F457461

General Info

Members Datasets Scaffolds Average Seq Length
512 283 1024 302

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1358421|Ga0451853_1358421_1171_2154
Length 327
Sequence MRECGLSDIDAQAYRRALTVTSAAMKVSVEPKPLHEPLAGGTPGATVTVEPMVAGHVTWPATMMERPGGRFETLKLLRALLSGNPAATVPCPAFLIRHPSAGAILVDTGLHPSVATDGKENFGGMGNRFGNPSLEPGEDIPSQLRKRGLDPGEIPIVVMTHMHIDHTSAISEFPSSTFIVSEKEWNAAATGPRPLLNGYRRPHYDYAFDYRTVDFDRAGIDSYATFGRCFDLFGDGSLRLAYTPGHSAGHISVIAHLGKRDFVIGGDATYMQAQLDGNAPLAPRPFDEHNYRRSLQELKLFKREYPNAIVTPGHDPEFYAGLDARYE

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
281 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 11.33
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1358421 3300041512 Bacteria 3353
2 JGI24746J21847_1000556 3300001977 Bacteria 5618
3 JGI24748J21848_1002016 3300002074 Bacteria 2266
4 JGI24034J26672_10000147 3300002239 Bacteria 10141
5 Ga0070683_100003645 3300005329 Bacteria 12544
6 Ga0070683_100031376 3300005329 Bacteria 4831
7 Ga0070683_100092824 3300005329 Bacteria 2835
8 Ga0070683_100275108 3300005329 Bacteria 1602
9 Ga0070677_10000020 3300005333 Bacteria 48941
10 Ga0070682_100000009 3300005337 Bacteria 291635
11 Ga0070682_100000032 3300005337 Bacteria 155141
12 Ga0070682_100242916 3300005337 Bacteria 1294
13 Ga0068868_100061700 3300005338 Bacteria 2970
14 Ga0068868_100070495 3300005338 Bacteria 2787
15 Ga0070691_10000003 3300005341 Bacteria 86538
16 Ga0070691_10000348 3300005341 Bacteria 16483
17 Ga0070661_100000032 3300005344 Bacteria 112964
18 Ga0070692_10018423 3300005345 Bacteria 3358
19 Ga0070668_100029027 3300005347 Bacteria 4199
20 Ga0070668_100041672 3300005347 Bacteria 3518
21 Ga0070675_100000022 3300005354 Bacteria 146580
22 Ga0070671_100154846 3300005355 Bacteria 1936
23 Ga0070674_100000021 3300005356 Bacteria 87134
24 Ga0070674_100000075 3300005356 Bacteria 45822
25 Ga0070673_100008528 3300005364 Bacteria 6819
26 Ga0070688_100000031 3300005365 Bacteria 65288
27 Ga0070688_100000194 3300005365 Bacteria 32209
28 Ga0070688_100041121 3300005365 Bacteria 2836
29 Ga0070659_100002039 3300005366 Bacteria 14442
30 Ga0070659_100101582 3300005366 Bacteria 2315
31 Ga0070667_100001503 3300005367 Bacteria 20862
32 Ga0070667_100015838 3300005367 Bacteria 6237
33 Ga0070714_100074920 3300005435 Bacteria 2936
34 Ga0070714_100074954 3300005435 Bacteria 2935
35 Ga0070713_100000516 3300005436 Bacteria 24506
36 Ga0070713_100045444 3300005436 Bacteria 3599
37 Ga0070710_10081672 3300005437 Bacteria 1888
38 Ga0070711_100028366 3300005439 Bacteria 3684
39 Ga0070711_100068958 3300005439 Bacteria 2486
40 Ga0070700_100083667 3300005441 Bacteria 2066
41 Ga0070700_100099506 3300005441 Bacteria 1913
42 Ga0070663_100033780 3300005455 Bacteria 3536
43 Ga0070663_100282127 3300005455 Unclassified 1324
44 Ga0070678_100011255 3300005456 Bacteria 5510
45 Ga0070662_100000052 3300005457 Bacteria 61979
46 Ga0070681_10010128 3300005458 Bacteria 9293
47 Ga0070681_10056853 3300005458 Bacteria 3893
48 Ga0068867_100029739 3300005459 Bacteria 3937
49 Ga0070685_10000058 3300005466 Bacteria 64666
50 Ga0070685_10000263 3300005466 Bacteria 33715
51 Ga0070685_10132509 3300005466 Bacteria 1560
52 Ga0070679_100000134 3300005530 Bacteria 59591
53 Ga0070679_100019644 3300005530 Bacteria 6574
54 Ga0070684_100039278 3300005535 Bacteria 4070
55 Ga0070684_100055447 3300005535 Bacteria 3455
56 Ga0070684_100080217 3300005535 Bacteria 2887
57 Ga0070684_100084428 3300005535 Bacteria 2815
58 Ga0070684_100099400 3300005535 Bacteria 2597
59 Ga0070684_100521935 3300005535 Unclassified 1101
60 Ga0068853_100015477 3300005539 Bacteria 6266
61 Ga0070672_100000258 3300005543 Bacteria 30020
62 Ga0070695_100203244 3300005545 Unclassified 1417
63 Ga0070693_100003269 3300005547 Bacteria 7523
64 Ga0070665_100000022 3300005548 Bacteria 379286
65 Ga0070665_100001623 3300005548 Bacteria 25894
66 Ga0070665_100186690 3300005548 Bacteria 2074
67 Ga0070704_100091354 3300005549 Bacteria 2270
68 Ga0068857_100045709 3300005577 Bacteria 3885
69 Ga0068854_100000133 3300005578 Bacteria 51376
70 Ga0068854_100023995 3300005578 Bacteria 4171
71 Ga0068856_100000369 3300005614 Bacteria 49419
72 Ga0068856_100008918 3300005614 Bacteria 9756
73 Ga0070702_100112910 3300005615 Bacteria 1688
74 Ga0068852_100000024 3300005616 Bacteria 120479
75 Ga0068864_100000023 3300005618 Bacteria 257064
76 Ga0068866_10000007 3300005718 Bacteria 121729
77 Ga0068866_10000469 3300005718 Bacteria 18473
78 Ga0068851_10000895 3300005834 Bacteria 12866
79 Ga0068851_10004054 3300005834 Bacteria 6576
80 Ga0068863_100000110 3300005841 Bacteria 86415
81 Ga0068863_100026684 3300005841 Bacteria 5508
82 Ga0068863_100393201 3300005841 Unclassified 1355
83 Ga0068858_100000150 3300005842 Bacteria 73075
84 Ga0068858_100000329 3300005842 Bacteria 50177
85 Ga0068858_100043131 3300005842 Bacteria 4183
