F457486

General Info

Members Datasets Scaffolds Average Seq Length
512 256 1024 213

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0008411|Ga0501042_0008411_1661_2404
Length 247
Sequence MIKWFKLELQPALENEWLPVHIGRQVGTRIFIKRRLNMTIRLGDAAPDFTAETTEGPIRFHEWAGNSWVVLFSHPKDFTPVCTTELGYMARIKSEFDKRNVKILAISVDDTESHTRWSKDIEETQGSAPNYPIIADPDRKVADLYDMIHPNADDTLTVRSVFVIGPDRKVKLMITYPASTGRNFDEILRVIDSLQLTAHHSVATPVNWKEGEDVIIVPSVSDEDAKKQFPEGWKTLKPYMRMVAQPH

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
256 2739367656 Pedobacter sp. CF523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 1.95
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 1.37
Rhizosphere 95.51
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0008411 3300049578 Bacteria 6810
2 JGI24033J26618_1021565 3300002155 Bacteria 828
3 JGI25157J39369_1002507 3300002741 Bacteria 4461
4 rootH1_10325573 3300003323 Unclassified 3763
5 Ga0058861_11775439 3300004800 Bacteria 843
6 Ga0058862_12531173 3300004803 Bacteria 843
7 Ga0065714_10093817 3300005288 Unclassified 1830
8 Ga0065712_10034302 3300005290 Bacteria 915
9 Ga0065712_10163860 3300005290 Bacteria 1285
10 Ga0065715_10193385 3300005293 Bacteria 1402
11 Ga0065715_10433451 3300005293 Bacteria 844
12 Ga0065707_10309768 3300005295 Bacteria 987
13 Ga0065707_10320574 3300005295 Bacteria 967
14 Ga0070676_10000511 3300005328 Bacteria 18619
15 Ga0070676_10020103 3300005328 Bacteria 3722
16 Ga0070676_10048020 3300005328 Bacteria 2495
17 Ga0070676_10267069 3300005328 Bacteria 1148
18 Ga0070683_100078947 3300005329 Bacteria 3080
19 Ga0070670_100000405 3300005331 Bacteria 35470
20 Ga0070670_100031469 3300005331 Bacteria 4569
21 Ga0068869_100000503 3300005334 Bacteria 21804
22 Ga0068869_100141891 3300005334 Bacteria 1855
23 Ga0070680_100000913 3300005336 Bacteria 20907
24 Ga0070680_100002762 3300005336 Bacteria 13033
25 Ga0070680_100110015 3300005336 Bacteria 2293
26 Ga0070682_100000182 3300005337 Bacteria 47152
27 Ga0070682_100000307 3300005337 Bacteria 33950
28 Ga0068868_100052262 3300005338 Bacteria 3217
29 Ga0068868_100146648 3300005338 Bacteria 1941
30 Ga0070660_100001850 3300005339 Bacteria 14554
31 Ga0070689_100039704 3300005340 Bacteria 3605
32 Ga0070661_100000431 3300005344 Bacteria 32034
33 Ga0070661_100003122 3300005344 Bacteria 11401
34 Ga0070692_10000066 3300005345 Bacteria 20940
35 Ga0070692_10000720 3300005345 Bacteria 10718
36 Ga0070692_10173045 3300005345 Bacteria 1246
37 Ga0070668_100147346 3300005347 Bacteria 1901
38 Ga0070669_100228807 3300005353 Bacteria 1473
39 Ga0070669_100322338 3300005353 Bacteria 1248
40 Ga0070669_100374676 3300005353 Bacteria 1160
41 Ga0070675_100258346 3300005354 Bacteria 1526
42 Ga0070674_100222846 3300005356 Bacteria 1468
43 Ga0070673_100001540 3300005364 Bacteria 13573
44 Ga0070673_100306314 3300005364 Bacteria 1400
45 Ga0070688_100207164 3300005365 Unclassified 1375
46 Ga0070659_100000500 3300005366 Bacteria 28860
47 Ga0070659_100004742 3300005366 Bacteria 9717
48 Ga0070703_10048801 3300005406 Bacteria 1346
49 Ga0070703_10104379 3300005406 Bacteria 1004
50 Ga0070714_100382644 3300005435 Bacteria 1327
51 Ga0070713_100180646 3300005436 Bacteria 1896
52 Ga0070701_10043678 3300005438 Bacteria 2294
53 Ga0070701_10045172 3300005438 Bacteria 2259
54 Ga0070711_100381537 3300005439 Bacteria 1140
55 Ga0070705_100000180 3300005440 Bacteria 36882
56 Ga0070705_100000328 3300005440 Bacteria 28122
57 Ga0070705_100009572 3300005440 Bacteria 4823
58 Ga0070700_100024958 3300005441 Bacteria 3516
59 Ga0070700_100240675 3300005441 Bacteria 1293
60 Ga0070694_100000116 3300005444 Bacteria 38891
61 Ga0070694_100046489 3300005444 Bacteria 2914
62 Ga0070694_100430838 3300005444 Bacteria 1038
63 Ga0070694_100698682 3300005444 Bacteria 824
64 Ga0070708_100010711 3300005445 Bacteria 7443
65 Ga0070708_100367709 3300005445 Bacteria 1355
66 Ga0070708_100571164 3300005445 Bacteria 1066
67 Ga0070708_100944762 3300005445 Bacteria 809
68 Ga0070663_100002682 3300005455 Bacteria 10076
69 Ga0070663_100010542 3300005455 Bacteria 5762
70 Ga0070678_100057693 3300005456 Bacteria 2846
71 Ga0070662_100004416 3300005457 Bacteria 8889
72 Ga0070662_100018940 3300005457 Bacteria 4664
73 Ga0070681_10004002 3300005458 Bacteria 13902
74 Ga0070681_10004717 3300005458 Bacteria 13050
75 Ga0070681_10021872 3300005458 Bacteria 6414
76 Ga0068867_100001933 3300005459 Bacteria 14438
77 Ga0068867_100009003 3300005459 Bacteria 7042
78 Ga0068867_100026941 3300005459 Bacteria 4130
79 Ga0070706_100009747 3300005467 Bacteria 8926
80 Ga0070706_100020440 3300005467 Bacteria 6102
81 Ga0070706_100160489 3300005467 Bacteria 2099
82 Ga0070707_100029038 3300005468 Bacteria 5264
83 Ga0070707_100064558 3300005468 Bacteria 3515
84 Ga0070707_100176799 3300005468 Bacteria 2080
85 Ga0070707_100195568 3300005468 Bacteria 1972
86 Ga0070707_100201642 3300005468 Bacteria 1939
87 Ga0070707_100658400 3300005468 Bacteria 1010
