_0000506 3300048911 Bacteria 30708
350 Ga0496108_0002544 3300048911 Bacteria 14598
351 Ga0496108_0016295 3300048911 Bacteria 6062
352 Ga0496108_0458031 3300048911 Bacteria 1114
353 Ga0496109_0000037 3300048912 Bacteria 151906
354 Ga0496109_0003751 3300048912 Bacteria 12697
355 Ga0496109_0220370 3300048912 Bacteria 1784
356 Ga0496109_0233629 3300048912 Bacteria 1730
357 Ga0496109_0423667 3300048912 Bacteria 1257
358 Ga0496110_0022418 3300048913 Bacteria 5362
359 Ga0496110_0137023 3300048913 Bacteria 2212
360 Ga0496110_0296845 3300048913 Bacteria 1472
361 Ga0496111_0011631 3300048914 Bacteria 5937
362 Ga0496111_0186353 3300048914 Bacteria 1543
363 Ga0496112_0001645 3300048915 Bacteria 17332
364 Ga0496112_0011482 3300048915 Bacteria 8090
365 Ga0496112_0029804 3300048915 Bacteria 5280
366 Ga0496112_0047579 3300048915 Bacteria 4208
367 Ga0496112_0090800 3300048915 Bacteria 3023
368 Ga0496112_0439513 3300048915 Bacteria 1243
369 Ga0496113_0000112 3300048916 Bacteria 35072
370 Ga0496113_0008008 3300048916 Bacteria 6851
371 Ga0496114_0000285 3300048917 Bacteria 36880
372 Ga0496114_0002227 3300048917 Bacteria 14770
373 Ga0496114_0223551 3300048917 Bacteria 1653
374 Ga0496114_0330647 3300048917 Bacteria 1347
375 Ga0496115_0325903 3300048918 Bacteria 1256
376 Ga0496116_0000059 3300048919 Bacteria 274491
377 Ga0496116_0012282 3300048919 Bacteria 7002
378 Ga0496116_0018594 3300048919 Bacteria 5347
379 Ga0496117_0000055 3300048920 Bacteria 274518
380 Ga0496117_0000284 3300048920 Bacteria 92675
381 Ga0496117_0000595 3300048920 Bacteria 59503
382 Ga0496118_0000058 3300048921 Bacteria 227245
383 Ga0496118_0000225 3300048921 Bacteria 98639
384 Ga0496118_0009306 3300048921 Bacteria 9955
385 Ga0496119_0000339 3300048922 Bacteria 65402
386 Ga0496119_0000668 3300048922 Bacteria 45998
387 Ga0496119_0005165 3300048922 Bacteria 12636
388 Ga0496119_0013188 3300048922 Bacteria 6610
389 Ga0496120_0000334 3300048923 Bacteria 78728
390 Ga0496120_0001979 3300048923 Bacteria 22334
391 Ga0496120_0014478 3300048923 Bacteria 5255
392 Ga0496121_0000060 3300048924 Bacteria 276682
393 Ga0496121_0000068 3300048924 Bacteria 259210
394 Ga0496121_0002945 3300048924 Bacteria 24853
395 Ga0496121_0022567 3300048924 Bacteria 6099
396 Ga0496122_0000085 3300048925 Bacteria 208310
397 Ga0496122_0001206 3300048925 Bacteria 44057
398 Ga0496122_0018697 3300048925 Bacteria 6381
399 Ga0496123_0000367 3300048926 Bacteria 84634
400 Ga0496123_0006030 3300048926 Bacteria 11922
401 Ga0496124_0000065 3300048927 Bacteria 223594
402 Ga0496124_0011434 3300048927 Bacteria 8874
403 Ga0496125_0000008 3300048928 Bacteria 704677
404 Ga0496125_0002033 3300048928 Bacteria 27406
405 Ga0496125_0059196 3300048928 Bacteria 3088
406 Ga0496125_0213958 3300048928 Bacteria 1249
407 Ga0496126_0000062 3300048929 Bacteria 259210
408 Ga0496126_0000175 3300048929 Bacteria 146389
409 Ga0496126_0002189 3300048929 Bacteria 27166
410 Ga0496126_0004145 3300048929 Bacteria 17522
411 Ga0496126_0004567 3300048929 Bacteria 16443
412 Ga0496126_0043343 3300048929 Bacteria 4151
413 Ga0496126_0326792 3300048929 Bacteria 1259
414 Ga0501032_0018396 3300049569 Bacteria 4896
415 Ga0501032_0090367 3300049569 Bacteria 2032
416 Ga0501033_0016825 3300049570 Bacteria 5529
417 Ga0501034_0003692 3300049571 Bacteria 17298
418 Ga0501034_0040712 3300049571 Bacteria 4702
419 Ga0501034_0099756 3300049571 Bacteria 2899
420 Ga0501036_0009928 3300049572 Bacteria 7838
421 Ga0501036_0185405 3300049572 Bacteria 1751
422 Ga0501037_0005194 3300049573 Bacteria 9468
423 Ga0501037_0013260 3300049573 Bacteria 6073
424 Ga0501038_0004988 3300049574 Bacteria 12329
425 Ga0501039_0032251 3300049575 Bacteria 4038
426 Ga0501043_0000225 3300049579 Bacteria 51378
427 Ga0501043_0094181 3300049579 Bacteria 2355
428 Ga0501046_0002030 3300049580 Bacteria 19227
429 Ga0501047_0007260 3300049581 Bacteria 10416
430 Ga0501047_0015704 3300049581 Bacteria 7214
431 Ga0501047_0149356 3300049581 Bacteria 2213
432 Ga0501048_0007990 3300049582 Bacteria 8008
433 Ga0501067_0136810 3300049583 Bacteria 1364
434 Ga0501068_0038931 3300049584 Bacteria 2850
435 Ga0501070_0001854 3300049586 Bacteria 18660
436 Ga0501070_0003176 3300049586 Bacteria 14285
437 Ga0501070_0237094 3300049586 Bacteria 1494
438 Ga0501071_0054000 3300049587 Bacteria 2899
439 Ga0501073_0003427 3300049589 Bacteria 11917
440 Ga0501073_0038174 3300049589 Bacteria 3409
441 Ga0501076_0036722 3300049592 Bacteria 3840
442 Ga0501080_0058822 3300049742 Bacteria 3577
443 Ga0501035_0000147 3300049822 Bacteria 85803
444 Ga0501035_0001513 3300049822 Bacteria 23775
445 Ga0501044_0000152 3300049823 Bacteria 85715
446 Ga0501044_0000601 3300049823 Bacteria 43671
447 Ga0501044_0035451 3300049823 Bacteria 5225
448 nmdc:mga03n38_211674_c1 3300050490 Bacteria 1008
449 nmdc:mga03n38_26866_c1 3300050490 Bacteria 2382
450 nmdc:mga03n38_31475_c1 3300050490 Bacteria 2239
451 nmdc:mga03n38_78092_c1 3300050490 Bacteria 1549
452 nmdc:mga03n38_8447_c1 3300050490 Bacteria 3697
453 nmdc:mga00v17_1718_c1 3300050491 Bacteria 11374