86 Ga0068858_100149533 3300005842 Bacteria 2195
87 Ga0068860_100011273 3300005843 Bacteria 8809
88 Ga0068862_100004171 3300005844 Bacteria 12237
89 Ga0081455_10008364 3300005937 Bacteria 10769
90 Ga0081455_10040573 3300005937 Bacteria 4102
91 Ga0081455_10041806 3300005937 Bacteria 4026
92 Ga0081455_10067212 3300005937 Bacteria 2988
93 Ga0081455_10164303 3300005937 Unclassified 1698
94 Ga0081455_10183350 3300005937 Bacteria 1583
95 Ga0081455_10301681 3300005937 Bacteria 1149
96 Ga0081540_1001588 3300005983 Bacteria 19426
97 Ga0081539_10001052 3300005985 Bacteria 50554
98 Ga0081539_10022350 3300005985 Bacteria 4189
99 Ga0075363_100010859 3300006048 Bacteria 4344
100 Ga0075364_10171734 3300006051 Bacteria 1466
101 Ga0070715_10000003 3300006163 Bacteria 345282
102 Ga0070715_10145985 3300006163 Bacteria 1154
103 Ga0070716_100132062 3300006173 Bacteria 1580
104 Ga0070712_100016243 3300006175 Unclassified 4806
105 Ga0075367_10043857 3300006178 Bacteria 2620
106 Ga0097621_100581550 3300006237 Bacteria 1022
107 Ga0075430_100048532 3300006846 Bacteria 3585
108 Ga0075431_100179264 3300006847 Bacteria 2175
109 Ga0075433_10002915 3300006852 Bacteria 13125
110 Ga0075433_10003283 3300006852 Bacteria 12491
111 Ga0068865_100000024 3300006881 Bacteria 94969
112 Ga0105245_10000022 3300009098 Bacteria 181225
113 Ga0105245_10001178 3300009098 Bacteria 23683
114 Ga0105245_10008000 3300009098 Bacteria 9247
115 Ga0105245_10267092 3300009098 Bacteria 1667
116 Ga0105247_10000064 3300009101 Bacteria 123994
117 Ga0105247_10072683 3300009101 Bacteria 2153
118 Ga0105243_10012040 3300009148 Bacteria 6541
119 Ga0105242_10000123 3300009176 Bacteria 56900
120 Ga0105242_10013245 3300009176 Bacteria 6366
121 Ga0105242_10064933 3300009176 Bacteria 3010
122 Ga0105248_10000017 3300009177 Bacteria 298089
123 Ga0105238_10000016 3300009551 Bacteria 236218
124 Ga0105249_10000181 3300009553 Bacteria 73946
125 Ga0105249_10012298 3300009553 Bacteria 7542
126 Ga0105239_10288660 3300010375 Bacteria 1847
127 Ga0105246_10306240 3300011119 Bacteria 1285
128 Ga0157371_10001783 3300013102 Bacteria 21764
129 Ga0157370_10049032 3300013104 Bacteria 4044
130 Ga0157369_10000068 3300013105 Bacteria 144274
131 Ga0157374_10005308 3300013296 Bacteria 10822
132 Ga0157374_10700813 3300013296 Bacteria 1026
133 Ga0157378_10000656 3300013297 Bacteria 32583
134 Ga0157378_10087628 3300013297 Bacteria 2824
135 Ga0157375_10000126 3300013308 Bacteria 75410
136 Ga0163163_10438413 3300014325 Unclassified 1366
137 Ga0157380_10000328 3300014326 Bacteria 28745
138 Ga0157380_10104533 3300014326 Bacteria 2365
139 Ga0157377_10077334 3300014745 Bacteria 1937
140 Ga0157379_10031333 3300014968 Bacteria 4736
141 Ga0157379_10047841 3300014968 Bacteria 3817
142 Ga0157379_10088250 3300014968 Bacteria 2781
143 Ga0157376_10018824 3300014969 Bacteria 5307
144 Ga0157376_10093379 3300014969 Bacteria 2612
145 Ga0163161_10000013 3300017792 Bacteria 258747
146 Ga0163161_10052079 3300017792 Bacteria 2967
147 Ga0207656_10000274 3300025321 Bacteria 17852
148 Ga0207656_10004135 3300025321 Bacteria 5043
149 Ga0207682_10000050 3300025893 Bacteria 49908
150 Ga0207642_10000008 3300025899 Bacteria 132651
151 Ga0207642_10000181 3300025899 Bacteria 18196
152 Ga0207710_10000165 3300025900 Bacteria 69714
153 Ga0207680_10011411 3300025903 Bacteria 4489
154 Ga0207680_10126296 3300025903 Bacteria 1680
155 Ga0207685_10000003 3300025905 Bacteria 344527
156 Ga0207705_10100545 3300025909 Bacteria 2127
157 Ga0207707_10035644 3300025912 Bacteria 4350
158 Ga0207707_10036138 3300025912 Bacteria 4320
159 Ga0207663_10066167 3300025916 Bacteria 2312
160 Ga0207649_10000015 3300025920 Bacteria 245662
161 Ga0207652_10001289 3300025921 Bacteria 22300
162 Ga0207652_10003408 3300025921 Bacteria 13125
163 Ga0207694_10000012 3300025924 Bacteria 411218
164 Ga0207659_10000030 3300025926 Bacteria 124433
165 Ga0207687_10000025 3300025927 Bacteria 175177
166 Ga0207687_10000039 3300025927 Bacteria 114303
167 Ga0207687_10006005 3300025927 Bacteria 8035
168 Ga0207687_10007709 3300025927 Bacteria 7066
169 Ga0207700_10000019 3300025928 Bacteria 183117
170 Ga0207700_10036698 3300025928 Bacteria 3543
171 Ga0207664_10009739 3300025929 Bacteria 6757
172 Ga0207664_10057860 3300025929 Bacteria 3083
173 Ga0207690_10005737 3300025932 Bacteria 7337
174 Ga0207690_10015961 3300025932 Bacteria 4562
175 Ga0207706_10000137 3300025933 Bacteria 79758
176 Ga0207686_10000066 3300025934 Bacteria 95095
177 Ga0207686_10000592 3300025934 Bacteria 22655
178 Ga0207686_10050440 3300025934 Unclassified 2587
179 Ga0207686_10105615 3300025934 Bacteria 1889
180 Ga0207709_10014890 3300025935 Bacteria 4302
181 Ga0207669_10000032 3300025937 Bacteria 82757
182 Ga0207669_10000091 3300025937 Bacteria 45833
183 Ga0207669_10299513 3300025937 Bacteria 1221