88 Ga0070698_100017154 3300005471 Bacteria 7634
89 Ga0070698_100210585 3300005471 Bacteria 1879
90 Ga0070698_100370865 3300005471 Bacteria 1363
91 Ga0070699_100013996 3300005518 Bacteria 6901
92 Ga0070699_100042150 3300005518 Bacteria 3949
93 Ga0070699_100348390 3300005518 Bacteria 1334
94 Ga0070699_100394978 3300005518 Bacteria 1250
95 Ga0070679_100000782 3300005530 Bacteria 27650
96 Ga0070679_100002937 3300005530 Bacteria 15522
97 Ga0070679_100107626 3300005530 Bacteria 2774
98 Ga0070679_100165186 3300005530 Bacteria 2187
99 Ga0070679_100435564 3300005530 Bacteria 1256
100 Ga0070684_100103823 3300005535 Bacteria 2543
101 Ga0070684_100125873 3300005535 Bacteria 2308
102 Ga0070697_100103611 3300005536 Bacteria 2365
103 Ga0070697_100393638 3300005536 Bacteria 1201
104 Ga0068853_100000088 3300005539 Bacteria 63120
105 Ga0068853_100127416 3300005539 Bacteria 2276
106 Ga0070672_100069797 3300005543 Bacteria 2791
107 Ga0070672_100104828 3300005543 Bacteria 2298
108 Ga0070695_100000261 3300005545 Bacteria 26461
109 Ga0070695_100000517 3300005545 Bacteria 20311
110 Ga0070695_100014943 3300005545 Bacteria 4684
111 Ga0070695_100102962 3300005545 Bacteria 1925
112 Ga0070696_100000841 3300005546 Bacteria 19805
113 Ga0070696_100010063 3300005546 Bacteria 6328
114 Ga0070696_100175776 3300005546 Bacteria 1586
115 Ga0070696_100362957 3300005546 Bacteria 1124
116 Ga0070693_100000207 3300005547 Bacteria 27302
117 Ga0070693_100001339 3300005547 Bacteria 11087
118 Ga0070704_100000649 3300005549 Bacteria 16779
119 Ga0070704_100097494 3300005549 Bacteria 2206
120 Ga0070704_100117387 3300005549 Bacteria 2036
121 Ga0070704_100302003 3300005549 Bacteria 1334
122 Ga0068855_100000493 3300005563 Bacteria 48771
123 Ga0068855_100001473 3300005563 Bacteria 29428
124 Ga0068855_100037779 3300005563 Bacteria 5740
125 Ga0068855_100039601 3300005563 Bacteria 5595
126 Ga0070664_100000847 3300005564 Bacteria 23598
127 Ga0070664_100022688 3300005564 Bacteria 5176
128 Ga0068857_100066870 3300005577 Bacteria 3198
129 Ga0068854_100002825 3300005578 Bacteria 10793
130 Ga0068854_100020466 3300005578 Bacteria 4477
131 Ga0068854_100183911 3300005578 Bacteria 1634
132 Ga0068854_100321677 3300005578 Bacteria 1257
133 Ga0068854_100892744 3300005578 Bacteria 781
134 Ga0068856_100000022 3300005614 Bacteria 142768
135 Ga0068856_100000198 3300005614 Bacteria 63839
136 Ga0068856_100000796 3300005614 Bacteria 33989
137 Ga0068856_100135488 3300005614 Bacteria 2468
138 Ga0070702_100018485 3300005615 Bacteria 3617
139 Ga0070702_100020066 3300005615 Bacteria 3496
140 Ga0068852_100546751 3300005616 Bacteria 1158
141 Ga0068859_100000533 3300005617 Bacteria 37712
142 Ga0068859_100003796 3300005617 Bacteria 15413
143 Ga0068859_100040821 3300005617 Bacteria 4660
144 Ga0068859_100822817 3300005617 Bacteria 1015
145 Ga0068864_100016508 3300005618 Bacteria 6145
146 Ga0068864_100137726 3300005618 Bacteria 2199
147 Ga0068864_101168154 3300005618 Bacteria 768
148 Ga0068861_100000784 3300005719 Bacteria 19103
149 Ga0068870_10000788 3300005840 Bacteria 12250
150 Ga0068870_10011795 3300005840 Bacteria 4064
151 Ga0068863_100228648 3300005841 Bacteria 1794
152 Ga0068858_100012891 3300005842 Bacteria 7883
153 Ga0068858_100555568 3300005842 Bacteria 1111
154 Ga0068860_100003786 3300005843 Bacteria 15557
155 Ga0068860_100035695 3300005843 Bacteria 4767
156 Ga0068860_100392359 3300005843 Bacteria 1372
157 Ga0068860_100652143 3300005843 Bacteria 1060
158 Ga0068862_100000415 3300005844 Bacteria 46252
159 Ga0068862_100002114 3300005844 Bacteria 17909
160 Ga0068862_100117899 3300005844 Bacteria 2337
161 Ga0068862_100130777 3300005844 Bacteria 2220
162 Ga0068862_100214142 3300005844 Bacteria 1741
163 Ga0068862_100256353 3300005844 Bacteria 1595
164 Ga0068862_100740781 3300005844 Bacteria 955
165 Ga0081455_10005726 3300005937 Bacteria 13545
166 Ga0081455_10054540 3300005937 Bacteria 3406
167 Ga0081539_10013430 3300005985 Bacteria 6170
168 Ga0075363_100073006 3300006048 Bacteria 1866
169 Ga0075364_10101877 3300006051 Bacteria 1912
170 Ga0068871_100215160 3300006358 Bacteria 1663
171 Ga0075428_100000176 3300006844 Bacteria 59684
172 Ga0075428_100009637 3300006844 Bacteria 10723
173 Ga0075428_100698427 3300006844 Bacteria 1081
174 Ga0075430_100013184 3300006846 Bacteria 7042
175 Ga0075430_100082953 3300006846 Bacteria 2686
176 Ga0075431_100000420 3300006847 Bacteria 34568
177 Ga0075431_100001064 3300006847 Bacteria 24562
178 Ga0075431_100009818 3300006847 Bacteria 9609
179 Ga0075431_100061269 3300006847 Bacteria 3882
180 Ga0075431_101056375 3300006847 Bacteria 778
181 Ga0075433_10028310 3300006852 Bacteria 4763
182 Ga0075433_10145881 3300006852 Bacteria 2104
183 Ga0075433_10533508 3300006852 Bacteria 1032
184 Ga0075434_100173892 3300006871 Bacteria 2173
185 Ga0075434_100175504 3300006871 Bacteria 2163
186 Ga0075429_100001389 3300006880 Bacteria 19781
