F457463

General Info

Members Datasets Scaffolds Average Seq Length
512 247 1024 157

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0006325|Ga0466967_0006325_864_1373
Length 169
Sequence MLSGGAQGAILSKPEDYLALAVQLALDNVLIRKGRPFGALLVKDGQIVASAVNNVLASHDPTAHAELEAIRLAARAQQNPRLDGHVMYASGHPCPMCLAAMYLVGIPQVYYAYSNEDGEPVGLSTSSLYAELTKPLSMQAMQLEHRPVRPAGMDLYEAWKRLNDDPPKE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
139 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
232 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
233 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
234 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
235 2643221734 Bosea sp. Root670 Isolate Unclassified
236 2643221736 Bosea sp. Root483D1 Isolate Unclassified
237 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
238 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
239 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
240 2928058823 Ralstonia sp. 1138 Isolate Unclassified
241 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
242 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
243 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
244 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
245 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
246 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
247 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.2
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.85
Nodule 0.98
Rhizoplane 2.34
Rhizosphere 65.82
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0006325 3300045976 Bacteria 8362
2 JGI24740J21852_10000165 3300001979 Bacteria 26307
3 JGI25162J39368_1000111 3300002737 Bacteria 89317
4 JGI25154J39366_1000536 3300002738 Bacteria 18958
5 JGI25159J45721_1006237 3300002987 Bacteria 3603
6 JGI25151J46595_10000846 3300003187 Bacteria 24391
7 JGI25151J46595_10001459 3300003187 Bacteria 16043
8 JGI25151J46595_10015852 3300003187 Bacteria 3309
9 JGI25151J46595_10021024 3300003187 Bacteria 2738
10 JGI25165J46597_1001440 3300003214 Bacteria 12658
11 JGI25165J46597_1035630 3300003214 Bacteria 640
12 JGI25153J46596_10056366 3300003215 Bacteria 1094
13 rootL2_10174794 3300003322 Bacteria 3022
14 rootH1_10242536 3300003323 Bacteria 3288
15 Ga0055538_1002615 3300003751 Bacteria 2565
16 Ga0055539_1000201 3300003752 Bacteria 47514
17 Ga0055533_1000937 3300003756 Bacteria 8647
18 Ga0055532_1000073 3300003758 Bacteria 131021
19 Ga0055525_1000366 3300003759 Bacteria 30305
20 Ga0055525_1005504 3300003759 Bacteria 1075
21 Ga0055535_1000055 3300003761 Bacteria 131021
22 Ga0055542_1000721 3300003762 Bacteria 25885
23 Ga0055529_1000149 3300003763 Bacteria 100620
24 Ga0055526_1003295 3300003771 Bacteria 10350
25 Ga0055526_1004820 3300003771 Bacteria 7973
26 Ga0055526_1022147 3300003771 Bacteria 2176
27 Ga0055526_1024545 3300003771 Bacteria 1967
28 Ga0055526_1027604 3300003771 Bacteria 1748
29 Ga0055537_1000057 3300003773 Bacteria 81507
30 Ga0055524_1000066 3300003775 Bacteria 131691
31 Ga0055524_1015029 3300003775 Bacteria 2840
32 Ga0055524_1018659 3300003775 Bacteria 2400
33 Ga0055524_1022085 3300003775 Bacteria 2089
34 Ga0055536_1000339 3300003781 Bacteria 34551
35 Ga0055536_1007488 3300003781 Bacteria 4871
36 Ga0055536_1010363 3300003781 Bacteria 3712
37 Ga0055536_1084748 3300003781 Bacteria 594
38 Ga0055534_1000175 3300003784 Bacteria 47703
39 Ga0055534_1000247 3300003784 Bacteria 38231
40 Ga0055534_1002727 3300003784 Bacteria 5942
41 Ga0055528_1000023 3300003790 Bacteria 131856
42 Ga0055530_10004258 3300003791 Bacteria 7490
43 Ga0055531_10009885 3300003794 Bacteria 4824
44 Ga0055531_10023298 3300003794 Bacteria 2328
45 Ga0055531_10023925 3300003794 Bacteria 2272
46 Ga0055531_10041843 3300003794 Bacteria 1320
47 Ga0055541_1000336 3300003841 Bacteria 14777
48 Ga0055541_1008961 3300003841 Bacteria 1570
49 Ga0055543_1072670 3300004625 Bacteria 538
50 Ga0065165_1000119 3300005262 Bacteria 134464
51 Ga0065165_1000545 3300005262 Bacteria 56973
52 Ga0065165_1097193 3300005262 Bacteria 742
53 Ga0070680_100268598 3300005336 Bacteria 1444
54 Ga0070680_100349743 3300005336 Bacteria 1257
55 Ga0070682_100014762 3300005337 Bacteria 4518
56 Ga0070661_100000061 3300005344 Bacteria 86581
57 Ga0070659_100002481 3300005366 Bacteria 13107
58 Ga0070659_100170551 3300005366 Bacteria 1782
59 Ga0070714_100553614 3300005435 Bacteria 1101
60 Ga0070663_100000009 3300005455 Bacteria 187718
61 Ga0070663_100013889 3300005455 Bacteria 5152
62 Ga0070663_100068421 3300005455 Bacteria 2578
63 Ga0070663_100144834 3300005455 Bacteria 1817
64 Ga0070663_100279202 3300005455 Bacteria 1331
65 Ga0070681_10067174 3300005458 Bacteria 3554
66 Ga0070681_10321866 3300005458 Bacteria 1456
67 Ga0070679_100035873 3300005530 Bacteria 4920
68 Ga0070684_100017185 3300005535 Bacteria 5930
69 Ga0068853_100013529 3300005539 Bacteria 6666