184 Ga0207704_10000054 3300025938 Bacteria 79155
185 Ga0207665_10131145 3300025939 Bacteria 1779
186 Ga0207691_10000871 3300025940 Bacteria 30024
187 Ga0207711_10000011 3300025941 Bacteria 518817
188 Ga0207661_10002638 3300025944 Bacteria 12343
189 Ga0207661_10004497 3300025944 Bacteria 9777
190 Ga0207661_10053194 3300025944 Bacteria 3239
191 Ga0207661_10470190 3300025944 Bacteria 1147
192 Ga0207651_10021515 3300025960 Bacteria 3922
193 Ga0207712_10000067 3300025961 Bacteria 130079
194 Ga0207712_10033097 3300025961 Bacteria 3493
195 Ga0207668_10025559 3300025972 Bacteria 3823
196 Ga0207668_10072576 3300025972 Bacteria 2463
197 Ga0207640_10000147 3300025981 Bacteria 51462
198 Ga0207640_10053916 3300025981 Bacteria 2627
199 Ga0207658_10043805 3300025986 Bacteria 3255
200 Ga0207658_10130823 3300025986 Archaea 2016
201 Ga0207677_10043277 3300026023 Bacteria 2992
202 Ga0207677_10066262 3300026023 Bacteria 2524
203 Ga0207703_10000070 3300026035 Bacteria 123480
204 Ga0207703_10000122 3300026035 Bacteria 92656
205 Ga0207678_10019235 3300026067 Bacteria 5998
206 Ga0207708_10061704 3300026075 Bacteria 2862
207 Ga0207702_10000326 3300026078 Bacteria 54674
208 Ga0207702_10000557 3300026078 Bacteria 41471
209 Ga0207702_10012405 3300026078 Bacteria 7097
210 Ga0207702_10232381 3300026078 Unclassified 1724
211 Ga0207641_10000065 3300026088 Bacteria 156066
212 Ga0207641_10019506 3300026088 Bacteria 5566
213 Ga0207648_10043310 3300026089 Bacteria 3952
214 Ga0207676_10000025 3300026095 Bacteria 261714
215 Ga0207674_10069830 3300026116 Bacteria 3532
216 Ga0207675_100581400 3300026118 Unclassified 1121
217 Ga0207683_10020523 3300026121 Bacteria 5652
218 Ga0207683_10072848 3300026121 Bacteria 3038
219 Ga0207698_10000014 3300026142 Bacteria 240703
220 Ga0268266_10000029 3300028379 Bacteria 424015
221 Ga0268266_10000422 3300028379 Bacteria 64158
222 Ga0268266_10000973 3300028379 Bacteria 36388
223 Ga0268266_10111563 3300028379 Bacteria 2423
224 Ga0268265_10005246 3300028380 Bacteria 8866
225 Ga0268264_10007756 3300028381 Bacteria 8936
226 Ga0265337_1000730 3300028556 Bacteria 17276
227 Ga0265326_10000040 3300028558 Bacteria 85624
228 Ga0265322_10000012 3300028654 Bacteria 152373
229 Ga0265338_10000156 3300028800 Bacteria 125065
230 Ga0265324_10000567 3300029957 Bacteria 25333
231 Ga0265328_10008624 3300031239 Bacteria 4193
232 Ga0265320_10000001 3300031240 Bacteria 847191
233 Ga0265329_10007672 3300031242 Bacteria 4152
234 Ga0265339_10021395 3300031249 Bacteria 3764
235 Ga0265331_10031968 3300031250 Bacteria 2611
236 Ga0265327_10000003 3300031251 Bacteria 852750
237 Ga0265316_10023963 3300031344 Bacteria 5125
238 Ga0265314_10000334 3300031711 Bacteria 66204
239 Ga0316576_10012462 3300031727 Bacteria 5616
240 Ga0316574_0009823 3300035398 Bacteria 5378
241 Ga0316574_0213315 3300035398 Unclassified 1238
242 Ga0373937_0033886 3300036401 Bacteria 4643
243 Ga0316584_0002818 3300036712 Bacteria 11147
244 Ga0395900_0229801 3300037418 Bacteria 1866
245 Ga0395898_0129650 3300037466 Bacteria 2416
246 Ga0395905_0278150 3300037471 Bacteria 1560
247 Ga0395901_0482600 3300038443 Bacteria 1264
248 Ga0395901_0687483 3300038443 Unclassified 1022
249 Ga0451833_0445893 3300041491 Bacteria 1439
250 Ga0451847_0609686 3300041503 Bacteria 1240
251 Ga0451849_1233055 3300041505 Bacteria 901
252 Ga0466963_0000257 3300044694 Bacteria 23311
253 Ga0466963_0008184 3300044694 Bacteria 6266
254 Ga0466963_0130248 3300044694 Bacteria 1737
255 Ga0466957_0000193 3300044842 Bacteria 28057
256 Ga0466957_0173007 3300044842 Bacteria 1407
257 Ga0466967_0000849 3300045976 Bacteria 16201
258 Ga0466967_0207368 3300045976 Bacteria 1858
259 Ga0495592_0000424 3300046454 Bacteria 32002
260 Ga0495592_0095525 3300046454 Bacteria 2126
261 Ga0495603_0000083 3300046455 Bacteria 42311
262 Ga0495603_0004890 3300046455 Bacteria 8013
263 Ga0495629_0001145 3300046459 Bacteria 20950
264 Ga0495629_0005665 3300046459 Bacteria 9329
265 Ga0495629_0050304 3300046459 Bacteria 2919
266 Ga0495629_0190161 3300046459 Bacteria 1421
267 Ga0495641_0000010 3300046461 Bacteria 158798
268 Ga0495651_0073968 3300046462 Bacteria 2586
269 Ga0495653_0006069 3300046463 Bacteria 9900
270 Ga0495653_0079686 3300046463 Bacteria 2425
271 Ga0495582_0000006 3300046473 Bacteria 140434
272 Ga0495662_0000178 3300046476 Bacteria 25519
273 Ga0495594_0000001 3300046499 Bacteria 293051
274 Ga0495606_0000283 3300046507 Bacteria 88309
275 Ga0495608_0000042 3300046511 Bacteria 115906
276 Ga0495608_0003416 3300046511 Bacteria 11374
277 Ga0495608_0007777 3300046511 Bacteria 7549
278 Ga0495618_0000037 3300046514 Bacteria 99735
279 Ga0495620_0000731 3300046515 Bacteria 20250
280 Ga0495620_0082089 3300046515 Bacteria 1303
281 Ga0495628_0000265 3300046516 Bacteria 46703
282 Ga0495628_0017094 3300046516 Bacteria 6043