454 nmdc:mga00v17_29711_c1 3300050491 Bacteria 3209
455 nmdc:mga00v17_41749_c1 3300050491 Bacteria 2756
456 nmdc:mga00v17_50431_c1 3300050491 Bacteria 2529
457 nmdc:mga00v17_6311_c1 3300050491 Bacteria 6286
458 nmdc:mga00v17_717_c1 3300050491 Bacteria 18140
459 nmdc:mga0yw44_116943_c1 3300050492 Bacteria 1714
460 nmdc:mga0yw44_38781_c1 3300050492 Bacteria 2821
461 nmdc:mga0yw44_49133_c1 3300050492 Bacteria 2545
462 nmdc:mga0yw44_84440_c1 3300050492 Bacteria 1996
463 nmdc:mga06z11_57841_c1 3300050494 Bacteria 2010
464 nmdc:mga07m45_145903_c1 3300050496 Bacteria 1372
465 nmdc:mga07m45_276585_c1 3300050496 Bacteria 977
466 nmdc:mga07m45_34462_c1 3300050496 Bacteria 2813
467 nmdc:mga07m45_53788_c1 3300050496 Bacteria 2275
468 nmdc:mga07m45_66954_c1 3300050496 Bacteria 2041
469 nmdc:mga0qj67_53401_c1 3300050509 Bacteria 3199
470 nmdc:mga06r32_37978_c1 3300050510 Bacteria 4558
471 nmdc:mga0sz30_1480_c1 3300050516 Bacteria 8387
472 nmdc:mga0sz30_21659_c1 3300050516 Bacteria 2603
473 nmdc:mga0sz30_35431_c1 3300050516 Bacteria 2082
474 nmdc:mga0sz30_4563_c1 3300050516 Bacteria 5016
475 nmdc:mga0sz30_48802_c1 3300050516 Bacteria 1792
476 nmdc:mga0sz30_9200_c1 3300050516 Bacteria 3751
477 Ga0500610_0030886 3300053079 Bacteria 2718
478 Ga0500643_014789 3300053087 Bacteria 2696
479 Ga0500556_0004518 3300053104 Bacteria 3960
480 Ga0500562_007174 3300053108 Bacteria 2813
481 Ga0500642_0030038 3300053130 Bacteria 2258
482 Ga0500568_0037961 3300053139 Bacteria 1952
483 Ga0500577_0023872 3300053142 Bacteria 2050
484 Ga0500616_0027705 3300053153 Bacteria 3127
485 Ga0500627_0153446 3300053158 Bacteria 1040
486 Ga0500645_000074 3300053730 Bacteria 78753
487 Ga0500645_003667 3300053730 Bacteria 6137
488 Ga0501082_0092667 3300060353 Bacteria 2610
489 Ga0466962_0057972 3300061719 Bacteria 1849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0023573 Ga0466966_0023573_14_934 298
2 3300050496 nmdc:mga07m45_276585_c1 nmdc:mga07m45_276585_c1_15_956 305
3 3300053158 Ga0500627_0153446 Ga0500627_0153446_24_965 305
4 3300048909 Ga0496106_0076481 Ga0496106_0076481_1599_2543 306
5 3300050490 nmdc:mga03n38_211674_c1 nmdc:mga03n38_211674_c1_51_995 306
6 3300050496 nmdc:mga07m45_145903_c1 nmdc:mga07m45_145903_c1_12_956 306
7 3300005435 Ga0070714_100236729 Ga0070714_1002367291 322
8 3300006051 Ga0075364_10033231 Ga0075364_100332313 322
9 3300039450 Ga0436363_1224609 Ga0436363_1224609_86_1078 322
10 3300041451 Ga0451791_0692920 Ga0451791_0692920_205_1197 322
11 3300048911 Ga0496108_0458031 Ga0496108_0458031_10_1002 322
12 3300048912 Ga0496109_0423667 Ga0496109_0423667_21_1013 322
13 3300031616 Ga0307508_10110302 Ga0307508_101103022 337
14 3300031727 Ga0316576_10243301 Ga0316576_102433012 349
15 iso_pu_bacteria 2643221687 2644488867 355
16 iso_pu_bacteria 2842888712 2842889217 355
17 iso_pu_bacteria 2902799365 2902804009 355
18 iso_pu_bacteria 2643221715 2644635304 356
19 iso_pu_bacteria 2738541274 2738703886 356
20 iso_pu_bacteria 2738543028 2739330760 356
21 iso_pu_bacteria 2842134933 2842137466 356
22 iso_pu_bacteria 2902810491 2902812818 356
23 iso_pu_bacteria 2902837492 2902838852 356
24 iso_pu_bacteria 2929212328 2929216313 356
25 iso_pu_bacteria 2939582691 2939588404 356
26 3300021384 Ga0213876_10099729 Ga0213876_100997292 358
27 3300039437 Ga0436365_1476212 Ga0436365_1476212_13236_14342 358
28 3300061719 Ga0466962_0057972 Ga0466962_0057972_639_1745 358
29 iso_pu_bacteria 2738541264 2738668015 358
30 iso_pu_bacteria 2738541356 2739147085 358
31 3300005455 Ga0070663_100010341 Ga0070663_1000103413 359
32 3300006048 Ga0075363_100003454 Ga0075363_1000034542 359
33 3300006051 Ga0075364_10085331 Ga0075364_100853312 359
34 3300009098 Ga0105245_10188213 Ga0105245_101882132 359
35 3300025303 Ga0209051_1001562 Ga0209051_10015629 359
36 3300025949 Ga0207667_10000194 Ga0207667_1000019480 359
37 3300026067 Ga0207678_10087774 Ga0207678_100877743 359
38 3300035691 Ga0373931_0183394 Ga0373931_0183394_44_1147 359
39 3300041411 Ga0439466_0007688 Ga0439466_0007688_1872_2975 359
40 3300041413 Ga0439465_0005065 Ga0439465_0005065_1627_2730 359
41 3300041512 Ga0451853_1243520 Ga0451853_1243520_442_1542 359
42 3300042004 Ga0439445_0002161 Ga0439445_0002161_2398_3501 359
43 3300045976 Ga0466967_0040744 Ga0466967_0040744_2367_3470 359
44 3300046459 Ga0495629_0020235 Ga0495629_0020235_1522_2625 359
45 3300046476 Ga0495662_0068443 Ga0495662_0068443_90_1193 359
46 3300046531 Ga0495665_0023585 Ga0495665_0023585_146_1249 359
47 3300046663 Ga0495635_0073970 Ga0495635_0073970_91_1194 359
48 3300046690 Ga0495624_0082902 Ga0495624_0082902_537_1640 359
49 3300047315 Ga0495581_0061918 Ga0495581_0061918_847_1950 359
50 3300047673 Ga0495593_0060762 Ga0495593_0060762_526_1629 359
51 3300048911 Ga0496108_0016295 Ga0496108_0016295_157_1260 359
52 3300048912 Ga0496109_0220370 Ga0496109_0220370_235_1338 359
53 3300048915 Ga0496112_0001645 Ga0496112_0001645_8880_9983 359
54 3300048917 Ga0496114_0330647 Ga0496114_0330647_103_1206 359
55 3300049587 Ga0501071_0054000 Ga0501071_0054000_823_1920 359