70 Ga0068855_100752393 3300005563 Bacteria 1039
71 Ga0070664_100000010 3300005564 Bacteria 165664
72 Ga0068857_101052441 3300005577 Bacteria 784
73 Ga0068854_100028644 3300005578 Bacteria 3851
74 Ga0068856_100000045 3300005614 Bacteria 110625
75 Ga0068852_100231301 3300005616 Bacteria 1762
76 Ga0075428_100003085 3300006844 Bacteria 18177
77 Ga0075430_100281184 3300006846 Bacteria 1377
78 Ga0075431_100026710 3300006847 Bacteria 5921
79 Ga0075429_100008248 3300006880 Bacteria 9058
80 Ga0105251_10032244 3300009011 Bacteria 2613
81 Ga0105251_10159556 3300009011 Bacteria 1017
82 Ga0105240_10000739 3300009093 Bacteria 59740
83 Ga0105240_10120343 3300009093 Bacteria 3162
84 Ga0105240_10139498 3300009093 Bacteria 2899
85 Ga0105240_10336432 3300009093 Bacteria 1716
86 Ga0114129_10018969 3300009147 Bacteria 9798
87 Ga0105241_10221252 3300009174 Bacteria 1591
88 Ga0105237_10002121 3300009545 Bacteria 25037
89 Ga0105238_10004352 3300009551 Bacteria 14054
90 Ga0105238_10061034 3300009551 Bacteria 3774
91 Ga0105239_10000454 3300010375 Bacteria 59740
92 Ga0157327_1006626 3300012512 Bacteria 981
93 Ga0157373_10004941 3300013100 Bacteria 10027
94 Ga0157373_10018501 3300013100 Bacteria 5072
95 Ga0157371_10000088 3300013102 Bacteria 145526
96 Ga0157371_10017730 3300013102 Bacteria 5283
97 Ga0157371_10705839 3300013102 Bacteria 755
98 Ga0157370_10000041 3300013104 Bacteria 133912
99 Ga0157370_10008961 3300013104 Bacteria 10742
100 Ga0157370_10495702 3300013104 Bacteria 1122
101 Ga0157370_10660278 3300013104 Bacteria 955
102 Ga0157369_10265362 3300013105 Bacteria 1790
103 Ga0157369_10435994 3300013105 Bacteria 1357
104 Ga0171462_1015 3300013250 Bacteria 169578
105 Ga0157372_10000097 3300013307 Bacteria 90742
106 Ga0157372_10171824 3300013307 Bacteria 2508
107 Ga0182008_10022898 3300014497 Bacteria 3197
108 Ga0182006_1003196 3300015261 Bacteria 8528
109 Ga0182006_1016828 3300015261 Bacteria 3116
110 Ga0182007_10002998 3300015262 Bacteria 8175
111 Ga0183360_10001 3300015689 Bacteria 3943671
112 Ga0197907_10007993 3300020069 Bacteria 783
113 Ga0209760_100795 3300025207 Bacteria 4333
114 Ga0209784_100008 3300025224 Bacteria 740293
115 Ga0209784_100262 3300025224 Bacteria 31953
116 Ga0209566_100006 3300025225 Bacteria 789272
117 Ga0209566_100407 3300025225 Bacteria 34223
118 Ga0209566_100636 3300025225 Bacteria 21451
119 Ga0209674_100045 3300025226 Bacteria 362387
120 Ga0209674_100114 3300025226 Bacteria 139197
121 Ga0209147_100005 3300025229 Bacteria 1036530
122 Ga0209563_100016 3300025230 Bacteria 802091
123 Ga0209563_111699 3300025230 Bacteria 1230
124 Ga0209437_100064 3300025233 Bacteria 334360
125 Ga0209258_100007 3300025242 Bacteria 1036530
126 Ga0209646_1000027 3300025246 Bacteria 395141
127 Ga0209026_1003785 3300025250 Bacteria 4791
128 Ga0209677_100008 3300025253 Bacteria 802091
129 Ga0209677_105391 3300025253 Bacteria 3349
130 Ga0209148_1000019 3300025254 Bacteria 748518
131 Ga0209759_1004768 3300025256 Bacteria 4956
132 Ga0209759_1045859 3300025256 Bacteria 711
133 Ga0209233_1000081 3300025261 Bacteria 336832
134 Ga0209233_1004045 3300025261 Bacteria 5074
135 Ga0209565_1000005 3300025263 Bacteria 947317
136 Ga0209565_1000094 3300025263 Bacteria 134853
137 Ga0209455_1000011 3300025272 Bacteria 947242
138 Ga0209673_1000027 3300025273 Bacteria 360561
139 Ga0209673_1007856 3300025273 Bacteria 4831
140 Ga0209673_1007992 3300025273 Bacteria 4770
141 Ga0209130_1000244 3300025284 Bacteria 68915
142 Ga0209130_1000702 3300025284 Bacteria 29997
143 Ga0209130_1015852 3300025284 Bacteria 1843
144 Ga0209675_1000004 3300025291 Bacteria 947166
145 Ga0209675_1000079 3300025291 Bacteria 155554
146 Ga0209675_1002258 3300025291 Bacteria 10059
147 Ga0209675_1010617 3300025291 Bacteria 3127
148 Ga0209675_1021220 3300025291 Bacteria 1736
149 Ga0209676_1000176 3300025292 Bacteria 152347
150 Ga0209676_1001097 3300025292 Bacteria 30146
151 Ga0209676_1005557 3300025292 Bacteria 6527
152 Ga0209676_1006363 3300025292 Bacteria 5852
153 Ga0209676_1030419 3300025292 Bacteria 1651
154 Ga0209676_1039738 3300025292 Bacteria 1333
155 Ga0209676_1040147 3300025292 Bacteria 1321
156 Ga0209025_1000046 3300025294 Bacteria 348962
157 Ga0209025_1000224 3300025294 Bacteria 133328
158 Ga0209025_1002162 3300025294 Bacteria 21902
159 Ga0209025_1007268 3300025294 Bacteria 8321
160 Ga0209025_1015187 3300025294 Bacteria 4667
161 Ga0209025_1077870 3300025294 Unclassified 1141
162 Ga0209564_1000050 3300025295 Bacteria 360560
163 Ga0209564_1000166 3300025295 Bacteria 160208
164 Ga0209564_1000308 3300025295 Bacteria 96489
165 Ga0209564_1000509 3300025295 Bacteria 63951
166 Ga0209564_1005648 3300025295 Bacteria 7026
167 Ga0209564_1047058 3300025295 Bacteria 1091
168 Ga0209758_1002177 3300025297 Bacteria 20570
169 Ga0209050_1001060 3300025298 Bacteria 33818
170 Ga0209050_1006506 3300025298 Bacteria 6888