283 Ga0495628_0082001 3300046516 Bacteria 2505
284 Ga0495628_0140673 3300046516 Bacteria 1842
285 Ga0495628_0159635 3300046516 Bacteria 1714
286 Ga0495630_0000148 3300046517 Bacteria 54619
287 Ga0495630_0000586 3300046517 Bacteria 26542
288 Ga0495637_0107457 3300046520 Bacteria 1085
289 Ga0495644_0004691 3300046523 Bacteria 5372
290 Ga0495652_0000009 3300046529 Bacteria 311000
291 Ga0495652_0039820 3300046529 Bacteria 4063
292 Ga0495640_0003678 3300046533 Bacteria 12324
293 Ga0495640_0050712 3300046533 Bacteria 2857
294 Ga0495586_0008020 3300046535 Bacteria 5632
295 Ga0495586_0167990 3300046535 Bacteria 1239
296 Ga0495587_0002629 3300046536 Bacteria 12001
297 Ga0495587_0015546 3300046536 Bacteria 4750
298 Ga0495598_0001441 3300046537 Bacteria 4716
299 Ga0495621_0005233 3300046539 Bacteria 3715
300 Ga0495645_0016069 3300046543 Bacteria 5337
301 Ga0495645_0080076 3300046543 Bacteria 2345
302 Ga0495622_0000069 3300046557 Bacteria 89759
303 Ga0495667_0000109 3300046559 Bacteria 59985
304 Ga0495656_0003522 3300046615 Bacteria 5296
305 Ga0495668_0057343 3300046616 Bacteria 2150
306 Ga0495634_0000021 3300046642 Bacteria 120521
307 Ga0495634_0000951 3300046642 Bacteria 27343
308 Ga0495634_0142664 3300046642 Unclassified 1520
309 Ga0495625_0000109 3300046660 Bacteria 125064
310 Ga0495635_0000006 3300046663 Bacteria 301820
311 Ga0495635_0038592 3300046663 Bacteria 3306
312 Ga0495635_0081100 3300046663 Bacteria 2220
313 Ga0495588_0098562 3300046674 Bacteria 1535
314 Ga0495657_0000040 3300046675 Bacteria 115899
315 Ga0495599_0020110 3300046678 Bacteria 4158
316 Ga0495623_0091266 3300046679 Bacteria 1869
317 Ga0495647_0000002 3300046681 Bacteria 174959
318 Ga0495647_0002786 3300046681 Bacteria 5539
319 Ga0495647_0034003 3300046681 Bacteria 1907
320 Ga0495658_0000027 3300046683 Bacteria 74322
321 Ga0495669_0000132 3300046684 Bacteria 47843
322 Ga0495613_0000190 3300046689 Bacteria 60696
323 Ga0495613_0000324 3300046689 Bacteria 42895
324 Ga0495624_0000005 3300046690 Bacteria 158127
325 Ga0495624_0000031 3300046690 Bacteria 91702
326 Ga0495624_0037983 3300046690 Bacteria 3096
327 Ga0495670_0041667 3300046691 Bacteria 2291
328 Ga0495649_0040054 3300046694 Bacteria 2567
329 Ga0495600_0001252 3300046809 Bacteria 13978
330 Ga0495600_0023088 3300046809 Bacteria 4001
331 Ga0495604_0000636 3300047317 Bacteria 30130
332 Ga0495604_0001593 3300047317 Bacteria 18689
333 Ga0495674_0004050 3300047319 Bacteria 14178
334 Ga0495672_0142528 3300047320 Bacteria 1250
335 Ga0495676_0000209 3300047321 Bacteria 46557
336 Ga0495676_0000624 3300047321 Bacteria 29322
337 Ga0495676_0002889 3300047321 Bacteria 15495
338 Ga0495680_0000094 3300047322 Bacteria 80355
339 Ga0495680_0000332 3300047322 Bacteria 52925
340 Ga0495680_0010267 3300047322 Bacteria 8355
341 Ga0495680_0124091 3300047322 Bacteria 1904
342 Ga0495675_0000051 3300047444 Bacteria 80375
343 Ga0495679_044460 3300047446 Bacteria 1360
344 Ga0495685_042063 3300047447 Bacteria 1560
345 Ga0495686_0008917 3300047472 Bacteria 7291
346 Ga0495593_0058369 3300047673 Bacteria 2024
347 Ga0495602_0000038 3300048088 Bacteria 130758
348 Ga0495602_0002031 3300048088 Bacteria 20359
349 Ga0495602_0133551 3300048088 Bacteria 1975
350 Ga0495602_0221192 3300048088 Bacteria 1429
351 Ga0496100_0000006 3300048903 Bacteria 297429
352 Ga0496100_0000028 3300048903 Bacteria 113912
353 Ga0496101_0000005 3300048904 Bacteria 331455
354 Ga0496101_0000009 3300048904 Bacteria 297429
355 Ga0496102_0000021 3300048905 Bacteria 246920
356 Ga0496102_0031863 3300048905 Bacteria 4732
357 Ga0496102_0120196 3300048905 Bacteria 2453
358 Ga0496103_0000001 3300048906 Bacteria 643471
359 Ga0496103_0023273 3300048906 Bacteria 3735
360 Ga0496103_0027757 3300048906 Bacteria 3433
361 Ga0496103_0056705 3300048906 Bacteria 2432
362 Ga0496104_0000008 3300048907 Bacteria 516976
363 Ga0496104_0000029 3300048907 Bacteria 202968
364 Ga0496104_0108935 3300048907 Bacteria 2655
365 Ga0496105_0000002 3300048908 Bacteria 753215
366 Ga0496105_0000003 3300048908 Bacteria 713251
367 Ga0496105_0000876 3300048908 Bacteria 20602
368 Ga0496105_0020070 3300048908 Bacteria 5395
369 Ga0496105_0048057 3300048908 Bacteria 3522
370 Ga0496106_0000070 3300048909 Bacteria 82770
371 Ga0496106_0000090 3300048909 Bacteria 72270
372 Ga0496106_0000101 3300048909 Bacteria 65644
373 Ga0496107_0000004 3300048910 Bacteria 297680
374 Ga0496107_0000015 3300048910 Bacteria 173644
375 Ga0496107_0035771 3300048910 Bacteria 3561
376 Ga0496107_0173708 3300048910 Bacteria 1599
377 Ga0496108_0000004 3300048911 Bacteria 545055
378 Ga0496108_0000042 3300048911 Bacteria 146397
379 Ga0496108_0000178 3300048911 Bacteria 58913
380 Ga0496108_0005504 3300048911 Bacteria 10245
381 Ga0496108_0038231 3300048911 Bacteria 3998
382 Ga0496109_0000034 3300048912 Bacteria 160397
