F457501

General Info

Members Datasets Scaffolds Average Seq Length
512 403 1024 285

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2958122699|2958126929
Length 338
Sequence IHADPDPSYVFSETSAAPYGGKAIGCQPRSQRFSMLFAGCDGGPYPWPEDTAIEPAMSDKTNTPKDTHYAKLRRAYRDEKSGGAPAFRPRQPVPPGENAADGLVRLYGLHTVRAALDNPRRKIRKMLVTRNAAERLEIADLAALPFKTELVEPRDIDKITGSDAVHQGVLIEAEPLKAKRLDALGDAKLVLVLDQITDPHNVGAILRSAVAFGAGALITTARHSPQESGVLAKSASGALEHIDQIEVKNLAEALGQLHEAGFRTIGLDSDAPAELEKSFAGEKIALVLGAEGKGLRQKTRETVTTLARLDMPGAIHSLNVSNAAAISLYVARAFLKRG

Samples

Sample ID Description Type Environment
1 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
26 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
27 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
29 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
30 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
31 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
54 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
55 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
56 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
57 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
58 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
59 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
60 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
61 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
62 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
63 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
64 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
65 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
66 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
67 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
97 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
98 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
101 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
102 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
103 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
104 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
105 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
106 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
107 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
108 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
109 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
110 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
111 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
112 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
113 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
114 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
115 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
116 2512875024
117 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
118 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
119 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
120 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
121 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
122 2534681786 Brucella suis 92/29 Isolate Unclassified
123 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
124 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
125 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
126 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
127 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
128 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
129 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
130 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
131 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
132 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
133 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
134 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
135 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
136 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
137 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
138 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
139 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
140 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
141 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
142 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
143 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
144 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
145 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
146 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
147 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
148 2738543024 Aminobacter sp. AP02 Isolate Unclassified
149 2751185800 Brucella pituitosa AA2 Isolate Unclassified
150 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
151 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
152 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
153 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
154 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
155 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
156 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
157 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
158 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
159 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