171 Ga0209050_1046019 3300025298 Bacteria 1150
172 Ga0209256_1000031 3300025299 Bacteria 410189
173 Ga0209256_1000960 3300025299 Bacteria 34857
174 Ga0209256_1001956 3300025299 Bacteria 18677
175 Ga0209256_1008858 3300025299 Bacteria 4549
176 Ga0209256_1008871 3300025299 Bacteria 4545
177 Ga0207426_1000151 3300025302 Bacteria 185103
178 Ga0207426_1000215 3300025302 Bacteria 136757
179 Ga0207426_1035838 3300025302 Bacteria 1581
180 Ga0207426_1079226 3300025302 Bacteria 895
181 Ga0209051_1070857 3300025303 Bacteria 1050
182 Ga0209257_1000255 3300025304 Bacteria 123098
183 Ga0209257_1000283 3300025304 Bacteria 113507
184 Ga0209257_1006338 3300025304 Bacteria 7690
185 Ga0209257_1007543 3300025304 Bacteria 6532
186 Ga0209257_1035848 3300025304 Bacteria 1530
187 Ga0207696_1007558 3300025711 Bacteria 4240
188 Ga0207655_1014101 3300025728 Bacteria 4539
189 Ga0207713_1020832 3300025735 Bacteria 3162
190 Ga0207705_10977475 3300025909 Bacteria 654
191 Ga0207654_11179577 3300025911 Bacteria 558
192 Ga0207707_10094144 3300025912 Bacteria 2617
193 Ga0207695_10000788 3300025913 Bacteria 59670
194 Ga0207695_10006520 3300025913 Bacteria 15107
195 Ga0207695_10296570 3300025913 Bacteria 1508
196 Ga0207695_10565390 3300025913 Bacteria 1018
197 Ga0207671_10000411 3300025914 Bacteria 59718
198 Ga0207671_10137651 3300025914 Bacteria 1879
199 Ga0207649_10000605 3300025920 Bacteria 24240
200 Ga0207652_10049707 3300025921 Bacteria 3591
201 Ga0207652_10974597 3300025921 Bacteria 746
202 Ga0207694_10118163 3300025924 Bacteria 2115
203 Ga0207664_10154990 3300025929 Bacteria 1949
204 Ga0207690_10063206 3300025932 Bacteria 2523
205 Ga0207690_10137932 3300025932 Bacteria 1793
206 Ga0207661_10000109 3300025944 Bacteria 52179
207 Ga0207679_10000002 3300025945 Bacteria 634491
208 Ga0207640_10009624 3300025981 Bacteria 5419
209 Ga0207639_10002690 3300026041 Bacteria 11929
210 Ga0207678_10000018 3300026067 Bacteria 135549
211 Ga0207678_10045408 3300026067 Bacteria 3799
212 Ga0207678_10078794 3300026067 Bacteria 2822
213 Ga0207702_10000053 3300026078 Bacteria 137538
214 Ga0207674_10001653 3300026116 Bacteria 28692
215 Ga0207698_11607399 3300026142 Bacteria 665
216 Ga0209371_1000006 3300027312 Bacteria 1055642
217 Ga0209282_1000019 3300027666 Bacteria 184034
218 Ga0268265_10176603 3300028380 Bacteria 1831
219 Ga0307515_10000029 3300028794 Bacteria 365410
220 Ga0307515_10009918 3300028794 Bacteria 18339
221 Ga0268256_1000007 3300030500 Bacteria 1055326
222 Ga0307513_10010270 3300031456 Bacteria 11754
223 Ga0307406_10297576 3300031901 Bacteria 1238
224 Ga0307406_10619919 3300031901 Bacteria 894
225 Ga0395899_0002516 3300037312 Bacteria 14851
226 Ga0395899_0008931 3300037312 Bacteria 7714
227 Ga0395899_0139154 3300037312 Bacteria 1728
228 Ga0395899_0176000 3300037312 Bacteria 1504
229 Ga0395899_0212784 3300037312 Bacteria 1342
230 Ga0395899_0326895 3300037312 Bacteria 1031
231 Ga0395899_0334003 3300037312 Bacteria 1018
232 Ga0395900_0000006 3300037418 Bacteria 495364
233 Ga0395900_0005617 3300037418 Bacteria 13113
234 Ga0395900_0054526 3300037418 Bacteria 4116
235 Ga0395900_0118521 3300037418 Bacteria 2716
236 Ga0395900_0171384 3300037418 Bacteria 2209
237 Ga0395900_0542173 3300037418 Bacteria 1109
238 Ga0395898_0012851 3300037466 Bacteria 8637
239 Ga0395898_0098108 3300037466 Bacteria 2813
240 Ga0395898_0114289 3300037466 Bacteria 2586
241 Ga0395898_0141682 3300037466 Bacteria 2302
242 Ga0395898_0206248 3300037466 Bacteria 1875
243 Ga0395898_0432874 3300037466 Bacteria 1253
244 Ga0395898_0763789 3300037466 Bacteria 908
245 Ga0395905_0034107 3300037471 Bacteria 4778
246 Ga0395905_0147200 3300037471 Bacteria 2216
247 Ga0395901_0000001 3300038443 Bacteria 800383
248 Ga0395901_0035004 3300038443 Bacteria 5189
249 Ga0395901_0037019 3300038443 Bacteria 5046
250 Ga0395901_0290340 3300038443 Bacteria 1697
251 Ga0395901_0397832 3300038443 Bacteria 1415
252 Ga0395901_0843535 3300038443 Bacteria 902
253 Ga0395901_1811127 3300038443 Bacteria 559
254 Ga0439439_0121575 3300041406 Bacteria 728
255 Ga0439465_0005898 3300041413 Bacteria 3895
256 Ga0439432_017466 3300042006 Bacteria 2407
257 Ga0439449_0013888 3300042007 Bacteria 3028
258 Ga0439452_017109 3300042010 Bacteria 1957
259 Ga0450904_000366 3300042139 Bacteria 9499
260 Ga0466969_0008077 3300044656 Bacteria 5589
261 Ga0466972_0001290 3300044658 Bacteria 12101
262 Ga0466978_0006655 3300044671 Bacteria 5915
263 Ga0466982_0094720 3300044672 Bacteria 1850
264 Ga0466965_0002975 3300044683 Bacteria 7344
265 Ga0466961_0000200 3300044693 Bacteria 40374
266 Ga0466963_0021800 3300044694 Bacteria 4047
267 Ga0466964_0178833 3300044706 Bacteria 1004
268 Ga0466971_0038113 3300044719 Bacteria 2156
269 Ga0466968_0016833 3300044735 Bacteria 2914
270 Ga0466970_0001061 3300044765 Bacteria 13303
271 Ga0466960_0085652 3300044901 Bacteria 1596