56 3300049592 Ga0501076_0036722 Ga0501076_0036722_1631_2728 359
57 3300050490 nmdc:mga03n38_78092_c1 nmdc:mga03n38_78092_c1_244_1347 359
58 3300000546 LJNas_1003678 LJNas_10036782 360
59 3300001990 JGI24737J22298_10012613 JGI24737J22298_100126134 360
60 3300002074 JGI24748J21848_1001167 JGI24748J21848_10011673 360
61 3300002077 JGI24744J21845_10001002 JGI24744J21845_100010027 360
62 3300002244 JGI24742J22300_10002567 JGI24742J22300_100025672 360
63 3300002459 JGI24751J29686_10005117 JGI24751J29686_100051173 360
64 3300003320 rootH2_10035322 rootH2_100353224 360
65 3300003320 rootH2_10073720 rootH2_100737207 360
66 3300003792 Ga0055540_1004498 Ga0055540_10044983 360
67 3300005330 Ga0070690_100016349 Ga0070690_1000163494 360
68 3300005335 Ga0070666_10068923 Ga0070666_100689232 360
69 3300005337 Ga0070682_100000620 Ga0070682_1000006204 360
70 3300005337 Ga0070682_100002412 Ga0070682_1000024128 360
71 3300005337 Ga0070682_100073048 Ga0070682_1000730482 360
72 3300005337 Ga0070682_100101275 Ga0070682_1001012752 360
73 3300005341 Ga0070691_10025793 Ga0070691_100257932 360
74 3300005347 Ga0070668_100002504 Ga0070668_1000025046 360
75 3300005353 Ga0070669_100001642 Ga0070669_1000016428 360
76 3300005355 Ga0070671_100002010 Ga0070671_10000201010 360
77 3300005356 Ga0070674_100000840 Ga0070674_10000084015 360
78 3300005356 Ga0070674_100057733 Ga0070674_1000577333 360
79 3300005367 Ga0070667_100000226 Ga0070667_10000022654 360
80 3300005367 Ga0070667_100058969 Ga0070667_1000589692 360
81 3300005436 Ga0070713_100049762 Ga0070713_1000497622 360
82 3300005437 Ga0070710_10003939 Ga0070710_100039392 360
83 3300005438 Ga0070701_10010903 Ga0070701_100109032 360
84 3300005439 Ga0070711_100000208 Ga0070711_1000002089 360
85 3300005439 Ga0070711_100028313 Ga0070711_1000283132 360
86 3300005457 Ga0070662_100008785 Ga0070662_1000087855 360
87 3300005459 Ga0068867_100023096 Ga0068867_1000230962 360
88 3300005539 Ga0068853_100057874 Ga0068853_1000578743 360
89 3300005545 Ga0070695_100038255 Ga0070695_1000382553 360
90 3300005548 Ga0070665_100088107 Ga0070665_1000881073 360
91 3300005549 Ga0070704_100000212 Ga0070704_10000021218 360
92 3300005549 Ga0070704_100144089 Ga0070704_1001440892 360
93 3300005617 Ga0068859_100000266 Ga0068859_10000026620 360
94 3300005718 Ga0068866_10000357 Ga0068866_1000035716 360
95 3300005719 Ga0068861_100000249 Ga0068861_10000024919 360
96 3300005841 Ga0068863_100000843 Ga0068863_10000084310 360
97 3300005841 Ga0068863_100019121 Ga0068863_1000191211 360
98 3300005841 Ga0068863_100335592 Ga0068863_1003355921 360
99 3300005842 Ga0068858_100004695 Ga0068858_1000046958 360
100 3300005842 Ga0068858_100138025 Ga0068858_1001380253 360
101 3300005843 Ga0068860_100000166 Ga0068860_10000016635 360
102 3300005843 Ga0068860_100090950 Ga0068860_1000909502 360
103 3300005844 Ga0068862_100000247 Ga0068862_10000024754 360
104 3300005844 Ga0068862_100002938 Ga0068862_10000293816 360
105 3300005844 Ga0068862_100127103 Ga0068862_1001271032 360
106 3300006038 Ga0075365_10019706 Ga0075365_100197062 360
107 3300006038 Ga0075365_10070315 Ga0075365_100703152 360
108 3300006048 Ga0075363_100001777 Ga0075363_1000017773 360
109 3300006048 Ga0075363_100004998 Ga0075363_1000049984 360
110 3300006048 Ga0075363_100020072 Ga0075363_1000200722 360
111 3300006048 Ga0075363_100085021 Ga0075363_1000850212 360
112 3300006051 Ga0075364_10000511 Ga0075364_1000051118 360
113 3300006051 Ga0075364_10002993 Ga0075364_100029932 360
114 3300006051 Ga0075364_10005981 Ga0075364_100059818 360
115 3300006051 Ga0075364_10014207 Ga0075364_100142073 360
116 3300006163 Ga0070715_10000525 Ga0070715_100005258 360
117 3300006175 Ga0070712_100008387 Ga0070712_1000083872 360
118 3300006178 Ga0075367_10011891 Ga0075367_100118912 360
119 3300006186 Ga0075369_10001636 Ga0075369_100016366 360
120 3300006186 Ga0075369_10002674 Ga0075369_100026743 360
121 3300006186 Ga0075369_10005726 Ga0075369_100057263 360
122 3300006186 Ga0075369_10022448 Ga0075369_100224483 360
123 3300006186 Ga0075369_10038448 Ga0075369_100384482 360
124 3300006186 Ga0075369_10069864 Ga0075369_100698642 360
125 3300006186 Ga0075369_10090161 Ga0075369_100901612 360
126 3300006353 Ga0075370_10014913 Ga0075370_100149133 360
127 3300006353 Ga0075370_10023935 Ga0075370_100239353 360
128 3300006353 Ga0075370_10079950 Ga0075370_100799502 360
129 3300006353 Ga0075370_10089116 Ga0075370_100891162 360
130 3300006353 Ga0075370_10090454 Ga0075370_100904542 360
131 3300006353 Ga0075370_10197735 Ga0075370_101977351 360
132 3300006844 Ga0075428_100002487 Ga0075428_10000248714 360
133 3300006846 Ga0075430_100055546 Ga0075430_1000555462 360
134 3300006847 Ga0075431_100269121 Ga0075431_1002691212 360
135 3300006931 Ga0097620_100000266 Ga0097620_10000026620 360
136 3300009092 Ga0105250_10043212 Ga0105250_100432123 360
137 3300009094 Ga0111539_10092582 Ga0111539_100925823 360
138 3300009098 Ga0105245_10001551 Ga0105245_1000155111 360
139 3300009101 Ga0105247_10000006 Ga0105247_10000006335 360