160 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
161 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
162 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
163 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
164 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
165 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
166 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
167 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
168 2854911287 Brucella lupini LUP21 Isolate Unclassified
169 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
170 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
171 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
172 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
173 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
174 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
175 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
176 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
177 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
178 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
179 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
180 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
181 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
182 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
183 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
184 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
185 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
186 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
187 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
188 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
189 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
190 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
191 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
192 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
193 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
194 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
195 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
196 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
197 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
198 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
199 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
200 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
201 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
202 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
203 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
204 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
205 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
206 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
207 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
208 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
209 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
210 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
211 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
212 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
213 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
214 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
215 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
216 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
217 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
218 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
219 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
220 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
221 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
222 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
223 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
224 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
225 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
226 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
227 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
228 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
229 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
230 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
231 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
232 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
233 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
234 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
235 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
236 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
237 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
238 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
239 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
240 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
241 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
242 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
243 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
244 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
245 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
246 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
247 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
248 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
249 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
250 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
251 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
252 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
253 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
254 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
255 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
256 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
257 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
258 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
259 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
260 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
261 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
262 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
263 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
264 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
265 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
266 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
267 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
268 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
269 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
270 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
271 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
272 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
273 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
274 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
275 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
276 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
277 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
278 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
279 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
280 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
281 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
282 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
283 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
284 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
285 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
286 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
287 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
288 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
289 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
290 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
291 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
292 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
293 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
294 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
295 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
296 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
297 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
298 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
299 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
300 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
301 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
302 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
303 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
304 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
305 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
306 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
307 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
308 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
309 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
310 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
311 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
312 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
313 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
314 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
315 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
316 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
317 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
318 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
319 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
320 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
321 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
322 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
323 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
324 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
325 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
326 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
327 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
328 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
329 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
330 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
331 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
332 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
333 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
334 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
335 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
336 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
337 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
338 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
339 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