383 Ga0496109_0000036 3300048912 Bacteria 153972
384 Ga0496109_0000391 3300048912 Bacteria 39830
385 Ga0496109_0001026 3300048912 Bacteria 23100
386 Ga0496109_0010089 3300048912 Bacteria 8060
387 Ga0496109_0252459 3300048912 Bacteria 1661
388 Ga0496109_0353448 3300048912 Bacteria 1388
389 Ga0496109_0637944 3300048912 Unclassified 1002
390 Ga0496110_0000122 3300048913 Bacteria 43513
391 Ga0496110_0007589 3300048913 Bacteria 8668
392 Ga0496110_0025709 3300048913 Bacteria 5034
393 Ga0496110_0059015 3300048913 Bacteria 3380
394 Ga0496111_0000037 3300048914 Bacteria 52978
395 Ga0496111_0080264 3300048914 Unclassified 2380
396 Ga0496111_0224791 3300048914 Bacteria 1394
397 Ga0496112_0000002 3300048915 Bacteria 782039
398 Ga0496112_0010244 3300048915 Bacteria 8499
399 Ga0496113_0000002 3300048916 Bacteria 220193
400 Ga0496113_0018796 3300048916 Bacteria 4820
401 Ga0496113_0030978 3300048916 Bacteria 3877
402 Ga0496113_0164654 3300048916 Bacteria 1754
403 Ga0496114_0000159 3300048917 Bacteria 47728
404 Ga0496114_0005005 3300048917 Bacteria 10338
405 Ga0496114_0131161 3300048917 Bacteria 2164
406 Ga0496114_0272529 3300048917 Bacteria 1491
407 Ga0496115_0000005 3300048918 Bacteria 290756
408 Ga0496115_0000257 3300048918 Bacteria 47123
409 Ga0496116_0000138 3300048919 Bacteria 151606
410 Ga0496118_0001277 3300048921 Bacteria 38534
411 Ga0496118_0035997 3300048921 Bacteria 4010
412 Ga0496118_0149978 3300048921 Bacteria 1461
413 Ga0496119_0003660 3300048922 Bacteria 15783
414 Ga0496119_0021239 3300048922 Bacteria 4699
415 Ga0496119_0024862 3300048922 Bacteria 4199
416 Ga0496119_0164991 3300048922 Bacteria 1174
417 Ga0496120_0002330 3300048923 Bacteria 19539
418 Ga0496121_0006772 3300048924 Bacteria 14054
419 Ga0496121_0095795 3300048924 Bacteria 2305
420 Ga0496125_0028985 3300048928 Bacteria 4985
421 Ga0496125_0074977 3300048928 Bacteria 2620
422 Ga0496126_0007436 3300048929 Bacteria 12015
423 Ga0496126_0045157 3300048929 Bacteria 4052
424 Ga0496126_0182320 3300048929 Bacteria 1783
425 Ga0501031_0003336 3300049568 Bacteria 10303
426 Ga0501032_0009040 3300049569 Bacteria 7239
427 Ga0501033_0005116 3300049570 Bacteria 10430
428 Ga0501034_0003804 3300049571 Bacteria 17018
429 Ga0501034_0022387 3300049571 Bacteria 6439
430 Ga0501034_0051243 3300049571 Bacteria 4162
431 Ga0501034_0119650 3300049571 Bacteria 2620
432 Ga0501034_0204127 3300049571 Bacteria 1933
433 Ga0501036_0073446 3300049572 Bacteria 2891
434 Ga0501037_0009327 3300049573 Bacteria 7200
435 Ga0501038_0014268 3300049574 Bacteria 7239
436 Ga0501039_0045896 3300049575 Bacteria 3376
437 Ga0501039_0089346 3300049575 Bacteria 2401
438 Ga0501040_0017812 3300049576 Bacteria 4715
439 Ga0501042_0024380 3300049578 Bacteria 4242
440 Ga0501042_0044650 3300049578 Bacteria 3158
441 Ga0501042_0056709 3300049578 Bacteria 2795
442 Ga0501043_0001141 3300049579 Bacteria 23356
443 Ga0501043_0217466 3300049579 Bacteria 1479
444 Ga0501046_0009482 3300049580 Bacteria 8413
445 Ga0501047_0003662 3300049581 Bacteria 14481
446 Ga0501047_0077493 3300049581 Bacteria 3197
447 Ga0501047_0153051 3300049581 Bacteria 2181
448 Ga0501047_0249364 3300049581 Bacteria 1624
449 Ga0501048_0009669 3300049582 Bacteria 7234
450 Ga0501067_0034805 3300049583 Bacteria 2796
451 Ga0501068_0032152 3300049584 Bacteria 3119
452 Ga0501068_0033339 3300049584 Bacteria 3067
453 Ga0501068_0061938 3300049584 Bacteria 2274
454 Ga0501069_0002690 3300049585 Bacteria 9072
455 Ga0501069_0024220 3300049585 Bacteria 3310
456 Ga0501069_0323404 3300049585 Bacteria 906
457 Ga0501070_0005806 3300049586 Bacteria 10532
458 Ga0501070_0007976 3300049586 Bacteria 8970
459 Ga0501070_0124388 3300049586 Bacteria 2131
460 Ga0501070_0277885 3300049586 Bacteria 1367
461 Ga0501071_0051249 3300049587 Bacteria 2974
462 Ga0501072_0045489 3300049588 Bacteria 3452
463 Ga0501073_0040030 3300049589 Bacteria 3319
464 Ga0501074_0008960 3300049590 Bacteria 7258
465 Ga0501075_0004446 3300049591 Bacteria 9488
466 Ga0501079_0010469 3300049741 Bacteria 7051
467 Ga0501080_0059103 3300049742 Bacteria 3568
468 Ga0501080_0246741 3300049742 Unclassified 1628
469 Ga0501080_0343279 3300049742 Unclassified 1349
470 Ga0501081_0059098 3300049743 Bacteria 2654
471 Ga0501081_0160128 3300049743 Bacteria 1622
472 Ga0501083_0021607 3300049744 Bacteria 4469
473 Ga0501083_0023580 3300049744 Bacteria 4266
474 Ga0501035_0007460 3300049822 Bacteria 10214
475 Ga0501044_0007015 3300049823 Bacteria 12399
476 Ga0501044_0203844 3300049823 Bacteria 1935
477 Ga0501044_0283305 3300049823 Bacteria 1590
478 Ga0501045_0049109 3300049824 Bacteria 3076
479 nmdc:mga03n38_84416_c1 3300050490 Unclassified 1499
480 nmdc:mga00v17_335511_c1 3300050491 Unclassified 983
481 nmdc:mga00v17_60501_c1 3300050491 Bacteria 2326
482 nmdc:mga0yw44_1878_c1 3300050492 Bacteria 8644
483 nmdc:mga0qj67_59238_c1 3300050509 Bacteria 3036