140 3300009101 Ga0105247_10001045 Ga0105247_1000104519 360
141 3300009147 Ga0114129_10016492 Ga0114129_100164925 360
142 3300009174 Ga0105241_10005541 Ga0105241_100055414 360
143 3300009174 Ga0105241_10008661 Ga0105241_100086613 360
144 3300009176 Ga0105242_10000519 Ga0105242_1000051916 360
145 3300009177 Ga0105248_10000042 Ga0105248_1000004233 360
146 3300009177 Ga0105248_10023260 Ga0105248_100232602 360
147 3300009545 Ga0105237_10006199 Ga0105237_1000619911 360
148 3300009551 Ga0105238_10418384 Ga0105238_104183842 360
149 3300009553 Ga0105249_10000008 Ga0105249_1000000882 360
150 3300009553 Ga0105249_10236074 Ga0105249_102360742 360
151 3300010375 Ga0105239_10007894 Ga0105239_1000789411 360
152 3300013297 Ga0157378_10000520 Ga0157378_1000052020 360
153 3300013306 Ga0163162_10141766 Ga0163162_101417662 360
154 3300013307 Ga0157372_10288839 Ga0157372_102888392 360
155 3300014968 Ga0157379_10113788 Ga0157379_101137882 360
156 3300014969 Ga0157376_10044930 Ga0157376_100449303 360
157 3300021384 Ga0213876_10004000 Ga0213876_100040002 360
158 3300021384 Ga0213876_10032675 Ga0213876_100326752 360
159 3300021388 Ga0213875_10016831 Ga0213875_100168313 360
160 3300025273 Ga0209673_1007932 Ga0209673_10079323 360
161 3300025303 Ga0209051_1001460 Ga0209051_100146015 360
162 3300025303 Ga0209051_1006898 Ga0209051_10068985 360
163 3300025898 Ga0207692_10015572 Ga0207692_100155722 360
164 3300025899 Ga0207642_10000711 Ga0207642_1000071110 360
165 3300025899 Ga0207642_10049518 Ga0207642_100495181 360
166 3300025900 Ga0207710_10000114 Ga0207710_1000011453 360
167 3300025900 Ga0207710_10047887 Ga0207710_100478872 360
168 3300025903 Ga0207680_10141449 Ga0207680_101414492 360
169 3300025904 Ga0207647_10023977 Ga0207647_100239773 360
170 3300025904 Ga0207647_10103416 Ga0207647_101034162 360
171 3300025914 Ga0207671_10012121 Ga0207671_100121214 360
172 3300025915 Ga0207693_10000824 Ga0207693_1000082411 360
173 3300025915 Ga0207693_10001335 Ga0207693_1000133514 360
174 3300025916 Ga0207663_10001018 Ga0207663_100010187 360
175 3300025916 Ga0207663_10059807 Ga0207663_100598072 360
176 3300025917 Ga0207660_10116184 Ga0207660_101161843 360
177 3300025918 Ga0207662_10151243 Ga0207662_101512432 360
178 3300025923 Ga0207681_10009971 Ga0207681_100099712 360
179 3300025926 Ga0207659_10107588 Ga0207659_101075882 360
180 3300025927 Ga0207687_10000930 Ga0207687_1000093015 360
181 3300025929 Ga0207664_10077201 Ga0207664_100772013 360
182 3300025931 Ga0207644_10003413 Ga0207644_100034137 360
183 3300025931 Ga0207644_10024691 Ga0207644_100246913 360
184 3300025934 Ga0207686_10008836 Ga0207686_100088362 360
185 3300025935 Ga0207709_10001522 Ga0207709_100015227 360
186 3300025937 Ga0207669_10001180 Ga0207669_100011807 360
187 3300025937 Ga0207669_10050133 Ga0207669_100501333 360
188 3300025938 Ga0207704_10000949 Ga0207704_100009497 360
189 3300025940 Ga0207691_10090311 Ga0207691_100903112 360
190 3300025940 Ga0207691_10355312 Ga0207691_103553121 360
191 3300025941 Ga0207711_10001104 Ga0207711_1000110412 360
192 3300025941 Ga0207711_10014732 Ga0207711_100147323 360
193 3300025942 Ga0207689_10005803 Ga0207689_1000580311 360
194 3300025949 Ga0207667_10026993 Ga0207667_100269937 360
195 3300025960 Ga0207651_10127975 Ga0207651_101279752 360
196 3300025961 Ga0207712_10000011 Ga0207712_10000011237 360
197 3300025961 Ga0207712_10003923 Ga0207712_100039234 360
198 3300025961 Ga0207712_10097559 Ga0207712_100975592 360
199 3300025981 Ga0207640_10000683 Ga0207640_1000068318 360
200 3300025986 Ga0207658_10000071 Ga0207658_1000007166 360
201 3300025986 Ga0207658_10003276 Ga0207658_100032761 360
202 3300025986 Ga0207658_10039413 Ga0207658_100394134 360
203 3300025986 Ga0207658_10265590 Ga0207658_102655902 360
204 3300026035 Ga0207703_10016341 Ga0207703_100163416 360
205 3300026041 Ga0207639_10043697 Ga0207639_100436973 360
206 3300026041 Ga0207639_10048275 Ga0207639_100482752 360
207 3300026067 Ga0207678_10008096 Ga0207678_100080965 360
208 3300026075 Ga0207708_10018582 Ga0207708_100185825 360
209 3300026088 Ga0207641_10000683 Ga0207641_1000068310 360
210 3300026088 Ga0207641_10008298 Ga0207641_100082987 360
211 3300026088 Ga0207641_10322127 Ga0207641_103221271 360
212 3300026118 Ga0207675_100011690 Ga0207675_1000116907 360
213 3300028379 Ga0268266_10034389 Ga0268266_100343892 360
214 3300028379 Ga0268266_10065858 Ga0268266_100658583 360
215 3300028380 Ga0268265_10000007 Ga0268265_10000007400 360
216 3300028381 Ga0268264_10000007 Ga0268264_10000007526 360
217 3300028381 Ga0268264_10001178 Ga0268264_1000117819 360
218 3300028558 Ga0265326_10005743 Ga0265326_100057433 360
219 3300031238 Ga0265332_10039216 Ga0265332_100392162 360
220 3300031247 Ga0265340_10000887 Ga0265340_100008872 360
221 3300031249 Ga0265339_10000858 Ga0265339_100008587 360
222 3300031344 Ga0265316_10006940 Ga0265316_100069406 360
223 3300031711 Ga0265314_10000001 Ga0265314_100000013150 360
224 3300031852 Ga0307410_10007523 Ga0307410_100075234 360
225 3300031901 Ga0307406_10107921 Ga0307406_101079212 360