340 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
341 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
342 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
343 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
344 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
345 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
346 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
347 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
348 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
349 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
350 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
351 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
352 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
353 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
354 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
355 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
356 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
357 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
358 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
359 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
360 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
361 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
362 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
363 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
364 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
365 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
366 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
367 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
368 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
369 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
370 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
371 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
372 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
373 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
374 3004167301 Mesorhizobium loti 582 Isolate Unclassified
375 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
376 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
377 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
378 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
379 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
380 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
381 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
382 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
383 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
384 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
385 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
386 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
387 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
388 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
389 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
390 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
391 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
392 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
393 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
394 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
395 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
396 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
397 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
398 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
399 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
400 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
401 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
402 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
403 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.41
Metatranscriptomes 0
Isolates 58.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 42.38
Rhizoplane 1.17
Rhizosphere 32.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000152 3300002739 Bacteria 16230
2 JGI25157J39369_1001570 3300002741 Bacteria 8098
3 Ga0055542_1001709 3300003762 Bacteria 9522
4 Ga0055526_1032196 3300003771 Bacteria 1485
5 Ga0055536_1006498 3300003781 Bacteria 5435
6 Ga0055531_10009806 3300003794 Bacteria 4854
7 Ga0055531_10010071 3300003794 Bacteria 4747
8 Ga0070658_10188567 3300005327 Bacteria 1737
9 Ga0070668_100171319 3300005347 Bacteria 1768
10 Ga0070663_100037010 3300005455 Bacteria 3394
11 Ga0068853_100371051 3300005539 Bacteria 1335
12 Ga0070665_100361587 3300005548 Bacteria 1457
13 Ga0068855_100289433 3300005563 Bacteria 1816
14 Ga0081539_10003601 3300005985 Bacteria 18738
15 Ga0075365_10150783 3300006038 Bacteria 1617
16 Ga0075365_10213752 3300006038 Bacteria 1352
17 Ga0075368_10090469 3300006042 Bacteria 1251
18 Ga0075368_10156401 3300006042 Bacteria 954
19 Ga0075364_10010992 3300006051 Bacteria 5490
20 Ga0075364_10092954 3300006051 Bacteria 2002
21 Ga0075362_10069251 3300006177 Bacteria 1608
22 Ga0075367_10250659 3300006178 Bacteria 1110
23 Ga0075369_10055176 3300006186 Bacteria 1726
24 Ga0075366_10104644 3300006195 Bacteria 1700
25 Ga0105240_10469410 3300009093 Bacteria 1405
26 Ga0123342_1034447 3300009766 Bacteria 2228
27 Ga0105239_10437077 3300010375 Bacteria 1483
28 Ga0157369_10039473 3300013105 Bacteria 5158