272 Ga0466959_0000415 3300045049 Bacteria 24900
273 Ga0466958_0335632 3300045836 Bacteria 972
274 Ga0495627_013868 3300046453 Bacteria 2828
275 Ga0495591_081478 3300046458 Bacteria 824
276 Ga0495580_0315167 3300046472 Bacteria 1063
277 Ga0495580_0735408 3300046472 Bacteria 643
278 Ga0495605_0003211 3300046474 Bacteria 9805
279 Ga0495605_0032403 3300046474 Bacteria 2660
280 Ga0495584_0159253 3300046491 Bacteria 1147
281 Ga0495584_0179618 3300046491 Bacteria 1076
282 Ga0495596_0000086 3300046500 Bacteria 64736
283 Ga0495607_0017794 3300046501 Bacteria 4550
284 Ga0495607_0104383 3300046501 Bacteria 1512
285 Ga0495583_0005337 3300046506 Bacteria 8766
286 Ga0495610_0000221 3300046512 Bacteria 61150
287 Ga0495610_0011438 3300046512 Bacteria 5426
288 Ga0495616_0007103 3300046513 Bacteria 6725
289 Ga0495616_0046048 3300046513 Bacteria 2204
290 Ga0495632_0012840 3300046519 Bacteria 4805
291 Ga0495643_0008500 3300046522 Bacteria 6492
292 Ga0495648_0101533 3300046524 Bacteria 1586
293 Ga0495648_0175328 3300046524 Bacteria 1095
294 Ga0495663_0003532 3300046525 Bacteria 4501
295 Ga0495654_0020142 3300046530 Bacteria 3479
296 Ga0495665_0083648 3300046531 Bacteria 1678
297 Ga0495609_0004101 3300046538 Bacteria 8104
298 Ga0495597_0000065 3300046542 Bacteria 90745
299 Ga0495597_0075972 3300046542 Bacteria 1441
300 Ga0495622_0091789 3300046557 Bacteria 1395
301 Ga0495633_0040885 3300046558 Bacteria 2207
302 Ga0495661_0021165 3300046665 Bacteria 4242
303 Ga0495661_0070625 3300046665 Bacteria 2043
304 Ga0495670_0051545 3300046691 Bacteria 2060
305 Ga0495671_0003443 3300046692 Bacteria 9716
306 Ga0495671_0112300 3300046692 Bacteria 1331
307 Ga0495649_0022167 3300046694 Bacteria 3554
308 Ga0495589_0015514 3300046794 Bacteria 3919
309 Ga0495674_0000977 3300047319 Bacteria 27450
310 Ga0495672_0005503 3300047320 Bacteria 10034
311 Ga0495672_0101382 3300047320 Bacteria 1560
312 Ga0495683_0195698 3300047323 Bacteria 914
313 Ga0495687_041758 3300047443 Bacteria 2009
314 Ga0495673_0069340 3300047469 Bacteria 1487
315 Ga0495681_0010942 3300047470 Bacteria 5448
316 Ga0495626_0081388 3300048091 Bacteria 1438
317 Ga0496100_0000617 3300048903 Bacteria 16844
318 Ga0496101_0000987 3300048904 Bacteria 16825
319 Ga0496101_0033944 3300048904 Bacteria 3602
320 Ga0496102_0000165 3300048905 Bacteria 89141
321 Ga0496103_0000728 3300048906 Bacteria 24278
322 Ga0496104_0425026 3300048907 Bacteria 1240
323 Ga0496104_1377212 3300048907 Bacteria 608
324 Ga0496105_0933244 3300048908 Bacteria 652
325 Ga0496106_0043212 3300048909 Bacteria 3381
326 Ga0496107_1016545 3300048910 Bacteria 601
327 Ga0496112_0193458 3300048915 Bacteria 1995
328 Ga0496114_0200421 3300048917 Bacteria 1748
329 Ga0496116_0007050 3300048919 Bacteria 10064
330 Ga0496116_0042730 3300048919 Bacteria 3095
331 Ga0496116_0057197 3300048919 Bacteria 2551
332 Ga0496116_0074697 3300048919 Bacteria 2131
333 Ga0496117_0001246 3300048920 Bacteria 38001
334 Ga0496117_0287960 3300048920 Bacteria 876
335 Ga0496118_0000283 3300048921 Bacteria 89206
336 Ga0496118_0238760 3300048921 Bacteria 1042
337 Ga0496119_0000011 3300048922 Bacteria 438315
338 Ga0496119_0045652 3300048922 Bacteria 2744
339 Ga0496119_0194325 3300048922 Bacteria 1055
340 Ga0496120_0002123 3300048923 Bacteria 21185
341 Ga0496121_0001382 3300048924 Bacteria 41101
342 Ga0496121_0006825 3300048924 Bacteria 13967
343 Ga0496121_0010364 3300048924 Bacteria 10527
344 Ga0496121_0015295 3300048924 Bacteria 8057
345 Ga0496122_0002013 3300048925 Bacteria 30221
346 Ga0496122_0045811 3300048925 Bacteria 3394
347 Ga0496122_0123247 3300048925 Bacteria 1666
348 Ga0496123_0000493 3300048926 Bacteria 68308
349 Ga0496123_0052369 3300048926 Bacteria 2709
350 Ga0496125_0024579 3300048928 Bacteria 5537
351 Ga0496126_0156201 3300048929 Bacteria 1952
352 Ga0495682_0231346 3300049460 Bacteria 654
353 Ga0501031_0012439 3300049568 Bacteria 5552
354 Ga0501031_0172932 3300049568 Bacteria 1411
355 Ga0501031_0262202 3300049568 Bacteria 1123
356 Ga0501032_0022038 3300049569 Bacteria 4422
357 Ga0501032_0030996 3300049569 Bacteria 3668
358 Ga0501032_0044529 3300049569 Bacteria 3003
359 Ga0501032_0090851 3300049569 Bacteria 2026
360 Ga0501032_0124280 3300049569 Bacteria 1705
361 Ga0501032_0199542 3300049569 Bacteria 1306
362 Ga0501032_0278274 3300049569 Bacteria 1083
363 Ga0501032_0680491 3300049569 Bacteria 653
364 Ga0501033_0000446 3300049570 Bacteria 39481
365 Ga0501033_0019827 3300049570 Bacteria 5083
366 Ga0501033_0022737 3300049570 Bacteria 4727
367 Ga0501033_0029784 3300049570 Bacteria 4102
368 Ga0501033_0048131 3300049570 Bacteria 3167
369 Ga0501033_0053457 3300049570 Bacteria 2991
370 Ga0501033_0083288 3300049570 Bacteria 2345
371 Ga0501033_0126924 3300049570 Bacteria 1849
372 Ga0501033_0176588 3300049570 Bacteria 1532
373 Ga0501033_0236737 3300049570 Bacteria 1296
374 Ga0501034_0004324 3300049571 Bacteria 15844