226 3300031995 Ga0307409_100067786 Ga0307409_1000677862 360
227 3300036712 Ga0316584_0010212 Ga0316584_0010212_3933_5039 360
228 3300037853 Ga0436364_0351983 Ga0436364_0351983_5638_6744 360
229 3300039437 Ga0436365_0122463 Ga0436365_0122463_4400_5521 360
230 3300039437 Ga0436365_1044958 Ga0436365_1044958_12973_14079 360
231 3300039437 Ga0436365_1896722 Ga0436365_1896722_33078_34184 360
232 3300039450 Ga0436363_1543590 Ga0436363_1543590_144_1253 360
233 3300039450 Ga0436363_1554232 Ga0436363_1554232_267_1376 360
234 3300041410 Ga0439461_0000578 Ga0439461_0000578_105_1211 360
235 3300041411 Ga0439466_0007406 Ga0439466_0007406_985_2091 360
236 3300041411 Ga0439466_0017862 Ga0439466_0017862_1325_2431 360
237 3300041413 Ga0439465_0008004 Ga0439465_0008004_1165_2271 360
238 3300041413 Ga0439465_0022089 Ga0439465_0022089_548_1654 360
239 3300041456 Ga0451795_0892760 Ga0451795_0892760_455_1561 360
240 3300041486 Ga0451807_1554927 Ga0451807_1554927_619_1983 360
241 3300041997 Ga0439431_0010362 Ga0439431_0010362_874_1980 360
242 3300042002 Ga0439442_014031 Ga0439442_014031_197_1303 360
243 3300042004 Ga0439445_0013843 Ga0439445_0013843_534_1640 360
244 3300042004 Ga0439445_0019493 Ga0439445_0019493_187_1293 360
245 3300042435 Ga0439434_0010754 Ga0439434_0010754_313_1419 360
246 3300044658 Ga0466972_0011389 Ga0466972_0011389_1652_2758 360
247 3300044658 Ga0466972_0028064 Ga0466972_0028064_1052_2158 360
248 3300044673 Ga0453683_0011924 Ga0453683_0011924_3590_4687 360
249 3300044683 Ga0466965_0001917 Ga0466965_0001917_5157_6263 360
250 3300044683 Ga0466965_0021500 Ga0466965_0021500_428_1534 360
251 3300044684 Ga0466966_0003423 Ga0466966_0003423_8603_9709 360
252 3300044684 Ga0466966_0055817 Ga0466966_0055817_18_1124 360
253 3300044693 Ga0466961_0021390 Ga0466961_0021390_1297_2403 360
254 3300044693 Ga0466961_0064740 Ga0466961_0064740_704_1810 360
255 3300044693 Ga0466961_0067343 Ga0466961_0067343_109_1215 360
256 3300044694 Ga0466963_0048958 Ga0466963_0048958_65_1171 360
257 3300044694 Ga0466963_0049616 Ga0466963_0049616_1462_2571 360
258 3300044694 Ga0466963_0097036 Ga0466963_0097036_313_1422 360
259 3300044706 Ga0466964_0064451 Ga0466964_0064451_87_1193 360
260 3300044735 Ga0466968_0012863 Ga0466968_0012863_25_1131 360
261 3300044735 Ga0466968_0052583 Ga0466968_0052583_548_1654 360
262 3300044765 Ga0466970_0035181 Ga0466970_0035181_924_2030 360
263 3300044765 Ga0466970_0043400 Ga0466970_0043400_1049_2155 360
264 3300044765 Ga0466970_0051379 Ga0466970_0051379_694_1800 360
265 3300044765 Ga0466970_0171437 Ga0466970_0171437_40_1146 360
266 3300044842 Ga0466957_0016272 Ga0466957_0016272_2549_3658 360
267 3300044842 Ga0466957_0048517 Ga0466957_0048517_858_1964 360
268 3300044901 Ga0466960_0002446 Ga0466960_0002446_2980_4086 360
269 3300044901 Ga0466960_0006383 Ga0466960_0006383_47_1156 360
270 3300045049 Ga0466959_0000568 Ga0466959_0000568_16683_17789 360
271 3300045049 Ga0466959_0027212 Ga0466959_0027212_453_1559 360
272 3300045836 Ga0466958_0008568 Ga0466958_0008568_1327_2433 360
273 3300045836 Ga0466958_0012500 Ga0466958_0012500_1641_2747 360
274 3300045836 Ga0466958_0050734 Ga0466958_0050734_742_1848 360
275 3300045976 Ga0466967_0009565 Ga0466967_0009565_760_1869 360
276 3300045976 Ga0466967_0021703 Ga0466967_0021703_297_1406 360
277 3300045976 Ga0466967_0082515 Ga0466967_0082515_1643_2749 360
278 3300045976 Ga0466967_0237535 Ga0466967_0237535_543_1649 360
279 3300046524 Ga0495648_0002831 Ga0495648_0002831_9109_10215 360
280 3300047320 Ga0495672_0003786 Ga0495672_0003786_6481_7587 360
281 3300047320 Ga0495672_0102048 Ga0495672_0102048_44_1150 360
282 3300047469 Ga0495673_0025518 Ga0495673_0025518_1387_2493 360
283 3300047472 Ga0495686_0114068 Ga0495686_0114068_46_1152 360
284 3300048091 Ga0495626_0059569 Ga0495626_0059569_24_1130 360
285 3300048903 Ga0496100_0000420 Ga0496100_0000420_19185_20291 360
286 3300048903 Ga0496100_0012829 Ga0496100_0012829_2088_3194 360
287 3300048903 Ga0496100_0029517 Ga0496100_0029517_94_1200 360
288 3300048904 Ga0496101_0000056 Ga0496101_0000056_122645_123751 360
289 3300048904 Ga0496101_0000626 Ga0496101_0000626_1285_2391 360
290 3300048904 Ga0496101_0004323 Ga0496101_0004323_6600_7706 360
291 3300048904 Ga0496101_0022861 Ga0496101_0022861_2643_3749 360
292 3300048904 Ga0496101_0076425 Ga0496101_0076425_1117_2223 360
293 3300048905 Ga0496102_0000025 Ga0496102_0000025_34009_35115 360
294 3300048905 Ga0496102_0000783 Ga0496102_0000783_24158_25264 360
295 3300048905 Ga0496102_0008726 Ga0496102_0008726_3563_4669 360
296 3300048905 Ga0496102_0050040 Ga0496102_0050040_1315_2421 360
297 3300048905 Ga0496102_0102122 Ga0496102_0102122_119_1225 360
298 3300048906 Ga0496103_0000022 Ga0496103_0000022_34009_35115 360
299 3300048906 Ga0496103_0001227 Ga0496103_0001227_12473_13579 360
300 3300048906 Ga0496103_0001883 Ga0496103_0001883_338_1444 360
301 3300048907 Ga0496104_0002462 Ga0496104_0002462_7381_8487 360
302 3300048907 Ga0496104_0069799 Ga0496104_0069799_214_1320 360
303 3300048908 Ga0496105_0004339 Ga0496105_0004339_5565_6671 360