29 Ga0157369_10068649 3300013105 Bacteria 3808
30 Ga0182005_1043258 3300015265 Bacteria 1224
31 Ga0209026_1000002 3300025250 Bacteria 1136158
32 Ga0209148_1000038 3300025254 Bacteria 493744
33 Ga0209759_1000897 3300025256 Bacteria 22261
34 Ga0209129_1005525 3300025258 Bacteria 4434
35 Ga0209233_1000188 3300025261 Bacteria 132904
36 Ga0209455_1000068 3300025272 Bacteria 310024
37 Ga0209025_1002031 3300025294 Bacteria 23103
38 Ga0209758_1000889 3300025297 Bacteria 40964
39 Ga0209758_1042308 3300025297 Bacteria 1691
40 Ga0209050_1012220 3300025298 Bacteria 3963
41 Ga0209051_1003231 3300025303 Bacteria 10844
42 Ga0209257_1001432 3300025304 Bacteria 28284
43 Ga0207705_10214229 3300025909 Bacteria 1461
44 Ga0207657_10282944 3300025919 Bacteria 1316
45 Ga0207694_10151242 3300025924 Bacteria 1870
46 Ga0207694_10320690 3300025924 Bacteria 1279
47 Ga0207639_10058847 3300026041 Bacteria 2957
48 Ga0207639_10168692 3300026041 Bacteria 1851
49 Ga0207678_10013361 3300026067 Bacteria 7206
50 Ga0207702_10222362 3300026078 Bacteria 1760
51 Ga0207674_10216171 3300026116 Bacteria 1865
52 Ga0316582_0017333 3300036647 Bacteria 4166
53 Ga0395899_0000073 3300037312 Bacteria 181387
54 Ga0395899_0020087 3300037312 Bacteria 5068
55 Ga0395900_0000027 3300037418 Bacteria 285957
56 Ga0395900_0029856 3300037418 Bacteria 5595
57 Ga0395900_0092119 3300037418 Bacteria 3114
58 Ga0395900_0239615 3300037418 Bacteria 1820
59 Ga0395898_0000043 3300037466 Bacteria 301783
60 Ga0395898_0070910 3300037466 Bacteria 3368
61 Ga0395898_0203152 3300037466 Bacteria 1891
62 Ga0395898_0388991 3300037466 Bacteria 1330
63 Ga0395898_0465334 3300037466 Bacteria 1204
64 Ga0395905_0000032 3300037471 Bacteria 285932
65 Ga0395905_0059079 3300037471 Bacteria 3585
66 Ga0395905_0346084 3300037471 Bacteria 1378
67 Ga0395901_0000056 3300038443 Bacteria 154356
68 Ga0395901_0011424 3300038443 Bacteria 8995
69 Ga0395901_0269453 3300038443 Bacteria 1771
70 Ga0395901_0490270 3300038443 Bacteria 1252
71 Ga0466965_0038472 3300044683 Bacteria 2350
72 Ga0466970_0161975 3300044765 Bacteria 1238
73 Ga0466960_0056876 3300044901 Bacteria 1906
74 Ga0495638_0063946 3300046460 Bacteria 2267
75 Ga0495638_0091660 3300046460 Bacteria 1830
76 Ga0495606_0091987 3300046507 Bacteria 1864
77 Ga0495643_0024216 3300046522 Bacteria 3445
78 Ga0495597_0057824 3300046542 Bacteria 1696
79 Ga0495625_0106288 3300046660 Bacteria 1922
80 Ga0495625_0212348 3300046660 Bacteria 1271
81 Ga0496112_0282715 3300048915 Bacteria 1606
82 Ga0496117_0012593 3300048920 Bacteria 7441
83 Ga0496117_0024480 3300048920 Bacteria 4774
84 Ga0496118_0014301 3300048921 Bacteria 7441
85 Ga0496118_0104503 3300048921 Bacteria 1901
86 Ga0496118_0126159 3300048921 Bacteria 1656
87 Ga0496119_0014875 3300048922 Bacteria 6050
88 Ga0496119_0059506 3300048922 Bacteria 2294
89 Ga0496120_0011851 3300048923 Bacteria 5965
90 Ga0496120_0029862 3300048923 Bacteria 3323
91 Ga0496120_0075927 3300048923 Bacteria 1833
92 Ga0496120_0118525 3300048923 Bacteria 1372
93 Ga0496121_0041522 3300048924 Bacteria 4018
94 Ga0496122_0002761 3300048925 Bacteria 24237
95 Ga0496122_0006681 3300048925 Bacteria 13137
96 Ga0496123_0002214 3300048926 Bacteria 24685
97 Ga0496123_0036614 3300048926 Bacteria 3477
98 Ga0496123_0049707 3300048926 Bacteria 2808
99 Ga0496124_0013753 3300048927 Bacteria 7876
100 Ga0496124_0018773 3300048927 Bacteria 6461
101 Ga0496124_0340995 3300048927 Bacteria 1064
102 Ga0496125_0000039 3300048928 Bacteria 318665
103 Ga0496125_0006026 3300048928 Bacteria 13260
104 Ga0496126_0002949 3300048929 Bacteria 22105
105 Ga0496126_0026256 3300048929 Bacteria 5587
106 Ga0496126_0149540 3300048929 Bacteria 2002
107 Ga0501031_0079215 3300049568 Bacteria 2141
108 Ga0501031_0094350 3300049568 Bacteria 1952
109 Ga0501031_0100470 3300049568 Bacteria 1887
110 Ga0501032_0000133 3300049569 Bacteria 60434
111 Ga0501032_0000524 3300049569 Bacteria 31194
112 Ga0501032_0125432 3300049569 Bacteria 1696
113 Ga0501033_0000121 3300049570 Bacteria 75242
114 Ga0501033_0000732 3300049570 Bacteria 30126
115 Ga0501033_0002396 3300049570 Bacteria 15960
116 Ga0501033_0002920 3300049570 Bacteria 14304
117 Ga0501033_0212215 3300049570 Bacteria 1380
118 Ga0501033_0253358 3300049570 Bacteria 1247
119 Ga0501034_0000064 3300049571 Bacteria 189461
120 Ga0501034_0001550 3300049571 Bacteria 30141
121 Ga0501034_0008308 3300049571 Bacteria 10988
122 Ga0501034_0021366 3300049571 Bacteria 6599
123 Ga0501034_0175528 3300049571 Bacteria 2109
124 Ga0501036_0000084 3300049572 Bacteria 58568
125 Ga0501036_0000414 3300049572 Bacteria 30141
126 Ga0501037_0000148 3300049573 Bacteria 65185
127 Ga0501037_0000509 3300049573 Bacteria 31179
128 Ga0501037_0000596 3300049573 Bacteria 28219
129 Ga0501038_0000443 3300049574 Bacteria 36113
130 Ga0501038_0000684 3300049574 Bacteria 30141
131 Ga0501038_0056794 3300049574 Bacteria 3362
132 Ga0501038_0059254 3300049574 Bacteria 3280
133 Ga0501038_0231571 3300049574 Bacteria 1470
134 Ga0501039_0000103 3300049575 Bacteria 57916
135 Ga0501039_0000437 3300049575 Bacteria 30141
136 Ga0501040_0013017 3300049576 Bacteria 5469
137 Ga0501043_0000029 3300049579 Bacteria 143328
138 Ga0501043_0003432 3300049579 Bacteria 13012
139 Ga0501043_0004546 3300049579 Bacteria 11271