187 Ga0075429_100008063 3300006880 Bacteria 9157
188 Ga0075436_100104052 3300006914 Bacteria 1978
189 Ga0075436_100180976 3300006914 Bacteria 1490
190 Ga0075436_100222498 3300006914 Bacteria 1340
191 Ga0097620_100000533 3300006931 Bacteria 37712
192 Ga0097620_100003796 3300006931 Bacteria 15413
193 Ga0097620_100040823 3300006931 Bacteria 4660
194 Ga0097620_100822855 3300006931 Bacteria 1015
195 Ga0075435_100027653 3300007076 Bacteria 4439
196 Ga0075435_100032802 3300007076 Bacteria 4103
197 Ga0075435_100180800 3300007076 Bacteria 1782
198 Ga0105240_10001403 3300009093 Bacteria 41363
199 Ga0105240_10015452 3300009093 Bacteria 10380
200 Ga0105240_10500255 3300009093 Bacteria 1351
201 Ga0114129_10008633 3300009147 Bacteria 14530
202 Ga0114129_10016092 3300009147 Bacteria 10639
203 Ga0114129_10034094 3300009147 Bacteria 7191
204 Ga0114129_10134768 3300009147 Bacteria 3389
205 Ga0114129_10430314 3300009147 Bacteria 1734
206 Ga0105243_10100151 3300009148 Bacteria 2404
207 Ga0105243_10708989 3300009148 Bacteria 982
208 Ga0105243_11100762 3300009148 Bacteria 803
209 Ga0105241_10000067 3300009174 Bacteria 79719
210 Ga0105241_10005575 3300009174 Bacteria 9295
211 Ga0105241_11090676 3300009174 Bacteria 751
212 Ga0105248_10000015 3300009177 Bacteria 322959
213 Ga0105248_10461202 3300009177 Bacteria 1432
214 Ga0105248_10621090 3300009177 Bacteria 1219
215 Ga0105237_10000667 3300009545 Bacteria 47464
216 Ga0105237_10046289 3300009545 Bacteria 4376
217 Ga0105237_10254196 3300009545 Bacteria 1759
218 Ga0105237_10589871 3300009545 Bacteria 1118
219 Ga0105238_10090542 3300009551 Bacteria 3046
220 Ga0105249_10659154 3300009553 Bacteria 1105
221 Ga0105239_10652238 3300010375 Bacteria 1202
222 Ga0157373_10000176 3300013100 Bacteria 52378
223 Ga0157373_10000398 3300013100 Bacteria 34875
224 Ga0157371_10369494 3300013102 Bacteria 1046
225 Ga0157370_10380703 3300013104 Bacteria 1300
226 Ga0157370_10547200 3300013104 Bacteria 1061
227 Ga0157369_10013569 3300013105 Bacteria 9211
228 Ga0157369_10015237 3300013105 Bacteria 8674
229 Ga0157369_10057932 3300013105 Bacteria 4179
230 Ga0157369_10143891 3300013105 Bacteria 2521
231 Ga0157374_10209089 3300013296 Bacteria 1913
232 Ga0157378_11156008 3300013297 Bacteria 812
233 Ga0163162_10723999 3300013306 Bacteria 1115
234 Ga0157372_10000370 3300013307 Bacteria 49961
235 Ga0157372_10000377 3300013307 Bacteria 49407
236 Ga0157372_10021219 3300013307 Bacteria 7017
237 Ga0157372_10056734 3300013307 Bacteria 4376
238 Ga0157372_10463373 3300013307 Bacteria 1477
239 Ga0157375_10014313 3300013308 Bacteria 7073
240 Ga0157375_10723197 3300013308 Bacteria 1148
241 Ga0163163_10460972 3300014325 Bacteria 1331
242 Ga0157380_10458543 3300014326 Bacteria 1226
243 Ga0157380_10534205 3300014326 Bacteria 1147
244 Ga0157379_10326543 3300014968 Bacteria 1401
245 Ga0197907_11351656 3300020069 Bacteria 697
246 Ga0206356_10418937 3300020070 Bacteria 2006
247 Ga0206351_10310838 3300020077 Bacteria 1002
248 Ga0206352_10347145 3300020078 Bacteria 950
249 Ga0206350_11554429 3300020080 Bacteria 1624
250 Ga0206354_10403217 3300020081 Bacteria 868
251 Ga0206353_10263531 3300020082 Bacteria 1291
252 Ga0206353_10564579 3300020082 Bacteria 2736
253 Ga0213876_10006817 3300021384 Bacteria 6236
254 Ga0213875_10036370 3300021388 Bacteria 2322
255 Ga0209646_1002109 3300025246 Bacteria 4642
256 Ga0209026_1000621 3300025250 Bacteria 22325
257 Ga0209759_1012372 3300025256 Bacteria 2367
258 Ga0209455_1000095 3300025272 Bacteria 217487
259 Ga0207653_10002265 3300025885 Bacteria 6130
260 Ga0207653_10016813 3300025885 Bacteria 2299
261 Ga0207653_10199915 3300025885 Bacteria 753
262 Ga0207688_10012863 3300025901 Bacteria 4549
263 Ga0207688_10013128 3300025901 Bacteria 4502
264 Ga0207647_10073832 3300025904 Bacteria 2055
265 Ga0207647_10234969 3300025904 Bacteria 1054
266 Ga0207699_10080371 3300025906 Bacteria 2020
267 Ga0207645_10004648 3300025907 Bacteria 10111
268 Ga0207645_10004917 3300025907 Bacteria 9801
269 Ga0207645_10055436 3300025907 Bacteria 2530
270 Ga0207645_10355760 3300025907 Bacteria 980
271 Ga0207643_10000350 3300025908 Bacteria 31013
272 Ga0207643_10001363 3300025908 Bacteria 14106
273 Ga0207684_10000566 3300025910 Bacteria 45187
274 Ga0207684_10007883 3300025910 Bacteria 9525
275 Ga0207684_10594417 3300025910 Bacteria 945
276 Ga0207654_10001632 3300025911 Bacteria 11720
277 Ga0207654_10002389 3300025911 Bacteria 9603
278 Ga0207654_10005745 3300025911 Bacteria 6266
279 Ga0207654_10427918 3300025911 Bacteria 925
280 Ga0207707_10000076 3300025912 Bacteria 100491
281 Ga0207707_10000124 3300025912 Bacteria 79966
282 Ga0207707_10037675 3300025912 Bacteria 4225
283 Ga0207695_10000636 3300025913 Bacteria 70234
284 Ga0207695_10001597 3300025913 Bacteria 36803
285 Ga0207695_10097452 3300025913 Bacteria 2942
286 Ga0207695_10263902 3300025913 Bacteria 1619
287 Ga0207671_10004931 3300025914 Bacteria 12523