304 3300048909 Ga0496106_0001025 Ga0496106_0001025_11701_12807 360
305 3300048909 Ga0496106_0006292 Ga0496106_0006292_6076_7182 360
306 3300048909 Ga0496106_0054743 Ga0496106_0054743_1561_2667 360
307 3300048909 Ga0496106_0058152 Ga0496106_0058152_871_1977 360
308 3300048910 Ga0496107_0000533 Ga0496107_0000533_14359_15465 360
309 3300048910 Ga0496107_0011253 Ga0496107_0011253_4731_5837 360
310 3300048912 Ga0496109_0233629 Ga0496109_0233629_509_1615 360
311 3300048913 Ga0496110_0022418 Ga0496110_0022418_2811_3917 360
312 3300048914 Ga0496111_0186353 Ga0496111_0186353_60_1166 360
313 3300048915 Ga0496112_0011482 Ga0496112_0011482_43_1149 360
314 3300048915 Ga0496112_0090800 Ga0496112_0090800_1399_2505 360
315 3300048916 Ga0496113_0008008 Ga0496113_0008008_185_1291 360
316 3300048917 Ga0496114_0000285 Ga0496114_0000285_12402_13508 360
317 3300048917 Ga0496114_0002227 Ga0496114_0002227_12347_13453 360
318 3300048917 Ga0496114_0223551 Ga0496114_0223551_75_1181 360
319 3300048918 Ga0496115_0325903 Ga0496115_0325903_80_1186 360
320 3300048919 Ga0496116_0000059 Ga0496116_0000059_239377_240483 360
321 3300048919 Ga0496116_0018594 Ga0496116_0018594_1807_2913 360
322 3300048920 Ga0496117_0000055 Ga0496117_0000055_34009_35115 360
323 3300048920 Ga0496117_0000595 Ga0496117_0000595_24483_25589 360
324 3300048921 Ga0496118_0000058 Ga0496118_0000058_34009_35115 360
325 3300048921 Ga0496118_0000225 Ga0496118_0000225_81460_82566 360
326 3300048922 Ga0496119_0000668 Ga0496119_0000668_33179_34285 360
327 3300048922 Ga0496119_0013188 Ga0496119_0013188_1983_3089 360
328 3300048923 Ga0496120_0001979 Ga0496120_0001979_11716_12822 360
329 3300048923 Ga0496120_0014478 Ga0496120_0014478_420_1526 360
330 3300048924 Ga0496121_0000060 Ga0496121_0000060_263861_264967 360
331 3300048924 Ga0496121_0022567 Ga0496121_0022567_2394_3500 360
332 3300048925 Ga0496122_0018697 Ga0496122_0018697_5265_6371 360
333 3300048928 Ga0496125_0059196 Ga0496125_0059196_23_1129 360
334 3300048928 Ga0496125_0213958 Ga0496125_0213958_14_1120 360
335 3300048929 Ga0496126_0002189 Ga0496126_0002189_20039_21145 360
336 3300048929 Ga0496126_0004145 Ga0496126_0004145_11855_12961 360
337 3300048929 Ga0496126_0004567 Ga0496126_0004567_2305_3411 360
338 3300048929 Ga0496126_0043343 Ga0496126_0043343_2626_3732 360
339 3300048929 Ga0496126_0326792 Ga0496126_0326792_100_1206 360
340 3300049569 Ga0501032_0018396 Ga0501032_0018396_1876_2982 360
341 3300049569 Ga0501032_0090367 Ga0501032_0090367_863_1969 360
342 3300049570 Ga0501033_0016825 Ga0501033_0016825_3655_4761 360
343 3300049571 Ga0501034_0003692 Ga0501034_0003692_11206_12315 360
344 3300049571 Ga0501034_0040712 Ga0501034_0040712_3318_4424 360
345 3300049571 Ga0501034_0099756 Ga0501034_0099756_1620_2726 360
346 3300049572 Ga0501036_0009928 Ga0501036_0009928_6470_7576 360
347 3300049572 Ga0501036_0185405 Ga0501036_0185405_449_1558 360
348 3300049573 Ga0501037_0005194 Ga0501037_0005194_2127_3233 360
349 3300049573 Ga0501037_0013260 Ga0501037_0013260_3003_4112 360
350 3300049574 Ga0501038_0004988 Ga0501038_0004988_5805_6911 360
351 3300049575 Ga0501039_0032251 Ga0501039_0032251_2421_3527 360
352 3300049579 Ga0501043_0000225 Ga0501043_0000225_7673_8779 360
353 3300049579 Ga0501043_0094181 Ga0501043_0094181_1220_2326 360
354 3300049580 Ga0501046_0002030 Ga0501046_0002030_17803_18912 360
355 3300049581 Ga0501047_0007260 Ga0501047_0007260_8958_10064 360
356 3300049581 Ga0501047_0015704 Ga0501047_0015704_4029_5138 360
357 3300049581 Ga0501047_0149356 Ga0501047_0149356_1082_2188 360
358 3300049582 Ga0501048_0007990 Ga0501048_0007990_3181_4290 360
359 3300049583 Ga0501067_0136810 Ga0501067_0136810_231_1337 360
360 3300049584 Ga0501068_0038931 Ga0501068_0038931_1215_2321 360
361 3300049586 Ga0501070_0001854 Ga0501070_0001854_6269_7375 360
362 3300049586 Ga0501070_0003176 Ga0501070_0003176_5211_6320 360
363 3300049586 Ga0501070_0237094 Ga0501070_0237094_90_1196 360
364 3300049589 Ga0501073_0003427 Ga0501073_0003427_2675_3781 360
365 3300049589 Ga0501073_0038174 Ga0501073_0038174_1217_2323 360
366 3300049742 Ga0501080_0058822 Ga0501080_0058822_2447_3556 360
367 3300049822 Ga0501035_0000147 Ga0501035_0000147_61843_62949 360
368 3300049822 Ga0501035_0001513 Ga0501035_0001513_20997_22106 360
369 3300049823 Ga0501044_0000152 Ga0501044_0000152_61735_62841 360
370 3300049823 Ga0501044_0000601 Ga0501044_0000601_11354_12463 360
371 3300049823 Ga0501044_0035451 Ga0501044_0035451_3254_4360 360
372 3300050490 nmdc:mga03n38_26866_c1 nmdc:mga03n38_26866_c1_86_1192 360
373 3300050490 nmdc:mga03n38_31475_c1 nmdc:mga03n38_31475_c1_385_1491 360
374 3300050490 nmdc:mga03n38_8447_c1 nmdc:mga03n38_8447_c1_567_1673 360
375 3300050491 nmdc:mga00v17_1718_c1 nmdc:mga00v17_1718_c1_1747_2853 360
376 3300050491 nmdc:mga00v17_29711_c1 nmdc:mga00v17_29711_c1_66_1172 360
377 3300050491 nmdc:mga00v17_41749_c1 nmdc:mga00v17_41749_c1_1055_2161 360
378 3300050491 nmdc:mga00v17_50431_c1 nmdc:mga00v17_50431_c1_1379_2485 360
379 3300050491 nmdc:mga00v17_6311_c1 nmdc:mga00v17_6311_c1_1860_2966 360