140 Ga0501043_0262910 3300049579 Bacteria 1326
141 Ga0501043_0311179 3300049579 Bacteria 1202
142 Ga0501046_0013687 3300049580 Bacteria 6858
143 Ga0501046_0208268 3300049580 Bacteria 1452
144 Ga0501047_0028325 3300049581 Bacteria 5400
145 Ga0501047_0029100 3300049581 Bacteria 5327
146 Ga0501047_0034333 3300049581 Bacteria 4897
147 Ga0501047_0091257 3300049581 Bacteria 2924
148 Ga0501047_0222194 3300049581 Bacteria 1745
149 Ga0501047_0374162 3300049581 Bacteria 1259
150 Ga0501048_0001718 3300049582 Bacteria 16695
151 Ga0501067_0017914 3300049583 Bacteria 3922
152 Ga0501068_0009883 3300049584 Bacteria 5345
153 Ga0501068_0016294 3300049584 Bacteria 4283
154 Ga0501068_0163999 3300049584 Bacteria 1401
155 Ga0501069_0000616 3300049585 Bacteria 16450
156 Ga0501069_0018993 3300049585 Bacteria 3712
157 Ga0501069_0019717 3300049585 Bacteria 3649
158 Ga0501070_0000149 3300049586 Bacteria 64277
159 Ga0501070_0002552 3300049586 Bacteria 15945
160 Ga0501070_0013356 3300049586 Bacteria 6926
161 Ga0501070_0123649 3300049586 Bacteria 2138
162 Ga0501070_0253108 3300049586 Bacteria 1440
163 Ga0501071_0005422 3300049587 Bacteria 8197
164 Ga0501073_0013987 3300049589 Bacteria 5832
165 Ga0501073_0078298 3300049589 Bacteria 2300
166 Ga0501073_0138560 3300049589 Bacteria 1686
167 Ga0501073_0275980 3300049589 Bacteria 1160
168 Ga0501074_0000065 3300049590 Bacteria 50594
169 Ga0501074_0012115 3300049590 Bacteria 6268
170 Ga0501074_0187104 3300049590 Bacteria 1476
171 Ga0501076_0577504 3300049592 Bacteria 927
172 Ga0501079_0176565 3300049741 Bacteria 1666
173 Ga0501080_0000770 3300049742 Bacteria 26033
174 Ga0501080_0005558 3300049742 Bacteria 11259
175 Ga0501080_0007297 3300049742 Bacteria 9969
176 Ga0501080_0055021 3300049742 Bacteria 3706
177 Ga0501080_0324264 3300049742 Bacteria 1394
178 Ga0501080_0602340 3300049742 Bacteria 975
179 Ga0501083_0004248 3300049744 Bacteria 10084
180 Ga0501083_0043125 3300049744 Bacteria 3057
181 Ga0501083_0049436 3300049744 Bacteria 2834
182 Ga0501035_0000061 3300049822 Bacteria 131658
183 Ga0501035_0000105 3300049822 Bacteria 104877
184 Ga0501035_0000752 3300049822 Bacteria 34903
185 Ga0501035_0000986 3300049822 Bacteria 30120
186 Ga0501035_0002911 3300049822 Bacteria 16476
187 Ga0501035_0004909 3300049822 Bacteria 12691
188 Ga0501035_0005554 3300049822 Bacteria 11916
189 Ga0501035_0186461 3300049822 Bacteria 1785
190 Ga0501035_0289294 3300049822 Bacteria 1383
191 Ga0501044_0000517 3300049823 Bacteria 46967
192 Ga0501044_0001253 3300049823 Bacteria 30141
193 Ga0501044_0010118 3300049823 Bacteria 10249
194 Ga0501044_0011708 3300049823 Bacteria 9503
195 Ga0501044_0014289 3300049823 Bacteria 8572
196 Ga0501044_0039059 3300049823 Bacteria 4954
197 Ga0501044_0043345 3300049823 Bacteria 4674
198 Ga0501044_0186860 3300049823 Bacteria 2036
199 Ga0501045_0001489 3300049824 Bacteria 15588
200 nmdc:mga03n38_29452_c1 3300050490 Bacteria 1784
201 nmdc:mga00v17_66535_c1 3300050491 Bacteria 2225
202 nmdc:mga00v17_935_c1 3300050491 Bacteria 15690
203 nmdc:mga0yw44_134547_c1 3300050492 Bacteria 1603
204 nmdc:mga0yw44_44041_c1 3300050492 Bacteria 2668
205 nmdc:mga0yw44_63346_c1 3300050492 Bacteria 2273
206 nmdc:mga0sz30_16516_c1 3300050516 Bacteria 2933
207 Ga0500610_0013847 3300053079 Bacteria 3767
208 Ga0500618_032832 3300053125 Bacteria 1212
209 Ga0500568_0007027 3300053139 Bacteria 5568
210 Ga0500616_0004267 3300053153 Bacteria 10277
211 Ga0500622_0098606 3300053156 Bacteria 1442
212 Ga0500627_0008715 3300053158 Bacteria 3619
213 2958126929 2958122699 Bacteria 7280457
214 2509115670 2508501123 Bacteria 6283661
215 2509144037 2508501127 Bacteria 7037543
216 2509374055 2509276018 Bacteria 6910194
217 2509397199 2509276022 Bacteria 6200534
218 2509442864 2509276033 Bacteria 7180565
219 2510843625 2510461069 Bacteria 5505000
220 2511132961 2510917022 Bacteria 6504556
221 2511174269 2510917026 Bacteria 7046020
222 2511388361 2511231027 Bacteria 5013807
223 2512958262 2512875024 Bacteria 7195110
224 2513612161 2513237090 Bacteria 7096802
225 2514032585 2513237164 Bacteria 7563725
226 2514419880 2513237305 Bacteria 7293571
227 2514589836 2513237351 Bacteria 6968952
228 2515639234 2515154113 Bacteria 7807172
229 2535484967 2534681786 Bacteria 3308809
230 2561466246 2558860983 Bacteria 4133860
231 2585269488 2582581306 Bacteria 6450535
232 2585273041 2582581307 Bacteria 6597605
233 2585559660 2585427531 Bacteria 6992870
234 2585902343 2585427608 Bacteria 6544331
235 2585904962 2585427609 Bacteria 6667127
236 2585995353 2585427633 Bacteria 6413184
237 2585999907 2585427634 Bacteria 6455027
238 2587979922 2585428125 Bacteria 6662905
239 2588516173 2588253730 Bacteria 6881675
240 2597813624 2597489875 Bacteria 7010078
241 2599937638 2599185301 Bacteria 6161860
242 2600375464 2600254933 Bacteria 4750527
243 2643774327 2643221550 Bacteria 4619371
244 2643775159 2643221551 Bacteria 3750538
245 2643793605 2643221555 Bacteria 3749717
246 2643837660 2643221564 Bacteria 4193379
247 2643989449 2643221595 Bacteria 6565519
248 2644131037 2643221623 Bacteria 5239945
249 2644153971 2643221627 Bacteria 6761570
250 2644242927 2643221643 Bacteria 5749658
251 2688598943 2687453392 Bacteria 6880454
252 2694631879 2693429783 Bacteria 7019804