288 Ga0207671_10006636 3300025914 Bacteria 10261
289 Ga0207671_10033352 3300025914 Bacteria 3831
290 Ga0207671_10484257 3300025914 Bacteria 986
291 Ga0207660_10000514 3300025917 Bacteria 25852
292 Ga0207660_10190464 3300025917 Bacteria 1597
293 Ga0207662_10133346 3300025918 Bacteria 1568
294 Ga0207657_10000005 3300025919 Bacteria 213481
295 Ga0207657_10000049 3300025919 Bacteria 110963
296 Ga0207649_10062769 3300025920 Bacteria 2343
297 Ga0207649_10080083 3300025920 Bacteria 2111
298 Ga0207652_10000060 3300025921 Bacteria 113511
299 Ga0207652_10011137 3300025921 Bacteria 7249
300 Ga0207646_10014831 3300025922 Bacteria 7382
301 Ga0207646_10021932 3300025922 Bacteria 5892
302 Ga0207646_10037475 3300025922 Bacteria 4371
303 Ga0207646_10041801 3300025922 Bacteria 4119
304 Ga0207646_10335574 3300025922 Bacteria 1366
305 Ga0207646_10401624 3300025922 Bacteria 1237
306 Ga0207646_10587849 3300025922 Bacteria 1000
307 Ga0207681_10022186 3300025923 Bacteria 4046
308 Ga0207681_10119966 3300025923 Bacteria 1927
309 Ga0207694_10288901 3300025924 Bacteria 1348
310 Ga0207650_10002233 3300025925 Bacteria 13524
311 Ga0207650_10008776 3300025925 Bacteria 6908
312 Ga0207659_10243483 3300025926 Bacteria 1456
313 Ga0207659_10840098 3300025926 Bacteria 789
314 Ga0207700_10160304 3300025928 Bacteria 1868
315 Ga0207690_10005127 3300025932 Bacteria 7735
316 Ga0207690_10006505 3300025932 Bacteria 6927
317 Ga0207706_10003272 3300025933 Bacteria 15500
318 Ga0207706_10007257 3300025933 Bacteria 10246
319 Ga0207706_10111013 3300025933 Bacteria 2412
320 Ga0207709_10065373 3300025935 Bacteria 2287
321 Ga0207709_10167924 3300025935 Bacteria 1537
322 Ga0207709_10905017 3300025935 Bacteria 717
323 Ga0207670_10025535 3300025936 Bacteria 3710
324 Ga0207670_10052554 3300025936 Bacteria 2740
325 Ga0207665_10003137 3300025939 Bacteria 11081
326 Ga0207665_10061532 3300025939 Bacteria 2545
327 Ga0207665_10182984 3300025939 Bacteria 1518
328 Ga0207691_10025477 3300025940 Bacteria 5553
329 Ga0207691_10056721 3300025940 Bacteria 3567
330 Ga0207711_10000003 3300025941 Bacteria 1042791
331 Ga0207711_10000005 3300025941 Bacteria 822972
332 Ga0207711_10000009 3300025941 Bacteria 580864
333 Ga0207689_10000423 3300025942 Bacteria 39658
334 Ga0207689_10001382 3300025942 Bacteria 23246
335 Ga0207661_10051626 3300025944 Bacteria 3282
336 Ga0207679_10000231 3300025945 Bacteria 43268
337 Ga0207679_10000244 3300025945 Bacteria 41582
338 Ga0207667_10001202 3300025949 Bacteria 32395
339 Ga0207667_10001430 3300025949 Bacteria 29914
340 Ga0207667_10011994 3300025949 Bacteria 10033
341 Ga0207651_10002878 3300025960 Bacteria 8303
342 Ga0207651_10659482 3300025960 Bacteria 919
343 Ga0207668_10150528 3300025972 Bacteria 1801
344 Ga0207640_10016124 3300025981 Bacteria 4339
345 Ga0207640_10375619 3300025981 Bacteria 1150
346 Ga0207658_10206114 3300025986 Bacteria 1645
347 Ga0207677_10039278 3300026023 Bacteria 3111
348 Ga0207677_10525106 3300026023 Bacteria 1027
349 Ga0207639_10000571 3300026041 Bacteria 25417
350 Ga0207639_10006846 3300026041 Bacteria 7765
351 Ga0207678_10006031 3300026067 Bacteria 10781
352 Ga0207678_10006894 3300026067 Bacteria 10078
353 Ga0207708_10134757 3300026075 Bacteria 1934
354 Ga0207708_10141567 3300026075 Bacteria 1887
355 Ga0207702_10000049 3300026078 Bacteria 140303
356 Ga0207702_10000576 3300026078 Bacteria 40802
357 Ga0207702_10004925 3300026078 Bacteria 11740
358 Ga0207702_10208672 3300026078 Bacteria 1815
359 Ga0207641_10052381 3300026088 Bacteria 3456
360 Ga0207648_10000565 3300026089 Bacteria 41535
361 Ga0207648_10005767 3300026089 Bacteria 12404
362 Ga0207648_10096966 3300026089 Bacteria 2581
363 Ga0207676_10015355 3300026095 Bacteria 5521
364 Ga0207676_10131931 3300026095 Bacteria 2125
365 Ga0207676_10946362 3300026095 Bacteria 847
366 Ga0207674_10000492 3300026116 Bacteria 52003
367 Ga0207674_10001421 3300026116 Bacteria 30917
368 Ga0207675_100000795 3300026118 Bacteria 31348
369 Ga0207675_100121091 3300026118 Bacteria 2476
370 Ga0207675_100162258 3300026118 Bacteria 2132
371 Ga0207698_10605507 3300026142 Bacteria 1081
372 Ga0209968_1050894 3300027526 Bacteria 719
373 Ga0209970_1006600 3300027614 Bacteria 1905
374 Ga0209588_1013685 3300027671 Bacteria 2477
375 Ga0209971_1021758 3300027682 Bacteria 1526
376 Ga0209974_10045026 3300027876 Bacteria 1473
377 Ga0268265_10001182 3300028380 Bacteria 22850
378 Ga0268265_10001266 3300028380 Bacteria 21820
379 Ga0268265_10086720 3300028380 Bacteria 2489
380 Ga0268265_10161379 3300028380 Bacteria 1904
381 Ga0268265_10416525 3300028380 Bacteria 1246
382 Ga0268265_10998839 3300028380 Bacteria 826
383 Ga0268264_10007448 3300028381 Bacteria 9133
384 Ga0268264_10023811 3300028381 Bacteria 4995
385 Ga0268264_10042062 3300028381 Bacteria 3781
386 Ga0268264_10296184 3300028381 Bacteria 1521
387 Ga0307408_100214002 3300031548 Bacteria 1568