380 3300050491 nmdc:mga00v17_717_c1 nmdc:mga00v17_717_c1_9500_10615 360
381 3300050492 nmdc:mga0yw44_116943_c1 nmdc:mga0yw44_116943_c1_89_1204 360
382 3300050492 nmdc:mga0yw44_38781_c1 nmdc:mga0yw44_38781_c1_332_1438 360
383 3300050492 nmdc:mga0yw44_49133_c1 nmdc:mga0yw44_49133_c1_1020_2138 360
384 3300050492 nmdc:mga0yw44_84440_c1 nmdc:mga0yw44_84440_c1_720_1826 360
385 3300050494 nmdc:mga06z11_57841_c1 nmdc:mga06z11_57841_c1_290_1396 360
386 3300050496 nmdc:mga07m45_34462_c1 nmdc:mga07m45_34462_c1_666_1772 360
387 3300050496 nmdc:mga07m45_53788_c1 nmdc:mga07m45_53788_c1_402_1508 360
388 3300050496 nmdc:mga07m45_66954_c1 nmdc:mga07m45_66954_c1_606_1721 360
389 3300050509 nmdc:mga0qj67_53401_c1 nmdc:mga0qj67_53401_c1_972_2078 360
390 3300050510 nmdc:mga06r32_37978_c1 nmdc:mga06r32_37978_c1_232_1338 360
391 3300050516 nmdc:mga0sz30_1480_c1 nmdc:mga0sz30_1480_c1_3562_4668 360
392 3300050516 nmdc:mga0sz30_21659_c1 nmdc:mga0sz30_21659_c1_248_1363 360
393 3300050516 nmdc:mga0sz30_35431_c1 nmdc:mga0sz30_35431_c1_27_1133 360
394 3300050516 nmdc:mga0sz30_4563_c1 nmdc:mga0sz30_4563_c1_1052_2158 360
395 3300050516 nmdc:mga0sz30_48802_c1 nmdc:mga0sz30_48802_c1_656_1762 360
396 3300050516 nmdc:mga0sz30_9200_c1 nmdc:mga0sz30_9200_c1_2629_3735 360
397 3300053079 Ga0500610_0030886 Ga0500610_0030886_1439_2545 360
398 3300053087 Ga0500643_014789 Ga0500643_014789_854_1960 360
399 3300053104 Ga0500556_0004518 Ga0500556_0004518_974_2080 360
400 3300053108 Ga0500562_007174 Ga0500562_007174_684_1790 360
401 3300053130 Ga0500642_0030038 Ga0500642_0030038_901_2007 360
402 3300053139 Ga0500568_0037961 Ga0500568_0037961_803_1909 360
403 3300053142 Ga0500577_0023872 Ga0500577_0023872_903_2009 360
404 3300053153 Ga0500616_0027705 Ga0500616_0027705_452_1558 360
405 3300053730 Ga0500645_000074 Ga0500645_000074_74513_75619 360
406 3300053730 Ga0500645_003667 Ga0500645_003667_4665_5771 360
407 3300060353 Ga0501082_0092667 Ga0501082_0092667_221_1321 360
408 iso_pu_bacteria 2622736605 2623502073 360
409 iso_pu_bacteria 2902792274 2902797023 360
410 3300003792 Ga0055540_1000675 Ga0055540_100067518 362
411 3300005367 Ga0070667_100000249 Ga0070667_10000024959 362
412 3300010375 Ga0105239_10031954 Ga0105239_100319543 362
413 3300025303 Ga0209051_1000076 Ga0209051_100007684 362
414 3300045976 Ga0466967_0096243 Ga0466967_0096243_1081_2199 362
415 3300048903 Ga0496100_0000023 Ga0496100_0000023_28412_29542 362
416 3300048904 Ga0496101_0000057 Ga0496101_0000057_112759_113889 362
417 3300048905 Ga0496102_0016301 Ga0496102_0016301_2036_3166 362
418 3300048906 Ga0496103_0000256 Ga0496103_0000256_46958_48088 362
419 3300048909 Ga0496106_0014167 Ga0496106_0014167_548_1678 362
420 3300048910 Ga0496107_0000056 Ga0496107_0000056_20419_21549 362
421 3300048911 Ga0496108_0002544 Ga0496108_0002544_6453_7583 362
422 3300048912 Ga0496109_0000037 Ga0496109_0000037_32076_33206 362
423 3300048913 Ga0496110_0137023 Ga0496110_0137023_288_1418 362
424 3300048914 Ga0496111_0011631 Ga0496111_0011631_2272_3402 362
425 3300048919 Ga0496116_0012282 Ga0496116_0012282_2420_3550 362
426 3300048922 Ga0496119_0005165 Ga0496119_0005165_10488_11618 362
427 3300048924 Ga0496121_0000068 Ga0496121_0000068_118701_119831 362
428 3300048925 Ga0496122_0000085 Ga0496122_0000085_194989_196119 362
429 3300048926 Ga0496123_0006030 Ga0496123_0006030_3886_5016 362
430 3300048927 Ga0496124_0000065 Ga0496124_0000065_103764_104894 362
431 3300048928 Ga0496125_0000008 Ga0496125_0000008_584847_585977 362
432 3300048929 Ga0496126_0000062 Ga0496126_0000062_118701_119831 362
433 iso_pu_bacteria 2738541275 2738709917 362
434 iso_pu_bacteria 2738541301 2738848342 362
435 iso_pu_bacteria 2738541304 2738864071 362
436 iso_pu_bacteria 2738543022 2739296589 362
437 iso_pu_bacteria 2738543033 2739358267 362
438 iso_pu_bacteria 2919138771 2919141776 362
439 iso_pu_bacteria 2928100450 2928101464 362
440 iso_pu_bacteria 2928959182 2928960126 362
441 3300005354 Ga0070675_100134313 Ga0070675_1001343132 363
442 3300005618 Ga0068864_100043810 Ga0068864_1000438103 363
443 3300009177 Ga0105248_10015431 Ga0105248_1001543111 363
444 3300013306 Ga0163162_10022853 Ga0163162_100228537 363
445 3300014325 Ga0163163_10181115 Ga0163163_101811152 363
446 3300026095 Ga0207676_10078231 Ga0207676_100782314 363
447 3300028379 Ga0268266_10264323 Ga0268266_102643232 363
448 3300044658 Ga0466972_0035655 Ga0466972_0035655_643_1761 363
449 3300048907 Ga0496104_0051113 Ga0496104_0051113_1548_2666 363
450 3300048911 Ga0496108_0000506 Ga0496108_0000506_2845_3963 363
451 3300048912 Ga0496109_0003751 Ga0496109_0003751_4077_5195 363
452 3300048915 Ga0496112_0047579 Ga0496112_0047579_1414_2532 363
453 3300005530 Ga0070679_100110863 Ga0070679_1001108634 364
454 3300013307 Ga0157372_10127775 Ga0157372_101277753 364
455 3300026067 Ga0207678_10221999 Ga0207678_102219992 364
456 3300031903 Ga0307407_10014042 Ga0307407_100140422 364
457 3300031995 Ga0307409_100033874 Ga0307409_1000338744 364
458 3300031995 Ga0307409_100428659 Ga0307409_1004286591 364