375 Ga0501034_0185096 3300049571 Bacteria 2047
376 Ga0501034_0318546 3300049571 Bacteria 1488
377 Ga0501034_0375448 3300049571 Bacteria 1347
378 Ga0501034_0388659 3300049571 Bacteria 1319
379 Ga0501034_0399774 3300049571 Bacteria 1297
380 Ga0501034_0520976 3300049571 Bacteria 1101
381 Ga0501034_0538518 3300049571 Bacteria 1078
382 Ga0501034_0544357 3300049571 Bacteria 1071
383 Ga0501034_0662850 3300049571 Bacteria 944
384 Ga0501036_0005424 3300049572 Bacteria 10334
385 Ga0501036_0029074 3300049572 Bacteria 4672
386 Ga0501036_0095573 3300049572 Bacteria 2512
387 Ga0501036_0181086 3300049572 Bacteria 1774
388 Ga0501036_0216566 3300049572 Bacteria 1608
389 Ga0501036_0545303 3300049572 Bacteria 964
390 Ga0501036_0803996 3300049572 Bacteria 774
391 Ga0501037_0000179 3300049573 Bacteria 58767
392 Ga0501037_0001481 3300049573 Bacteria 17182
393 Ga0501037_0058510 3300049573 Bacteria 2812
394 Ga0501037_0107945 3300049573 Bacteria 2006
395 Ga0501037_0230112 3300049573 Bacteria 1302
396 Ga0501037_0242597 3300049573 Bacteria 1263
397 Ga0501037_0423386 3300049573 Bacteria 911
398 Ga0501037_0430329 3300049573 Bacteria 902
399 Ga0501038_0008730 3300049574 Bacteria 9300
400 Ga0501038_0016736 3300049574 Bacteria 6642
401 Ga0501038_0080825 3300049574 Bacteria 2739
402 Ga0501038_0174718 3300049574 Bacteria 1737
403 Ga0501038_0238033 3300049574 Bacteria 1446
404 Ga0501038_0306094 3300049574 Bacteria 1246
405 Ga0501039_0001884 3300049575 Bacteria 15509
406 Ga0501039_0105688 3300049575 Bacteria 2198
407 Ga0501039_0980498 3300049575 Bacteria 657
408 Ga0501042_0011846 3300049578 Bacteria 5889
409 Ga0501042_0168464 3300049578 Bacteria 1581
410 Ga0501043_0000005 3300049579 Bacteria 254466
411 Ga0501043_0005191 3300049579 Bacteria 10540
412 Ga0501043_0007432 3300049579 Bacteria 8698
413 Ga0501043_0036224 3300049579 Bacteria 3881
414 Ga0501043_0043005 3300049579 Bacteria 3551
415 Ga0501043_0122225 3300049579 Bacteria 2042
416 Ga0501043_0200972 3300049579 Bacteria 1547
417 Ga0501043_0275677 3300049579 Bacteria 1290
418 Ga0501043_0285858 3300049579 Bacteria 1263
419 Ga0501043_0539030 3300049579 Bacteria 868
420 Ga0501046_0000376 3300049580 Bacteria 45083
421 Ga0501046_0021898 3300049580 Bacteria 5269
422 Ga0501046_0071918 3300049580 Bacteria 2686
423 Ga0501046_0246319 3300049580 Bacteria 1317
424 Ga0501046_0354414 3300049580 Bacteria 1065
425 Ga0501046_0704145 3300049580 Bacteria 711
426 Ga0501046_0910026 3300049580 Bacteria 613
427 Ga0501047_0022956 3300049581 Bacteria 5989
428 Ga0501047_0055387 3300049581 Bacteria 3835
429 Ga0501047_0070774 3300049581 Bacteria 3358
430 Ga0501047_0074428 3300049581 Bacteria 3270
431 Ga0501047_0088937 3300049581 Bacteria 2966
432 Ga0501047_0121847 3300049581 Bacteria 2489
433 Ga0501047_0154601 3300049581 Bacteria 2168
434 Ga0501047_0170493 3300049581 Bacteria 2045
435 Ga0501047_0277327 3300049581 Bacteria 1522
436 Ga0501047_0809349 3300049581 Bacteria 752
437 Ga0501048_0168532 3300049582 Bacteria 1551
438 Ga0501048_0408100 3300049582 Bacteria 971
439 Ga0501068_0047823 3300049584 Bacteria 2581
440 Ga0501068_0608383 3300049584 Bacteria 712
441 Ga0501069_0000011 3300049585 Bacteria 153214
442 Ga0501069_0205867 3300049585 Bacteria 1141
443 Ga0501070_0001424 3300049586 Bacteria 21419
444 Ga0501070_0013988 3300049586 Bacteria 6756
445 Ga0501070_0032558 3300049586 Bacteria 4363
446 Ga0501070_0046609 3300049586 Bacteria 3604
447 Ga0501070_0047624 3300049586 Bacteria 3562
448 Ga0501070_0059996 3300049586 Bacteria 3153
449 Ga0501070_0134414 3300049586 Bacteria 2042
450 Ga0501070_0140286 3300049586 Bacteria 1995
451 Ga0501070_1064001 3300049586 Bacteria 625
452 Ga0501071_0059243 3300049587 Bacteria 2770
453 Ga0501073_0078435 3300049589 Bacteria 2298
454 Ga0501074_0000336 3300049590 Bacteria 27389
455 Ga0501080_0001369 3300049742 Bacteria 20402
456 Ga0501080_0904887 3300049742 Bacteria 769
457 Ga0501081_0114796 3300049743 Bacteria 1914
458 Ga0501083_0000805 3300049744 Bacteria 20562
459 Ga0501035_0000107 3300049822 Bacteria 103130
460 Ga0501035_0007869 3300049822 Bacteria 9961
461 Ga0501035_0013853 3300049822 Bacteria 7443
462 Ga0501035_0015836 3300049822 Bacteria 6958
463 Ga0501035_0039263 3300049822 Bacteria 4284
464 Ga0501035_0060690 3300049822 Bacteria 3366
465 Ga0501035_0062852 3300049822 Bacteria 3303
466 Ga0501035_0063985 3300049822 Bacteria 3270
467 Ga0501035_0107961 3300049822 Bacteria 2440
468 Ga0501035_0115867 3300049822 Bacteria 2345
469 Ga0501035_0206022 3300049822 Bacteria 1685
470 Ga0501035_0268985 3300049822 Bacteria 1443
471 Ga0501035_1005676 3300049822 Bacteria 655
472 Ga0501044_0000077 3300049823 Bacteria 119196
473 Ga0501044_0000154 3300049823 Bacteria 85407
474 Ga0501044_0005777 3300049823 Bacteria 13696
475 Ga0501044_0009552 3300049823 Bacteria 10560
476 Ga0501044_0026244 3300049823 Bacteria 6168