388 Ga0307408_100480087 3300031548 Bacteria 1084
389 Ga0265313_10012819 3300031595 Bacteria 5087
390 Ga0265314_10201608 3300031711 Bacteria 1176
391 Ga0316578_10113832 3300031728 Bacteria 1625
392 Ga0307516_10243944 3300031730 Bacteria 1494
393 Ga0307413_10017402 3300031824 Bacteria 3742
394 Ga0307413_10286757 3300031824 Bacteria 1241
395 Ga0307406_10044374 3300031901 Bacteria 2786
396 Ga0307409_100535484 3300031995 Bacteria 1147
397 Ga0307416_100600132 3300032002 Bacteria 1181
398 Ga0307411_10964459 3300032005 Bacteria 761
399 Ga0373948_0005061 3300034817 Bacteria 2115
400 Ga0373948_0011291 3300034817 Bacteria 1576
401 Ga0373928_0058168 3300035084 Bacteria 929
402 Ga0373929_0041292 3300035085 Bacteria 1025
403 Ga0373940_0018717 3300035088 Bacteria 1741
404 Ga0373949_0008720 3300035090 Bacteria 2220
405 Ga0373951_0009557 3300035091 Bacteria 2182
406 Ga0373941_0052190 3300035115 Bacteria 1303
407 Ga0373960_0016642 3300035121 Bacteria 1895
408 Ga0373942_0113109 3300035207 Bacteria 841
409 Ga0373961_0010700 3300035241 Bacteria 2264
410 Ga0316574_0055806 3300035398 Bacteria 2469
411 Ga0373931_0030527 3300035691 Bacteria 2775
412 Ga0373927_0145132 3300035695 Bacteria 1553
413 Ga0373937_1020198 3300036401 Bacteria 776
414 Ga0395900_0416015 3300037418 Bacteria 1306
415 Ga0395898_0017676 3300037466 Bacteria 7278
416 Ga0395898_0039679 3300037466 Bacteria 4659
417 Ga0395905_0488555 3300037471 Bacteria 1131
418 Ga0436364_0590082 3300037853 Bacteria 2571
419 Ga0436365_0553808 3300039437 Bacteria 16532
420 Ga0436360_0795699 3300039438 Bacteria 1372
421 Ga0436360_1220197 3300039438 Bacteria 2169
422 Ga0439441_045581 3300042001 Bacteria 890
423 Ga0439448_0001120 3300042005 Bacteria 6756
424 Ga0439455_0004006 3300042012 Bacteria 2877
425 Ga0450889_001980 3300042144 Bacteria 2050
426 Ga0439459_0002670 3300042438 Bacteria 2768
427 Ga0439459_0031032 3300042438 Bacteria 1087
428 Ga0439460_0000936 3300042461 Bacteria 6677
429 Ga0451577_0057105 3300042876 Bacteria 3480
430 Ga0451577_0060544 3300042876 Bacteria 3375
431 Ga0451577_0205633 3300042876 Bacteria 1777
432 Ga0451577_0292064 3300042876 Bacteria 1477
433 Ga0451577_0411111 3300042876 Bacteria 1228
434 Ga0466966_0108193 3300044684 Bacteria 1715
435 Ga0466964_0440080 3300044706 Bacteria 689
436 Ga0453684_0089773 3300044712 Bacteria 3799
437 Ga0453684_0592781 3300044712 Bacteria 1216
438 Ga0453684_0806341 3300044712 Bacteria 1012
439 Ga0466968_0115570 3300044735 Unclassified 1210
440 Ga0466959_0155116 3300045049 Bacteria 1612
441 Ga0451576_0000361 3300045051 Bacteria 109138
442 Ga0451576_0024702 3300045051 Bacteria 6487
443 Ga0451576_0030315 3300045051 Bacteria 5780
444 Ga0451576_0030489 3300045051 Bacteria 5763
445 Ga0495580_0103500 3300046472 Bacteria 1979
446 Ga0495580_0196601 3300046472 Bacteria 1390
447 Ga0495580_0286655 3300046472 Bacteria 1123
448 Ga0495584_0175342 3300046491 Bacteria 1090
449 Ga0495667_0078754 3300046559 Bacteria 2143
450 Ga0495623_0091453 3300046679 Bacteria 1867
451 Ga0495646_0045172 3300046680 Bacteria 2692
452 Ga0496102_0040054 3300048905 Bacteria 4237
453 Ga0496106_0293728 3300048909 Bacteria 1303
454 Ga0496109_0279256 3300048912 Bacteria 1574
455 Ga0496110_0323017 3300048913 Bacteria 1406
456 Ga0496112_0094499 3300048915 Bacteria 2960
457 Ga0496113_0225671 3300048916 Bacteria 1493
458 Ga0496114_0024929 3300048917 Bacteria 4884
459 Ga0501036_0076357 3300049572 Bacteria 2834
460 Ga0501036_0184820 3300049572 Bacteria 1754
461 Ga0501040_0003453 3300049576 Bacteria 10199
462 Ga0501046_0000011 3300049580 Bacteria 326457
463 Ga0501047_0152737 3300049581 Bacteria 2184
464 Ga0501048_0012233 3300049582 Bacteria 6387
465 Ga0501067_0068690 3300049583 Bacteria 1962
466 Ga0501068_0160239 3300049584 Bacteria 1418
467 Ga0501069_0007801 3300049585 Bacteria 5620
468 Ga0501072_0158630 3300049588 Bacteria 1804
469 Ga0501073_0190470 3300049589 Bacteria 1419
470 Ga0501075_0014492 3300049591 Bacteria 5650
471 Ga0501079_0111521 3300049741 Bacteria 2125
472 Ga0501081_0003272 3300049743 Bacteria 10293
473 Ga0501081_0010296 3300049743 Bacteria 6106
474 Ga0501081_0025466 3300049743 Bacteria 3979
475 Ga0501035_0014175 3300049822 Bacteria 7356
476 nmdc:mga03683_62585_c1 3300050489 Bacteria 1576
477 nmdc:mga03n38_254876_c1 3300050490 Bacteria 928
478 nmdc:mga05p37_11628_c1 3300050507 Bacteria 10489
479 nmdc:mga05p37_131934_c1 3300050507 Bacteria 3065
480 nmdc:mga05p37_1731_c1 3300050507 Bacteria 25473
481 nmdc:mga05p37_3046_c1 3300050507 Bacteria 19461
482 nmdc:mga05p37_365555_c1 3300050507 Bacteria 1695
483 nmdc:mga05p37_78012_c1 3300050507 Bacteria 4078
484 nmdc:mga05p37_80756_c1 3300050507 Bacteria 4005
485 nmdc:mga09592_11081_c1 3300050508 Bacteria 7337
486 nmdc:mga09592_111174_c1 3300050508 Bacteria 2351
487 nmdc:mga09592_9393_c1 3300050508 Bacteria 7951
488 nmdc:mga0qj67_166439_c1 3300050509 Bacteria 1790
489 nmdc:mga0qj67_3553_c1 3300050509 Bacteria 11252