459 3300032002 Ga0307416_100086024 Ga0307416_1000860242 364
460 3300032002 Ga0307416_100108437 Ga0307416_1001084372 364
461 3300032002 Ga0307416_100161283 Ga0307416_1001612832 364
462 3300032004 Ga0307414_10144475 Ga0307414_101444753 364
463 3300032005 Ga0307411_10102823 Ga0307411_101028232 364
464 3300037418 Ga0395900_0166829 Ga0395900_0166829_555_1694 364
465 3300037466 Ga0395898_0176332 Ga0395898_0176332_218_1357 364
466 3300038443 Ga0395901_0039317 Ga0395901_0039317_629_1768 364
467 3300044719 Ga0466971_0026402 Ga0466971_0026402_1283_2422 364
468 3300044842 Ga0466957_0167705 Ga0466957_0167705_82_1221 364
469 3300045976 Ga0466967_0012319 Ga0466967_0012319_3920_5059 364
470 3300045976 Ga0466967_0185996 Ga0466967_0185996_748_1887 364
471 3300048915 Ga0496112_0439513 Ga0496112_0439513_41_1180 364
472 3300005842 Ga0068858_100085357 Ga0068858_1000853571 365
473 3300009177 Ga0105248_10124680 Ga0105248_101246803 365
474 3300026035 Ga0207703_10067422 Ga0207703_100674221 365
475 2162886007 SwRhRL2b_contig_1475941 SwRhRL2b_0275.00007350 366
476 3300005289 Ga0065704_10071183 Ga0065704_1007118315 366
477 3300005347 Ga0070668_100018841 Ga0070668_1000188414 366
478 3300005353 Ga0070669_100000080 Ga0070669_10000008087 366
479 3300005355 Ga0070671_100008938 Ga0070671_1000089388 366
480 3300005367 Ga0070667_100000903 Ga0070667_10000090325 366
481 3300005548 Ga0070665_100001980 Ga0070665_10000198022 366
482 3300005843 Ga0068860_100027360 Ga0068860_1000273604 366
483 3300009101 Ga0105247_10122161 Ga0105247_101221612 366
484 3300013306 Ga0163162_10019157 Ga0163162_100191572 366
485 3300025735 Ga0207713_1012425 Ga0207713_10124253 366
486 3300025923 Ga0207681_10000049 Ga0207681_10000049108 366
487 3300025931 Ga0207644_10019296 Ga0207644_100192965 366
488 3300025972 Ga0207668_10061705 Ga0207668_100617053 366
489 3300025986 Ga0207658_10001895 Ga0207658_100018958 366
490 3300028379 Ga0268266_10014595 Ga0268266_100145957 366
491 3300028380 Ga0268265_10023178 Ga0268265_100231784 366
492 3300028381 Ga0268264_10020298 Ga0268264_100202985 366
493 3300048904 Ga0496101_0087597 Ga0496101_0087597_783_1883 366
494 3300048905 Ga0496102_0000308 Ga0496102_0000308_28830_29930 366
495 3300048906 Ga0496103_0000021 Ga0496103_0000021_114842_115942 366
496 3300048907 Ga0496104_0000131 Ga0496104_0000131_59144_60244 366
497 3300048908 Ga0496105_0070550 Ga0496105_0070550_1202_2302 366
498 3300048909 Ga0496106_0166526 Ga0496106_0166526_191_1291 366
499 3300048910 Ga0496107_0041997 Ga0496107_0041997_481_1581 366
500 3300048913 Ga0496110_0296845 Ga0496110_0296845_317_1417 366
501 3300048915 Ga0496112_0029804 Ga0496112_0029804_1274_2374 366
502 3300048916 Ga0496113_0000112 Ga0496113_0000112_32339_33439 366
503 3300048920 Ga0496117_0000284 Ga0496117_0000284_32804_33904 366
504 3300048921 Ga0496118_0009306 Ga0496118_0009306_771_1871 366
505 3300048922 Ga0496119_0000339 Ga0496119_0000339_3145_4245 366
506 3300048923 Ga0496120_0000334 Ga0496120_0000334_54556_55656 366
507 3300048924 Ga0496121_0002945 Ga0496121_0002945_20859_21959 366
508 3300048925 Ga0496122_0001206 Ga0496122_0001206_39813_40913 366
509 3300048926 Ga0496123_0000367 Ga0496123_0000367_25215_26315 366
510 3300048927 Ga0496124_0011434 Ga0496124_0011434_4952_6052 366
511 3300048928 Ga0496125_0002033 Ga0496125_0002033_459_1559 366
512 3300048929 Ga0496126_0000175 Ga0496126_0000175_113061_114161 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

89

338

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9731 11 366
3ht5-assembly1.cif.gz_A-2 crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis 0.973 37 366
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9593 37 366
5u3f-assembly1.cif.gz_A structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9575 40 366
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9564 37 366
ID Description Score Start End Superfamily
3jz6B01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9693 11 179 3.30.470.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.967 11 182 3.90.180.10
5u3fA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9608 40 175 3.30.470.10
3jz6A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9582 180 347 3.20.10.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9561 11 182 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A261F602-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9816 11 365 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A4V2MU24-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9803 8 365 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A6J7C082-F1-model_v4 Unannotated protein 0.9779 74 366 GO:0004084
GO:0008652
GO:0009082
AF-A0A1Q9VAK2-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9775 36 366 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A0R2QBH1-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.977 11 333 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656

Feature Viewer

pLDDT pTM Quality
89.39 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map