477 Ga0501044_0055808 3300049823 Bacteria 4056
478 Ga0501044_0064444 3300049823 Bacteria 3741
479 Ga0501044_0101420 3300049823 Bacteria 2895
480 Ga0501044_0133295 3300049823 Bacteria 2477
481 Ga0501044_0157858 3300049823 Bacteria 2247
482 Ga0501044_0366195 3300049823 Bacteria 1359
483 Ga0501044_0366330 3300049823 Bacteria 1358
484 Ga0501044_0541164 3300049823 Bacteria 1062
485 Ga0501044_0564691 3300049823 Bacteria 1034
486 Ga0501044_0588697 3300049823 Bacteria 1006
487 Ga0501044_0756750 3300049823 Bacteria 853
488 Ga0501044_0835310 3300049823 Bacteria 799
489 Ga0501044_1364424 3300049823 Bacteria 575
490 nmdc:mga09592_9834_c1 3300050508 Bacteria 7775
491 nmdc:mga06r32_233866_c1 3300050510 Bacteria 1826
492 Ga0501082_0015310 3300060353 Bacteria 6603
493 Ga0501082_0215324 3300060353 Bacteria 1671
494 Ga0501082_0380269 3300060353 Bacteria 1232
495 Ga0466962_0011043 3300061719 Bacteria 4348
496 2585264773 2582581306 Bacteria 6450535
497 2585386158 2582581865 Bacteria 6644329
498 2617381089 2617270742 Bacteria 6808054
499 2643772219 2643221550 Bacteria 4619371
500 2644734034 2643221734 Bacteria 5365412
501 2644747361 2643221736 Bacteria 6608466
502 2728749167 2728368998 Bacteria 8720350
503 2842484266 2842482326 Bacteria 7212537
504 2917701851 2917699015 Bacteria 7043791
505 2928059548 2928058823 Bacteria 5520022
506 2939631236 2939631187 Bacteria 6118131
507 2941493695 2941489479 Bacteria 6313767
508 2995952358 2995948881 Bacteria 6358104
509 2996338875 2996336353 Bacteria 5511628
510 643827892 643692032 Bacteria 6891900
511 8003016238 8003014200 Bacteria 4059994
512 8057101968 8057101203 Bacteria 5034064
513 Ga0466967_0006325
514 JGI24740J21852_10000165
515 JGI25162J39368_1000111
516 JGI25154J39366_1000536
517 JGI25159J45721_1006237
518 JGI25151J46595_10000846
519 JGI25151J46595_10001459
520 JGI25151J46595_10015852
521 JGI25151J46595_10021024
522 JGI25165J46597_1001440
523 JGI25165J46597_1035630
524 JGI25153J46596_10056366
525 rootL2_10174794
526 rootH1_10242536
527 Ga0055538_1002615
528 Ga0055539_1000201
529 Ga0055533_1000937
530 Ga0055532_1000073
531 Ga0055525_1000366
532 Ga0055525_1005504
533 Ga0055535_1000055
534 Ga0055542_1000721
535 Ga0055529_1000149
536 Ga0055526_1003295
537 Ga0055526_1004820
538 Ga0055526_1022147
539 Ga0055526_1024545
540 Ga0055526_1027604
541 Ga0055537_1000057
542 Ga0055524_1000066
543 Ga0055524_1015029
544 Ga0055524_1018659
545 Ga0055524_1022085
546 Ga0055536_1000339
547 Ga0055536_1007488
548 Ga0055536_1010363
549 Ga0055536_1084748
550 Ga0055534_1000175
551 Ga0055534_1000247
552 Ga0055534_1002727
553 Ga0055528_1000023
554 Ga0055530_10004258
555 Ga0055531_10009885
556 Ga0055531_10023298
557 Ga0055531_10023925
558 Ga0055531_10041843
559 Ga0055541_1000336
560 Ga0055541_1008961
561 Ga0055543_1072670
562 Ga0065165_1000119
563 Ga0065165_1000545
564 Ga0065165_1097193
565 Ga0070680_100268598
566 Ga0070680_100349743
567 Ga0070682_100014762
568 Ga0070661_100000061
569 Ga0070659_100002481
570 Ga0070659_100170551
571 Ga0070714_100553614
572 Ga0070663_100000009
573 Ga0070663_100013889
574 Ga0070663_100068421
575 Ga0070663_100144834
576 Ga0070663_100279202
577 Ga0070681_10067174
578 Ga0070681_10321866
579 Ga0070679_100035873
580 Ga0070684_100017185
581 Ga0068853_100013529
582 Ga0068855_100752393
583 Ga0070664_100000010
584 Ga0068857_101052441
585 Ga0068854_100028644
586 Ga0068856_100000045
587 Ga0068852_100231301
588 Ga0075428_100003085
589 Ga0075430_100281184
590 Ga0075431_100026710
591 Ga0075429_100008248
592 Ga0105251_10032244
593 Ga0105251_10159556
594 Ga0105240_10000739
595 Ga0105240_10120343
596 Ga0105240_10139498
597 Ga0105240_10336432
598 Ga0114129_10018969
599 Ga0105241_10221252
600 Ga0105237_10002121
601 Ga0105238_10004352
602 Ga0105238_10061034
603 Ga0105239_10000454
604 Ga0157327_1006626
605 Ga0157373_10004941
606 Ga0157373_10018501
607 Ga0157371_10000088
608 Ga0157371_10017730
609 Ga0157371_10705839
610 Ga0157370_10000041
611 Ga0157370_10008961
612 Ga0157370_10495702
613 Ga0157370_10660278
614 Ga0157369_10265362
615 Ga0157369_10435994
616 Ga0171462_1015
617 Ga0157372_10000097
618 Ga0157372_10171824
619 Ga0182008_10022898
620 Ga0182006_1003196
621 Ga0182006_1016828
622 Ga0182007_10002998
623 Ga0183360_10001
624 Ga0197907_10007993
625 Ga0209760_100795
626 Ga0209784_100008
627 Ga0209784_100262
628 Ga0209566_100006
629 Ga0209566_100407
630 Ga0209566_100636
631 Ga0209674_100045
632 Ga0209674_100114
633 Ga0209147_100005
634 Ga0209563_100016
635 Ga0209563_111699
636 Ga0209437_100064
637 Ga0209258_100007
638 Ga0209646_1000027
639 Ga0209026_1003785
640 Ga0209677_100008
641 Ga0209677_105391
642 Ga0209148_1000019
643 Ga0209759_1004768
644 Ga0209759_1045859
645 Ga0209233_1000081
646 Ga0209233_1004045
647 Ga0209565_1000005
648 Ga0209565_1000094
649 Ga0209455_1000011
650 Ga0209673_1000027
651 Ga0209673_1007856
652 Ga0209673_1007992