490 nmdc:mga0qj67_71885_c1 3300050509 Bacteria 2761
491 nmdc:mga06r32_10491_c1 3300050510 Bacteria 8356
492 nmdc:mga06r32_1179_c1 3300050510 Bacteria 23558
493 nmdc:mga06r32_1301951_c1 3300050510 Bacteria 671
494 nmdc:mga06r32_2393_c1 3300050510 Bacteria 16786
495 nmdc:mga0n895_133182_c1 3300050512 Bacteria 2512
496 nmdc:mga0n895_144476_c1 3300050512 Bacteria 2408
497 nmdc:mga0n895_223842_c1 3300050512 Bacteria 1910
498 nmdc:mga0n895_490722_c1 3300050512 Bacteria 1238
499 nmdc:mga0n895_845079_c1 3300050512 Bacteria 904
500 nmdc:mga0rr50_11743_c1 3300050513 Bacteria 5621
501 nmdc:mga0rr50_308187_c1 3300050513 Bacteria 1326
502 nmdc:mga0rr50_44080_c1 3300050513 Bacteria 3269
503 nmdc:mga0rr50_78211_c1 3300050513 Bacteria 2545
504 nmdc:mga08x19_93647_c1 3300050514 Bacteria 1986
505 nmdc:mga0a205_223996_c1 3300050515 Bacteria 1766
506 nmdc:mga0a205_326696_c1 3300050515 Bacteria 1404
507 nmdc:mga0a205_548629_c1 3300050515 Bacteria 1011
508 Ga0501084_0016740 3300054114 Bacteria 6089
509 Ga0501082_0001283 3300060353 Bacteria 22061
510 Ga0530510_0022624 3300061734 Bacteria 4478
511 Ga0530510_0246775 3300061734 Bacteria 1330
512 2739617755 2739367656 Bacteria 5152243
513 Ga0501042_0008411
514 JGI24033J26618_1021565
515 JGI25157J39369_1002507
516 rootH1_10325573
517 Ga0058861_11775439
518 Ga0058862_12531173
519 Ga0065714_10093817
520 Ga0065712_10034302
521 Ga0065712_10163860
522 Ga0065715_10193385
523 Ga0065715_10433451
524 Ga0065707_10309768
525 Ga0065707_10320574
526 Ga0070676_10000511
527 Ga0070676_10020103
528 Ga0070676_10048020
529 Ga0070676_10267069
530 Ga0070683_100078947
531 Ga0070670_100000405
532 Ga0070670_100031469
533 Ga0068869_100000503
534 Ga0068869_100141891
535 Ga0070680_100000913
536 Ga0070680_100002762
537 Ga0070680_100110015
538 Ga0070682_100000182
539 Ga0070682_100000307
540 Ga0068868_100052262
541 Ga0068868_100146648
542 Ga0070660_100001850
543 Ga0070689_100039704
544 Ga0070661_100000431
545 Ga0070661_100003122
546 Ga0070692_10000066
547 Ga0070692_10000720
548 Ga0070692_10173045
549 Ga0070668_100147346
550 Ga0070669_100228807
551 Ga0070669_100322338
552 Ga0070669_100374676
553 Ga0070675_100258346
554 Ga0070674_100222846
555 Ga0070673_100001540
556 Ga0070673_100306314
557 Ga0070688_100207164
558 Ga0070659_100000500
559 Ga0070659_100004742
560 Ga0070703_10048801
561 Ga0070703_10104379
562 Ga0070714_100382644
563 Ga0070713_100180646
564 Ga0070701_10043678
565 Ga0070701_10045172
566 Ga0070711_100381537
567 Ga0070705_100000180
568 Ga0070705_100000328
569 Ga0070705_100009572
570 Ga0070700_100024958
571 Ga0070700_100240675
572 Ga0070694_100000116
573 Ga0070694_100046489
574 Ga0070694_100430838
575 Ga0070694_100698682
576 Ga0070708_100010711
577 Ga0070708_100367709
578 Ga0070708_100571164
579 Ga0070708_100944762
580 Ga0070663_100002682
581 Ga0070663_100010542
582 Ga0070678_100057693
583 Ga0070662_100004416
584 Ga0070662_100018940
585 Ga0070681_10004002
586 Ga0070681_10004717
587 Ga0070681_10021872
588 Ga0068867_100001933
589 Ga0068867_100009003
590 Ga0068867_100026941
591 Ga0070706_100009747
592 Ga0070706_100020440
593 Ga0070706_100160489
594 Ga0070707_100029038
595 Ga0070707_100064558
596 Ga0070707_100176799
597 Ga0070707_100195568
598 Ga0070707_100201642
599 Ga0070707_100658400
600 Ga0070698_100017154
601 Ga0070698_100210585
602 Ga0070698_100370865
603 Ga0070699_100013996
604 Ga0070699_100042150
605 Ga0070699_100348390
606 Ga0070699_100394978
607 Ga0070679_100000782
608 Ga0070679_100002937
609 Ga0070679_100107626
610 Ga0070679_100165186
611 Ga0070679_100435564
612 Ga0070684_100103823
613 Ga0070684_100125873
614 Ga0070697_100103611
615 Ga0070697_100393638
616 Ga0068853_100000088
617 Ga0068853_100127416
618 Ga0070672_100069797
619 Ga0070672_100104828
620 Ga0070695_100000261
621 Ga0070695_100000517
622 Ga0070695_100014943
623 Ga0070695_100102962
624 Ga0070696_100000841
625 Ga0070696_100010063
626 Ga0070696_100175776
627 Ga0070696_100362957
628 Ga0070693_100000207
629 Ga0070693_100001339
630 Ga0070704_100000649
631 Ga0070704_100097494
632 Ga0070704_100117387
633 Ga0070704_100302003
634 Ga0068855_100000493
635 Ga0068855_100001473
636 Ga0068855_100037779
637 Ga0068855_100039601
638 Ga0070664_100000847
639 Ga0070664_100022688
640 Ga0068857_100066870
641 Ga0068854_100002825
642 Ga0068854_100020466
643 Ga0068854_100183911
644 Ga0068854_100321677
645 Ga0068854_100892744
646 Ga0068856_100000022
647 Ga0068856_100000198
648 Ga0068856_100000796
649 Ga0068856_100135488
650 Ga0070702_100018485
651 Ga0070702_100020066
652 Ga0068852_100546751
653 Ga0068859_100000533
654 Ga0068859_100003796
655 Ga0068859_100040821
656 Ga0068859_100822817
657 Ga0068864_100016508
658 Ga0068864_100137726
659 Ga0068864_101168154
660 Ga0068861_100000784
661 Ga0068870_10000788
662 Ga0068870_10011795
663 Ga0068863_100228648
664 Ga0068858_100012891
665 Ga0068858_100555568
666 Ga0068860_100003786