484 nmdc:mga0a205_15_c1 3300050515 Bacteria 33986
485 nmdc:mga0a205_3790_c1 3300050515 Bacteria 13540
486 Ga0495601_0000019 3300053077 Bacteria 161673
487 Ga0495601_0000059 3300053077 Bacteria 60752
488 Ga0495601_0018526 3300053077 Bacteria 4239
489 Ga0495612_0001133 3300053078 Bacteria 10927
490 Ga0495612_0001929 3300053078 Bacteria 8537
491 Ga0495612_0058792 3300053078 Bacteria 1589
492 Ga0495655_0000008 3300053083 Bacteria 153535
493 Ga0495655_0056444 3300053083 Bacteria 1057
494 Ga0495595_0000009 3300053084 Bacteria 193039
495 Ga0495595_0000213 3300053084 Bacteria 23371
496 Ga0495595_0001807 3300053084 Bacteria 8340
497 Ga0495619_0000001 3300053085 Bacteria 586054
498 Ga0495619_0000057 3300053085 Bacteria 93948
499 Ga0495619_0000069 3300053085 Bacteria 82755
500 Ga0495619_0000347 3300053085 Bacteria 32351
501 Ga0495619_0002458 3300053085 Bacteria 12117
502 Ga0495619_0005611 3300053085 Bacteria 7959
503 Ga0495619_0011363 3300053085 Bacteria 5607
504 Ga0495619_0090877 3300053085 Bacteria 2067
505 Ga0500566_0029398 3300053094 Bacteria 3210
506 Ga0500641_0009782 3300053096 Bacteria 3451
507 Ga0500554_086565 3300053102 Unclassified 1037
508 Ga0500595_044606 3300053119 Bacteria 1404
509 Ga0500614_001627 3300053123 Bacteria 5294
510 Ga0500628_000043 3300053129 Bacteria 45301
511 Ga0501084_0079345 3300054114 Bacteria 2751
512 Ga0501082_0044209 3300060353 Bacteria 3842
513 Ga0451853_1358421
514 JGI24746J21847_1000556
515 JGI24748J21848_1002016
516 JGI24034J26672_10000147
517 Ga0070683_100003645
518 Ga0070683_100031376
519 Ga0070683_100092824
520 Ga0070683_100275108
521 Ga0070677_10000020
522 Ga0070682_100000009
523 Ga0070682_100000032
524 Ga0070682_100242916
525 Ga0068868_100061700
526 Ga0068868_100070495
527 Ga0070691_10000003
528 Ga0070691_10000348
529 Ga0070661_100000032
530 Ga0070692_10018423
531 Ga0070668_100029027
532 Ga0070668_100041672
533 Ga0070675_100000022
534 Ga0070671_100154846
535 Ga0070674_100000021
536 Ga0070674_100000075
537 Ga0070673_100008528
538 Ga0070688_100000031
539 Ga0070688_100000194
540 Ga0070688_100041121
541 Ga0070659_100002039
542 Ga0070659_100101582
543 Ga0070667_100001503
544 Ga0070667_100015838
545 Ga0070714_100074920
546 Ga0070714_100074954
547 Ga0070713_100000516
548 Ga0070713_100045444
549 Ga0070710_10081672
550 Ga0070711_100028366
551 Ga0070711_100068958
552 Ga0070700_100083667
553 Ga0070700_100099506
554 Ga0070663_100033780
555 Ga0070663_100282127
556 Ga0070678_100011255
557 Ga0070662_100000052
558 Ga0070681_10010128
559 Ga0070681_10056853
560 Ga0068867_100029739
561 Ga0070685_10000058
562 Ga0070685_10000263
563 Ga0070685_10132509
564 Ga0070679_100000134
565 Ga0070679_100019644
566 Ga0070684_100039278
567 Ga0070684_100055447
568 Ga0070684_100080217
569 Ga0070684_100084428
570 Ga0070684_100099400
571 Ga0070684_100521935
572 Ga0068853_100015477
573 Ga0070672_100000258
574 Ga0070695_100203244
575 Ga0070693_100003269
576 Ga0070665_100000022
577 Ga0070665_100001623
578 Ga0070665_100186690
579 Ga0070704_100091354
580 Ga0068857_100045709
581 Ga0068854_100000133
582 Ga0068854_100023995
583 Ga0068856_100000369
584 Ga0068856_100008918
585 Ga0070702_100112910
586 Ga0068852_100000024
587 Ga0068864_100000023
588 Ga0068866_10000007
589 Ga0068866_10000469
590 Ga0068851_10000895
591 Ga0068851_10004054
592 Ga0068863_100000110
593 Ga0068863_100026684
594 Ga0068863_100393201
595 Ga0068858_100000150
596 Ga0068858_100000329
597 Ga0068858_100043131
598 Ga0068858_100149533
599 Ga0068860_100011273
600 Ga0068862_100004171
601 Ga0081455_10008364
602 Ga0081455_10040573
603 Ga0081455_10041806
604 Ga0081455_10067212
605 Ga0081455_10164303
606 Ga0081455_10183350
607 Ga0081455_10301681
608 Ga0081540_1001588
609 Ga0081539_10001052
610 Ga0081539_10022350
611 Ga0075363_100010859
612 Ga0075364_10171734
613 Ga0070715_10000003
614 Ga0070715_10145985
615 Ga0070716_100132062
616 Ga0070712_100016243
617 Ga0075367_10043857
618 Ga0097621_100581550
619 Ga0075430_100048532
620 Ga0075431_100179264
621 Ga0075433_10002915
622 Ga0075433_10003283
623 Ga0068865_100000024
624 Ga0105245_10000022
625 Ga0105245_10001178
626 Ga0105245_10008000
627 Ga0105245_10267092
628 Ga0105247_10000064
629 Ga0105247_10072683
630 Ga0105243_10012040
631 Ga0105242_10000123
632 Ga0105242_10013245
633 Ga0105242_10064933
634 Ga0105248_10000017
635 Ga0105238_10000016
636 Ga0105249_10000181
637 Ga0105249_10012298
638 Ga0105239_10288660
639 Ga0105246_10306240
640 Ga0157371_10001783
641 Ga0157370_10049032
642 Ga0157369_10000068
643 Ga0157374_10005308
644 Ga0157374_10700813
645 Ga0157378_10000656
646 Ga0157378_10087628
647 Ga0157375_10000126
648 Ga0163163_10438413
649 Ga0157380_10000328
650 Ga0157380_10104533
651 Ga0157377_10077334
652 Ga0157379_10031333
653 Ga0157379_10047841
654 Ga0157379_10088250
655 Ga0157376_10018824