653 Ga0209130_1000244
654 Ga0209130_1000702
655 Ga0209130_1015852
656 Ga0209675_1000004
657 Ga0209675_1000079
658 Ga0209675_1002258
659 Ga0209675_1010617
660 Ga0209675_1021220
661 Ga0209676_1000176
662 Ga0209676_1001097
663 Ga0209676_1005557
664 Ga0209676_1006363
665 Ga0209676_1030419
666 Ga0209676_1039738
667 Ga0209676_1040147
668 Ga0209025_1000046
669 Ga0209025_1000224
670 Ga0209025_1002162
671 Ga0209025_1007268
672 Ga0209025_1015187
673 Ga0209025_1077870
674 Ga0209564_1000050
675 Ga0209564_1000166
676 Ga0209564_1000308
677 Ga0209564_1000509
678 Ga0209564_1005648
679 Ga0209564_1047058
680 Ga0209758_1002177
681 Ga0209050_1001060
682 Ga0209050_1006506
683 Ga0209050_1046019
684 Ga0209256_1000031
685 Ga0209256_1000960
686 Ga0209256_1001956
687 Ga0209256_1008858
688 Ga0209256_1008871
689 Ga0207426_1000151
690 Ga0207426_1000215
691 Ga0207426_1035838
692 Ga0207426_1079226
693 Ga0209051_1070857
694 Ga0209257_1000255
695 Ga0209257_1000283
696 Ga0209257_1006338
697 Ga0209257_1007543
698 Ga0209257_1035848
699 Ga0207696_1007558
700 Ga0207655_1014101
701 Ga0207713_1020832
702 Ga0207705_10977475
703 Ga0207654_11179577
704 Ga0207707_10094144
705 Ga0207695_10000788
706 Ga0207695_10006520
707 Ga0207695_10296570
708 Ga0207695_10565390
709 Ga0207671_10000411
710 Ga0207671_10137651
711 Ga0207649_10000605
712 Ga0207652_10049707
713 Ga0207652_10974597
714 Ga0207694_10118163
715 Ga0207664_10154990
716 Ga0207690_10063206
717 Ga0207690_10137932
718 Ga0207661_10000109
719 Ga0207679_10000002
720 Ga0207640_10009624
721 Ga0207639_10002690
722 Ga0207678_10000018
723 Ga0207678_10045408
724 Ga0207678_10078794
725 Ga0207702_10000053
726 Ga0207674_10001653
727 Ga0207698_11607399
728 Ga0209371_1000006
729 Ga0209282_1000019
730 Ga0268265_10176603
731 Ga0307515_10000029
732 Ga0307515_10009918
733 Ga0268256_1000007
734 Ga0307513_10010270
735 Ga0307406_10297576
736 Ga0307406_10619919
737 Ga0395899_0002516
738 Ga0395899_0008931
739 Ga0395899_0139154
740 Ga0395899_0176000
741 Ga0395899_0212784
742 Ga0395899_0326895
743 Ga0395899_0334003
744 Ga0395900_0000006
745 Ga0395900_0005617
746 Ga0395900_0054526
747 Ga0395900_0118521
748 Ga0395900_0171384
749 Ga0395900_0542173
750 Ga0395898_0012851
751 Ga0395898_0098108
752 Ga0395898_0114289
753 Ga0395898_0141682
754 Ga0395898_0206248
755 Ga0395898_0432874
756 Ga0395898_0763789
757 Ga0395905_0034107
758 Ga0395905_0147200
759 Ga0395901_0000001
760 Ga0395901_0035004
761 Ga0395901_0037019
762 Ga0395901_0290340
763 Ga0395901_0397832
764 Ga0395901_0843535
765 Ga0395901_1811127
766 Ga0439439_0121575
767 Ga0439465_0005898
768 Ga0439432_017466
769 Ga0439449_0013888
770 Ga0439452_017109
771 Ga0450904_000366
772 Ga0466969_0008077
773 Ga0466972_0001290
774 Ga0466978_0006655
775 Ga0466982_0094720
776 Ga0466965_0002975
777 Ga0466961_0000200
778 Ga0466963_0021800
779 Ga0466964_0178833
780 Ga0466971_0038113
781 Ga0466968_0016833
782 Ga0466970_0001061
783 Ga0466960_0085652
784 Ga0466959_0000415
785 Ga0466958_0335632
786 Ga0495627_013868
787 Ga0495591_081478
788 Ga0495580_0315167
789 Ga0495580_0735408
790 Ga0495605_0003211
791 Ga0495605_0032403
792 Ga0495584_0159253
793 Ga0495584_0179618
794 Ga0495596_0000086
795 Ga0495607_0017794
796 Ga0495607_0104383
797 Ga0495583_0005337
798 Ga0495610_0000221
799 Ga0495610_0011438
800 Ga0495616_0007103
801 Ga0495616_0046048
802 Ga0495632_0012840
803 Ga0495643_0008500
804 Ga0495648_0101533
805 Ga0495648_0175328
806 Ga0495663_0003532
807 Ga0495654_0020142
808 Ga0495665_0083648
809 Ga0495609_0004101
810 Ga0495597_0000065
811 Ga0495597_0075972
812 Ga0495622_0091789
813 Ga0495633_0040885
814 Ga0495661_0021165
815 Ga0495661_0070625
816 Ga0495670_0051545
817 Ga0495671_0003443
818 Ga0495671_0112300
819 Ga0495649_0022167
820 Ga0495589_0015514
821 Ga0495674_0000977
822 Ga0495672_0005503
823 Ga0495672_0101382
824 Ga0495683_0195698
825 Ga0495687_041758
826 Ga0495673_0069340
827 Ga0495681_0010942
828 Ga0495626_0081388
829 Ga0496100_0000617
830 Ga0496101_0000987
831 Ga0496101_0033944
832 Ga0496102_0000165
833 Ga0496103_0000728
834 Ga0496104_0425026
835 Ga0496104_1377212
836 Ga0496105_0933244
837 Ga0496106_0043212
838 Ga0496107_1016545
839 Ga0496112_0193458
840 Ga0496114_0200421
841 Ga0496116_0007050
842 Ga0496116_0042730
843 Ga0496116_0057197
844 Ga0496116_0074697
845 Ga0496117_0001246
846 Ga0496117_0287960
847 Ga0496118_0000283
848 Ga0496118_0238760
849 Ga0496119_0000011
850 Ga0496119_0045652
851 Ga0496119_0194325
852 Ga0496120_0002123
853 Ga0496121_0001382
854 Ga0496121_0006825
855 Ga0496121_0010364
856 Ga0496121_0015295
857 Ga0496122_0002013
858 Ga0496122_0045811
859 Ga0496122_0123247
860 Ga0496123_0000493
861 Ga0496123_0052369
862 Ga0496125_0024579
863 Ga0496126_0156201
864 Ga0495682_0231346
865 Ga0501031_0012439
866 Ga0501031_0172932
867 Ga0501031_0262202
868 Ga0501032_0022038
869 Ga0501032_0030996
870 Ga0501032_0044529