667 Ga0068860_100035695
668 Ga0068860_100392359
669 Ga0068860_100652143
670 Ga0068862_100000415
671 Ga0068862_100002114
672 Ga0068862_100117899
673 Ga0068862_100130777
674 Ga0068862_100214142
675 Ga0068862_100256353
676 Ga0068862_100740781
677 Ga0081455_10005726
678 Ga0081455_10054540
679 Ga0081539_10013430
680 Ga0075363_100073006
681 Ga0075364_10101877
682 Ga0068871_100215160
683 Ga0075428_100000176
684 Ga0075428_100009637
685 Ga0075428_100698427
686 Ga0075430_100013184
687 Ga0075430_100082953
688 Ga0075431_100000420
689 Ga0075431_100001064
690 Ga0075431_100009818
691 Ga0075431_100061269
692 Ga0075431_101056375
693 Ga0075433_10028310
694 Ga0075433_10145881
695 Ga0075433_10533508
696 Ga0075434_100173892
697 Ga0075434_100175504
698 Ga0075429_100001389
699 Ga0075429_100008063
700 Ga0075436_100104052
701 Ga0075436_100180976
702 Ga0075436_100222498
703 Ga0097620_100000533
704 Ga0097620_100003796
705 Ga0097620_100040823
706 Ga0097620_100822855
707 Ga0075435_100027653
708 Ga0075435_100032802
709 Ga0075435_100180800
710 Ga0105240_10001403
711 Ga0105240_10015452
712 Ga0105240_10500255
713 Ga0114129_10008633
714 Ga0114129_10016092
715 Ga0114129_10034094
716 Ga0114129_10134768
717 Ga0114129_10430314
718 Ga0105243_10100151
719 Ga0105243_10708989
720 Ga0105243_11100762
721 Ga0105241_10000067
722 Ga0105241_10005575
723 Ga0105241_11090676
724 Ga0105248_10000015
725 Ga0105248_10461202
726 Ga0105248_10621090
727 Ga0105237_10000667
728 Ga0105237_10046289
729 Ga0105237_10254196
730 Ga0105237_10589871
731 Ga0105238_10090542
732 Ga0105249_10659154
733 Ga0105239_10652238
734 Ga0157373_10000176
735 Ga0157373_10000398
736 Ga0157371_10369494
737 Ga0157370_10380703
738 Ga0157370_10547200
739 Ga0157369_10013569
740 Ga0157369_10015237
741 Ga0157369_10057932
742 Ga0157369_10143891
743 Ga0157374_10209089
744 Ga0157378_11156008
745 Ga0163162_10723999
746 Ga0157372_10000370
747 Ga0157372_10000377
748 Ga0157372_10021219
749 Ga0157372_10056734
750 Ga0157372_10463373
751 Ga0157375_10014313
752 Ga0157375_10723197
753 Ga0163163_10460972
754 Ga0157380_10458543
755 Ga0157380_10534205
756 Ga0157379_10326543
757 Ga0197907_11351656
758 Ga0206356_10418937
759 Ga0206351_10310838
760 Ga0206352_10347145
761 Ga0206350_11554429
762 Ga0206354_10403217
763 Ga0206353_10263531
764 Ga0206353_10564579
765 Ga0213876_10006817
766 Ga0213875_10036370
767 Ga0209646_1002109
768 Ga0209026_1000621
769 Ga0209759_1012372
770 Ga0209455_1000095
771 Ga0207653_10002265
772 Ga0207653_10016813
773 Ga0207653_10199915
774 Ga0207688_10012863
775 Ga0207688_10013128
776 Ga0207647_10073832
777 Ga0207647_10234969
778 Ga0207699_10080371
779 Ga0207645_10004648
780 Ga0207645_10004917
781 Ga0207645_10055436
782 Ga0207645_10355760
783 Ga0207643_10000350
784 Ga0207643_10001363
785 Ga0207684_10000566
786 Ga0207684_10007883
787 Ga0207684_10594417
788 Ga0207654_10001632
789 Ga0207654_10002389
790 Ga0207654_10005745
791 Ga0207654_10427918
792 Ga0207707_10000076
793 Ga0207707_10000124
794 Ga0207707_10037675
795 Ga0207695_10000636
796 Ga0207695_10001597
797 Ga0207695_10097452
798 Ga0207695_10263902
799 Ga0207671_10004931
800 Ga0207671_10006636
801 Ga0207671_10033352
802 Ga0207671_10484257
803 Ga0207660_10000514
804 Ga0207660_10190464
805 Ga0207662_10133346
806 Ga0207657_10000005
807 Ga0207657_10000049
808 Ga0207649_10062769
809 Ga0207649_10080083
810 Ga0207652_10000060
811 Ga0207652_10011137
812 Ga0207646_10014831
813 Ga0207646_10021932
814 Ga0207646_10037475
815 Ga0207646_10041801
816 Ga0207646_10335574
817 Ga0207646_10401624
818 Ga0207646_10587849
819 Ga0207681_10022186
820 Ga0207681_10119966
821 Ga0207694_10288901
822 Ga0207650_10002233
823 Ga0207650_10008776
824 Ga0207659_10243483
825 Ga0207659_10840098
826 Ga0207700_10160304
827 Ga0207690_10005127
828 Ga0207690_10006505
829 Ga0207706_10003272
830 Ga0207706_10007257
831 Ga0207706_10111013
832 Ga0207709_10065373
833 Ga0207709_10167924
834 Ga0207709_10905017
835 Ga0207670_10025535
836 Ga0207670_10052554
837 Ga0207665_10003137
838 Ga0207665_10061532
839 Ga0207665_10182984
840 Ga0207691_10025477
841 Ga0207691_10056721
842 Ga0207711_10000003
843 Ga0207711_10000005
844 Ga0207711_10000009
845 Ga0207689_10000423
846 Ga0207689_10001382
847 Ga0207661_10051626
848 Ga0207679_10000231
849 Ga0207679_10000244
850 Ga0207667_10001202
851 Ga0207667_10001430
852 Ga0207667_10011994
853 Ga0207651_10002878
854 Ga0207651_10659482
855 Ga0207668_10150528
856 Ga0207640_10016124
857 Ga0207640_10375619
858 Ga0207658_10206114
859 Ga0207677_10039278
860 Ga0207677_10525106
861 Ga0207639_10000571
862 Ga0207639_10006846
863 Ga0207678_10006031
864 Ga0207678_10006894
865 Ga0207708_10134757
866 Ga0207708_10141567
867 Ga0207702_10000049
868 Ga0207702_10000576
869 Ga0207702_10004925
870 Ga0207702_10208672
871 Ga0207641_10052381
872 Ga0207648_10000565
873 Ga0207648_10005767
874 Ga0207648_10096966
875 Ga0207676_10015355
876 Ga0207676_10131931