656 Ga0157376_10093379
657 Ga0163161_10000013
658 Ga0163161_10052079
659 Ga0207656_10000274
660 Ga0207656_10004135
661 Ga0207682_10000050
662 Ga0207642_10000008
663 Ga0207642_10000181
664 Ga0207710_10000165
665 Ga0207680_10011411
666 Ga0207680_10126296
667 Ga0207685_10000003
668 Ga0207705_10100545
669 Ga0207707_10035644
670 Ga0207707_10036138
671 Ga0207663_10066167
672 Ga0207649_10000015
673 Ga0207652_10001289
674 Ga0207652_10003408
675 Ga0207694_10000012
676 Ga0207659_10000030
677 Ga0207687_10000025
678 Ga0207687_10000039
679 Ga0207687_10006005
680 Ga0207687_10007709
681 Ga0207700_10000019
682 Ga0207700_10036698
683 Ga0207664_10009739
684 Ga0207664_10057860
685 Ga0207690_10005737
686 Ga0207690_10015961
687 Ga0207706_10000137
688 Ga0207686_10000066
689 Ga0207686_10000592
690 Ga0207686_10050440
691 Ga0207686_10105615
692 Ga0207709_10014890
693 Ga0207669_10000032
694 Ga0207669_10000091
695 Ga0207669_10299513
696 Ga0207704_10000054
697 Ga0207665_10131145
698 Ga0207691_10000871
699 Ga0207711_10000011
700 Ga0207661_10002638
701 Ga0207661_10004497
702 Ga0207661_10053194
703 Ga0207661_10470190
704 Ga0207651_10021515
705 Ga0207712_10000067
706 Ga0207712_10033097
707 Ga0207668_10025559
708 Ga0207668_10072576
709 Ga0207640_10000147
710 Ga0207640_10053916
711 Ga0207658_10043805
712 Ga0207658_10130823
713 Ga0207677_10043277
714 Ga0207677_10066262
715 Ga0207703_10000070
716 Ga0207703_10000122
717 Ga0207678_10019235
718 Ga0207708_10061704
719 Ga0207702_10000326
720 Ga0207702_10000557
721 Ga0207702_10012405
722 Ga0207702_10232381
723 Ga0207641_10000065
724 Ga0207641_10019506
725 Ga0207648_10043310
726 Ga0207676_10000025
727 Ga0207674_10069830
728 Ga0207675_100581400
729 Ga0207683_10020523
730 Ga0207683_10072848
731 Ga0207698_10000014
732 Ga0268266_10000029
733 Ga0268266_10000422
734 Ga0268266_10000973
735 Ga0268266_10111563
736 Ga0268265_10005246
737 Ga0268264_10007756
738 Ga0265337_1000730
739 Ga0265326_10000040
740 Ga0265322_10000012
741 Ga0265338_10000156
742 Ga0265324_10000567
743 Ga0265328_10008624
744 Ga0265320_10000001
745 Ga0265329_10007672
746 Ga0265339_10021395
747 Ga0265331_10031968
748 Ga0265327_10000003
749 Ga0265316_10023963
750 Ga0265314_10000334
751 Ga0316576_10012462
752 Ga0316574_0009823
753 Ga0316574_0213315
754 Ga0373937_0033886
755 Ga0316584_0002818
756 Ga0395900_0229801
757 Ga0395898_0129650
758 Ga0395905_0278150
759 Ga0395901_0482600
760 Ga0395901_0687483
761 Ga0451833_0445893
762 Ga0451847_0609686
763 Ga0451849_1233055
764 Ga0466963_0000257
765 Ga0466963_0008184
766 Ga0466963_0130248
767 Ga0466957_0000193
768 Ga0466957_0173007
769 Ga0466967_0000849
770 Ga0466967_0207368
771 Ga0495592_0000424
772 Ga0495592_0095525
773 Ga0495603_0000083
774 Ga0495603_0004890
775 Ga0495629_0001145
776 Ga0495629_0005665
777 Ga0495629_0050304
778 Ga0495629_0190161
779 Ga0495641_0000010
780 Ga0495651_0073968
781 Ga0495653_0006069
782 Ga0495653_0079686
783 Ga0495582_0000006
784 Ga0495662_0000178
785 Ga0495594_0000001
786 Ga0495606_0000283
787 Ga0495608_0000042
788 Ga0495608_0003416
789 Ga0495608_0007777
790 Ga0495618_0000037
791 Ga0495620_0000731
792 Ga0495620_0082089
793 Ga0495628_0000265
794 Ga0495628_0017094
795 Ga0495628_0082001
796 Ga0495628_0140673
797 Ga0495628_0159635
798 Ga0495630_0000148
799 Ga0495630_0000586
800 Ga0495637_0107457
801 Ga0495644_0004691
802 Ga0495652_0000009
803 Ga0495652_0039820
804 Ga0495640_0003678
805 Ga0495640_0050712
806 Ga0495586_0008020
807 Ga0495586_0167990
808 Ga0495587_0002629
809 Ga0495587_0015546
810 Ga0495598_0001441
811 Ga0495621_0005233
812 Ga0495645_0016069
813 Ga0495645_0080076
814 Ga0495622_0000069
815 Ga0495667_0000109
816 Ga0495656_0003522
817 Ga0495668_0057343
818 Ga0495634_0000021
819 Ga0495634_0000951
820 Ga0495634_0142664
821 Ga0495625_0000109
822 Ga0495635_0000006
823 Ga0495635_0038592
824 Ga0495635_0081100
825 Ga0495588_0098562
826 Ga0495657_0000040
827 Ga0495599_0020110
828 Ga0495623_0091266
829 Ga0495647_0000002
830 Ga0495647_0002786
831 Ga0495647_0034003
832 Ga0495658_0000027
833 Ga0495669_0000132
834 Ga0495613_0000190
835 Ga0495613_0000324
836 Ga0495624_0000005
837 Ga0495624_0000031
838 Ga0495624_0037983
839 Ga0495670_0041667
840 Ga0495649_0040054
841 Ga0495600_0001252
842 Ga0495600_0023088
843 Ga0495604_0000636
844 Ga0495604_0001593
845 Ga0495674_0004050
846 Ga0495672_0142528
847 Ga0495676_0000209
848 Ga0495676_0000624
849 Ga0495676_0002889
850 Ga0495680_0000094
851 Ga0495680_0000332
852 Ga0495680_0010267
853 Ga0495680_0124091
854 Ga0495675_0000051
855 Ga0495679_044460
856 Ga0495685_042063
857 Ga0495686_0008917
858 Ga0495593_0058369
859 Ga0495602_0000038
860 Ga0495602_0002031
861 Ga0495602_0133551
862 Ga0495602_0221192
863 Ga0496100_0000006
864 Ga0496100_0000028
865 Ga0496101_0000005
866 Ga0496101_0000009
867 Ga0496102_0000021
868 Ga0496102_0031863