871 Ga0501032_0090851
872 Ga0501032_0124280
873 Ga0501032_0199542
874 Ga0501032_0278274
875 Ga0501032_0680491
876 Ga0501033_0000446
877 Ga0501033_0019827
878 Ga0501033_0022737
879 Ga0501033_0029784
880 Ga0501033_0048131
881 Ga0501033_0053457
882 Ga0501033_0083288
883 Ga0501033_0126924
884 Ga0501033_0176588
885 Ga0501033_0236737
886 Ga0501034_0004324
887 Ga0501034_0185096
888 Ga0501034_0318546
889 Ga0501034_0375448
890 Ga0501034_0388659
891 Ga0501034_0399774
892 Ga0501034_0520976
893 Ga0501034_0538518
894 Ga0501034_0544357
895 Ga0501034_0662850
896 Ga0501036_0005424
897 Ga0501036_0029074
898 Ga0501036_0095573
899 Ga0501036_0181086
900 Ga0501036_0216566
901 Ga0501036_0545303
902 Ga0501036_0803996
903 Ga0501037_0000179
904 Ga0501037_0001481
905 Ga0501037_0058510
906 Ga0501037_0107945
907 Ga0501037_0230112
908 Ga0501037_0242597
909 Ga0501037_0423386
910 Ga0501037_0430329
911 Ga0501038_0008730
912 Ga0501038_0016736
913 Ga0501038_0080825
914 Ga0501038_0174718
915 Ga0501038_0238033
916 Ga0501038_0306094
917 Ga0501039_0001884
918 Ga0501039_0105688
919 Ga0501039_0980498
920 Ga0501042_0011846
921 Ga0501042_0168464
922 Ga0501043_0000005
923 Ga0501043_0005191
924 Ga0501043_0007432
925 Ga0501043_0036224
926 Ga0501043_0043005
927 Ga0501043_0122225
928 Ga0501043_0200972
929 Ga0501043_0275677
930 Ga0501043_0285858
931 Ga0501043_0539030
932 Ga0501046_0000376
933 Ga0501046_0021898
934 Ga0501046_0071918
935 Ga0501046_0246319
936 Ga0501046_0354414
937 Ga0501046_0704145
938 Ga0501046_0910026
939 Ga0501047_0022956
940 Ga0501047_0055387
941 Ga0501047_0070774
942 Ga0501047_0074428
943 Ga0501047_0088937
944 Ga0501047_0121847
945 Ga0501047_0154601
946 Ga0501047_0170493
947 Ga0501047_0277327
948 Ga0501047_0809349
949 Ga0501048_0168532
950 Ga0501048_0408100
951 Ga0501068_0047823
952 Ga0501068_0608383
953 Ga0501069_0000011
954 Ga0501069_0205867
955 Ga0501070_0001424
956 Ga0501070_0013988
957 Ga0501070_0032558
958 Ga0501070_0046609
959 Ga0501070_0047624
960 Ga0501070_0059996
961 Ga0501070_0134414
962 Ga0501070_0140286
963 Ga0501070_1064001
964 Ga0501071_0059243
965 Ga0501073_0078435
966 Ga0501074_0000336
967 Ga0501080_0001369
968 Ga0501080_0904887
969 Ga0501081_0114796
970 Ga0501083_0000805
971 Ga0501035_0000107
972 Ga0501035_0007869
973 Ga0501035_0013853
974 Ga0501035_0015836
975 Ga0501035_0039263
976 Ga0501035_0060690
977 Ga0501035_0062852
978 Ga0501035_0063985
979 Ga0501035_0107961
980 Ga0501035_0115867
981 Ga0501035_0206022
982 Ga0501035_0268985
983 Ga0501035_1005676
984 Ga0501044_0000077
985 Ga0501044_0000154
986 Ga0501044_0005777
987 Ga0501044_0009552
988 Ga0501044_0026244
989 Ga0501044_0055808
990 Ga0501044_0064444
991 Ga0501044_0101420
992 Ga0501044_0133295
993 Ga0501044_0157858
994 Ga0501044_0366195
995 Ga0501044_0366330
996 Ga0501044_0541164
997 Ga0501044_0564691
998 Ga0501044_0588697
999 Ga0501044_0756750
1000 Ga0501044_0835310
1001 Ga0501044_1364424
1002 nmdc:mga09592_9834_c1
1003 nmdc:mga06r32_233866_c1
1004 Ga0501082_0015310
1005 Ga0501082_0215324
1006 Ga0501082_0380269
1007 Ga0466962_0011043
1008 2585264773
1009 2585386158
1010 2617381089
1011 2643772219
1012 2644734034
1013 2644747361
1014 2728749167
1015 2842484266
1016 2917701851
1017 2928059548
1018 2939631236
1019 2941493695
1020 2995952358
1021 2996338875
1022 643827892
1023 8003016238
1024 8057101968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

11

113

0.95

PF14437

MafB19-deam

MafB19-like deaminase

16

146

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vpc-assembly1.cif.gz_F structure of the spcas9 dna adenine base editor - abe8e 0.9764 2 103
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9761 2 102
3v0f-assembly2.cif.gz_B crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), form ii 0.9732 25 39
1wwr-assembly1.cif.gz_A crystal structure of trna adenosine deaminase tada from aquifex aeolicus 0.9721 1 102
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9708 1 102
ID Description Score Start End Superfamily
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9771 5 102 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9729 1 102 3.40.140.10
af_K7K815_1119_1301_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9706 3 104 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9703 1 102 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9636 5 102 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A3B0LWC0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9943 1 113 GO:0002100
GO:0006152
GO:0008892
GO:0047974
GO:0052717
AF-A0A533YHZ7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9867 5 102 GO:0002100
GO:0008270
GO:0052717
AF-A0A1K1XT98-F1-model_v4 deleted 0.9862 5 102
AF-A0A3B0LWC0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9857 1 113 GO:0002100
GO:0006152
GO:0008892
GO:0047974
GO:0052717
AF-A0A2V2EFH9-F1-model_v4 deleted 0.9855 3 102

Map