877 Ga0207676_10946362
878 Ga0207674_10000492
879 Ga0207674_10001421
880 Ga0207675_100000795
881 Ga0207675_100121091
882 Ga0207675_100162258
883 Ga0207698_10605507
884 Ga0209968_1050894
885 Ga0209970_1006600
886 Ga0209588_1013685
887 Ga0209971_1021758
888 Ga0209974_10045026
889 Ga0268265_10001182
890 Ga0268265_10001266
891 Ga0268265_10086720
892 Ga0268265_10161379
893 Ga0268265_10416525
894 Ga0268265_10998839
895 Ga0268264_10007448
896 Ga0268264_10023811
897 Ga0268264_10042062
898 Ga0268264_10296184
899 Ga0307408_100214002
900 Ga0307408_100480087
901 Ga0265313_10012819
902 Ga0265314_10201608
903 Ga0316578_10113832
904 Ga0307516_10243944
905 Ga0307413_10017402
906 Ga0307413_10286757
907 Ga0307406_10044374
908 Ga0307409_100535484
909 Ga0307416_100600132
910 Ga0307411_10964459
911 Ga0373948_0005061
912 Ga0373948_0011291
913 Ga0373928_0058168
914 Ga0373929_0041292
915 Ga0373940_0018717
916 Ga0373949_0008720
917 Ga0373951_0009557
918 Ga0373941_0052190
919 Ga0373960_0016642
920 Ga0373942_0113109
921 Ga0373961_0010700
922 Ga0316574_0055806
923 Ga0373931_0030527
924 Ga0373927_0145132
925 Ga0373937_1020198
926 Ga0395900_0416015
927 Ga0395898_0017676
928 Ga0395898_0039679
929 Ga0395905_0488555
930 Ga0436364_0590082
931 Ga0436365_0553808
932 Ga0436360_0795699
933 Ga0436360_1220197
934 Ga0439441_045581
935 Ga0439448_0001120
936 Ga0439455_0004006
937 Ga0450889_001980
938 Ga0439459_0002670
939 Ga0439459_0031032
940 Ga0439460_0000936
941 Ga0451577_0057105
942 Ga0451577_0060544
943 Ga0451577_0205633
944 Ga0451577_0292064
945 Ga0451577_0411111
946 Ga0466966_0108193
947 Ga0466964_0440080
948 Ga0453684_0089773
949 Ga0453684_0592781
950 Ga0453684_0806341
951 Ga0466968_0115570
952 Ga0466959_0155116
953 Ga0451576_0000361
954 Ga0451576_0024702
955 Ga0451576_0030315
956 Ga0451576_0030489
957 Ga0495580_0103500
958 Ga0495580_0196601
959 Ga0495580_0286655
960 Ga0495584_0175342
961 Ga0495667_0078754
962 Ga0495623_0091453
963 Ga0495646_0045172
964 Ga0496102_0040054
965 Ga0496106_0293728
966 Ga0496109_0279256
967 Ga0496110_0323017
968 Ga0496112_0094499
969 Ga0496113_0225671
970 Ga0496114_0024929
971 Ga0501036_0076357
972 Ga0501036_0184820
973 Ga0501040_0003453
974 Ga0501046_0000011
975 Ga0501047_0152737
976 Ga0501048_0012233
977 Ga0501067_0068690
978 Ga0501068_0160239
979 Ga0501069_0007801
980 Ga0501072_0158630
981 Ga0501073_0190470
982 Ga0501075_0014492
983 Ga0501079_0111521
984 Ga0501081_0003272
985 Ga0501081_0010296
986 Ga0501081_0025466
987 Ga0501035_0014175
988 nmdc:mga03683_62585_c1
989 nmdc:mga03n38_254876_c1
990 nmdc:mga05p37_11628_c1
991 nmdc:mga05p37_131934_c1
992 nmdc:mga05p37_1731_c1
993 nmdc:mga05p37_3046_c1
994 nmdc:mga05p37_365555_c1
995 nmdc:mga05p37_78012_c1
996 nmdc:mga05p37_80756_c1
997 nmdc:mga09592_11081_c1
998 nmdc:mga09592_111174_c1
999 nmdc:mga09592_9393_c1
1000 nmdc:mga0qj67_166439_c1
1001 nmdc:mga0qj67_3553_c1
1002 nmdc:mga0qj67_71885_c1
1003 nmdc:mga06r32_10491_c1
1004 nmdc:mga06r32_1179_c1
1005 nmdc:mga06r32_1301951_c1
1006 nmdc:mga06r32_2393_c1
1007 nmdc:mga0n895_133182_c1
1008 nmdc:mga0n895_144476_c1
1009 nmdc:mga0n895_223842_c1
1010 nmdc:mga0n895_490722_c1
1011 nmdc:mga0n895_845079_c1
1012 nmdc:mga0rr50_11743_c1
1013 nmdc:mga0rr50_308187_c1
1014 nmdc:mga0rr50_44080_c1
1015 nmdc:mga0rr50_78211_c1
1016 nmdc:mga08x19_93647_c1
1017 nmdc:mga0a205_223996_c1
1018 nmdc:mga0a205_326696_c1
1019 nmdc:mga0a205_548629_c1
1020 Ga0501084_0016740
1021 Ga0501082_0001283
1022 Ga0530510_0022624
1023 Ga0530510_0246775
1024 2739617755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

42

173

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

193

232

0.96

PF08534

Redoxin

Redoxin

41

191

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9674 3 210
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9627 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.96 3 210
5b6n-assembly2.cif.gz_C crystal structures of human peroxiredoxin 6 in sulfinic acid state 0.9545 2 209
1xcc-assembly2.cif.gz_D 1-cys peroxidoxin from plasmodium yoelli 0.9522 5 207
ID Description Score Start End Superfamily
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9772 146 207 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.975 146 209 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9604 146 209 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9603 5 106 3.40.30.10
5b6mE01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9436 2 145 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9867 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A659YRX5-F1-model_v4 deleted 0.9824 1 104
AF-A0A7K0JSX1-F1-model_v4 deleted 0.9802 1 209
AF-A0A3B0MZ76-F1-model_v4 Putative peroxiredoxin (EC 1.11.1.15) 0.9798 1 207 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1T5DCE5-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9793 1 207 GO:0005829
GO:0016020
GO:0045454
GO:0051920

Map