869 Ga0496102_0120196
870 Ga0496103_0000001
871 Ga0496103_0023273
872 Ga0496103_0027757
873 Ga0496103_0056705
874 Ga0496104_0000008
875 Ga0496104_0000029
876 Ga0496104_0108935
877 Ga0496105_0000002
878 Ga0496105_0000003
879 Ga0496105_0000876
880 Ga0496105_0020070
881 Ga0496105_0048057
882 Ga0496106_0000070
883 Ga0496106_0000090
884 Ga0496106_0000101
885 Ga0496107_0000004
886 Ga0496107_0000015
887 Ga0496107_0035771
888 Ga0496107_0173708
889 Ga0496108_0000004
890 Ga0496108_0000042
891 Ga0496108_0000178
892 Ga0496108_0005504
893 Ga0496108_0038231
894 Ga0496109_0000034
895 Ga0496109_0000036
896 Ga0496109_0000391
897 Ga0496109_0001026
898 Ga0496109_0010089
899 Ga0496109_0252459
900 Ga0496109_0353448
901 Ga0496109_0637944
902 Ga0496110_0000122
903 Ga0496110_0007589
904 Ga0496110_0025709
905 Ga0496110_0059015
906 Ga0496111_0000037
907 Ga0496111_0080264
908 Ga0496111_0224791
909 Ga0496112_0000002
910 Ga0496112_0010244
911 Ga0496113_0000002
912 Ga0496113_0018796
913 Ga0496113_0030978
914 Ga0496113_0164654
915 Ga0496114_0000159
916 Ga0496114_0005005
917 Ga0496114_0131161
918 Ga0496114_0272529
919 Ga0496115_0000005
920 Ga0496115_0000257
921 Ga0496116_0000138
922 Ga0496118_0001277
923 Ga0496118_0035997
924 Ga0496118_0149978
925 Ga0496119_0003660
926 Ga0496119_0021239
927 Ga0496119_0024862
928 Ga0496119_0164991
929 Ga0496120_0002330
930 Ga0496121_0006772
931 Ga0496121_0095795
932 Ga0496125_0028985
933 Ga0496125_0074977
934 Ga0496126_0007436
935 Ga0496126_0045157
936 Ga0496126_0182320
937 Ga0501031_0003336
938 Ga0501032_0009040
939 Ga0501033_0005116
940 Ga0501034_0003804
941 Ga0501034_0022387
942 Ga0501034_0051243
943 Ga0501034_0119650
944 Ga0501034_0204127
945 Ga0501036_0073446
946 Ga0501037_0009327
947 Ga0501038_0014268
948 Ga0501039_0045896
949 Ga0501039_0089346
950 Ga0501040_0017812
951 Ga0501042_0024380
952 Ga0501042_0044650
953 Ga0501042_0056709
954 Ga0501043_0001141
955 Ga0501043_0217466
956 Ga0501046_0009482
957 Ga0501047_0003662
958 Ga0501047_0077493
959 Ga0501047_0153051
960 Ga0501047_0249364
961 Ga0501048_0009669
962 Ga0501067_0034805
963 Ga0501068_0032152
964 Ga0501068_0033339
965 Ga0501068_0061938
966 Ga0501069_0002690
967 Ga0501069_0024220
968 Ga0501069_0323404
969 Ga0501070_0005806
970 Ga0501070_0007976
971 Ga0501070_0124388
972 Ga0501070_0277885
973 Ga0501071_0051249
974 Ga0501072_0045489
975 Ga0501073_0040030
976 Ga0501074_0008960
977 Ga0501075_0004446
978 Ga0501079_0010469
979 Ga0501080_0059103
980 Ga0501080_0246741
981 Ga0501080_0343279
982 Ga0501081_0059098
983 Ga0501081_0160128
984 Ga0501083_0021607
985 Ga0501083_0023580
986 Ga0501035_0007460
987 Ga0501044_0007015
988 Ga0501044_0203844
989 Ga0501044_0283305
990 Ga0501045_0049109
991 nmdc:mga03n38_84416_c1
992 nmdc:mga00v17_335511_c1
993 nmdc:mga00v17_60501_c1
994 nmdc:mga0yw44_1878_c1
995 nmdc:mga0qj67_59238_c1
996 nmdc:mga0a205_15_c1
997 nmdc:mga0a205_3790_c1
998 Ga0495601_0000019
999 Ga0495601_0000059
1000 Ga0495601_0018526
1001 Ga0495612_0001133
1002 Ga0495612_0001929
1003 Ga0495612_0058792
1004 Ga0495655_0000008
1005 Ga0495655_0056444
1006 Ga0495595_0000009
1007 Ga0495595_0000213
1008 Ga0495595_0001807
1009 Ga0495619_0000001
1010 Ga0495619_0000057
1011 Ga0495619_0000069
1012 Ga0495619_0000347
1013 Ga0495619_0002458
1014 Ga0495619_0005611
1015 Ga0495619_0011363
1016 Ga0495619_0090877
1017 Ga0500566_0029398
1018 Ga0500641_0009782
1019 Ga0500554_086565
1020 Ga0500595_044606
1021 Ga0500614_001627
1022 Ga0500628_000043
1023 Ga0501084_0079345
1024 Ga0501082_0044209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

86

314

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8853 16 299
4j5h-assembly1.cif.gz_A crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site 0.8832 22 299
5eht-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8806 16 299
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8798 16 299
3dha-assembly1.cif.gz_A an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site 0.8696 17 299
ID Description Score Start End Superfamily
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8793 16 295 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8726 16 295 3.60.15.10
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8487 25 296 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.835 21 303 3.60.15.10
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8293 21 303 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A538A8T2-F1-model_v4 N-acyl homoserine lactonase family protein 0.9759 1 303
AF-A0A538A8T2-F1-model_v4 N-acyl homoserine lactonase family protein 0.9727 1 303
AF-A0A6I2Y8S9-F1-model_v4 MBL fold metallo-hydrolase 0.9584 5 298 GO:0016787
AF-A0A5C7Q2I0-F1-model_v4 N-acyl homoserine lactonase family protein 0.9527 63 297
AF-A0A534QS42-F1-model_v4 N-acyl homoserine lactonase family protein 0.9499 34 299

Map