253 2694634702 2693429784 Bacteria 7241525
254 2723576034 2721755686 Bacteria 7343952
255 2739309022 2738543024 Bacteria 5603683
256 2753359596 2751185800 Bacteria 5467370
257 2756677430 2756170246 Bacteria 7451806
258 2757572527 2757320392 Bacteria 3737298
259 2758641858 2758568016 Bacteria 5645291
260 2765465510 2765235802 Bacteria 5618596
261 2770195535 2767802442 Bacteria 5747986
262 2776271600 2775506902 Bacteria 6208009
263 2776279887 2775506904 Bacteria 5954060
264 2792751739 2791355123 Bacteria 8049106
265 2793316327 2791355259 Bacteria 7254731
266 2837653668 2837651117 Bacteria 3772164
267 2837680445 2837678835 Bacteria 5252418
268 2839995618 2839993093 Bacteria 5512535
269 2841740487 2841734538 Bacteria 6784580
270 2842872937 2842871566 Bacteria 4827117
271 2844006834 2844002411 Bacteria 7168230
272 2844014294 2844009547 Bacteria 6728125
273 2847670764 2847670302 Bacteria 6165597
274 2854901759 2854896431 Bacteria 5869725
275 2854912187 2854911287 Bacteria 5582813
276 2854919378 2854916844 Bacteria 5725939
277 2856316220 2856314179 Bacteria 6477897
278 2856324999 2856320880 Bacteria 7263508
279 2856332944 2856328259 Bacteria 6528202
280 2856336295 2856334872 Bacteria 7037011
281 2856345867 2856342000 Bacteria 7176905
282 2856352533 2856349417 Bacteria 6230045
283 2856363333 2856356410 Bacteria 6297484
284 2856367151 2856364286 Bacteria 6939991
285 2857355552 2857349434 Bacteria 7926032
286 2857371637 2857367948 Bacteria 6965560
287 2869166423 2869162929 Bacteria 6399702
288 2869255277 2869249662 Bacteria 6868783
289 2869263784 2869256925 Bacteria 6981691
290 2869275630 2869271264 Bacteria 6908218
291 2869280944 2869278585 Bacteria 7077053
292 2869287520 2869285874 Bacteria 6901219
293 2871431047 2871429161 Bacteria 6547891
294 2871436190 2871435913 Bacteria 6880295
295 2871448821 2871444079 Bacteria 6423508
296 2871455109 2871451962 Bacteria 7336357
297 2871465184 2871459585 Bacteria 6866887
298 2871471061 2871466892 Bacteria 6923287
299 2871481027 2871474448 Bacteria 6806570
300 2871495285 2871488783 Bacteria 6929816
301 2871500425 2871495908 Bacteria 6935695
302 2874115615 2874109183 Bacteria 6517025
303 2874125674 2874123672 Bacteria 7238285
304 2874133831 2874131515 Bacteria 6820270
305 2874141388 2874139085 Bacteria 7021506
306 2874150216 2874146452 Bacteria 7533118
307 2874157286 2874155637 Bacteria 6724144
308 2874163731 2874162495 Bacteria 6174670
309 2874173154 2874168670 Bacteria 8062617
310 2876368124 2876363079 Bacteria 6544991
311 2876371360 2876369609 Bacteria 6807521
312 2876385389 2876377896 Bacteria 6565995
313 2876386096 2876386047 Bacteria 6698674
314 2876395298 2876392853 Bacteria 6660880
315 2876400255 2876399893 Bacteria 6927900
316 2876411348 2876406927 Bacteria 6191900
317 2876415669 2876413966 Bacteria 6831344
318 2878041544 2878035449 Bacteria 6555736
319 2878734603 2878730984 Bacteria 6380721
320 2878743117 2878738818 Bacteria 7136951
321 2878747668 2878745973 Bacteria 6867388
322 2878758048 2878753008 Bacteria 6922523
323 2878764514 2878760144 Bacteria 6823465
324 2878771615 2878767105 Bacteria 6898628
325 2878777636 2878774303 Bacteria 6108671
326 2878785395 2878781027 Bacteria 6834456
327 2878794493 2878788777 Bacteria 6567085
328 2881152516 2881147464 Bacteria 7779814
329 2881155946 2881155292 Bacteria 6461656
330 2881161826 2881161766 Bacteria 7127907
331 2881852702 2881845957 Bacteria 6611900
332 2881865139 2881861095 Bacteria 7128710
333 2882633030 2882632389 Bacteria 8154593
334 2882914954 2882912400 Bacteria 6801539
335 2885310713 2885305155 Bacteria 7348390
336 2885317478 2885312484 Bacteria 6415165
337 2885323973 2885318864 Bacteria 6729568
338 2885342348 2885334103 Bacteria 7216818
339 2888347904 2888343758 Bacteria 6611049
340 2889011968 2889010040 Bacteria 6749192
341 2889793677 2889790730 Bacteria 5689708
342 2889919525 2889914905 Bacteria 5702301
343 2891377292 2891373044 Bacteria 5202277
344 2894656547 2894652903 Bacteria 4587256
345 2894819944 2894817345 Bacteria 4892941
346 2899807829 2899803654 Bacteria 5577784
347 2903452144 2903448605 Bacteria 7357801
348 2903501569 2903492973 Bacteria 13473544
349 2903502052 2903492973 Bacteria 13473544
350 2903527120 2903521522 Bacteria 6525694
351 2903533347 2903528002 Bacteria 6586099
352 2903545238 2903540706 Bacteria 7062119
353 2904581633 2904578770 Bacteria 5302906
354 2904661928 2904659560 Bacteria 6685615
355 2906310060 2906308376 Bacteria 6841989
356 2906322933 2906321335 Bacteria 6579571
357 2906361115 2906354277 Bacteria 6991324
358 2906368966 2906363423 Bacteria 6856682
359 2906375705 2906370794 Bacteria 6881062
360 2906383823 2906378014 Bacteria 6911440
361 2906395409 2906393657 Bacteria 6790866
362 2906404234 2906401398 Bacteria 6693206
363 2906411741 2906408224 Bacteria 6162342
364 2906416357 2906414383 Bacteria 6580790
365 2906434260 2906427513 Bacteria 6375796
366 2915652985 2915650412 Bacteria 4288180
367 2919122885 2919119836 Bacteria 5208557
368 2919169128 2919166419 Bacteria 4952238
369 2919171164 2919171160 Bacteria 6499771
370 2922154914 2922151315 Bacteria 6902399
371 2922159670 2922158528 Bacteria 6573167
372 2922172922 2922172374 Bacteria 6167644
373 2922185451 2922178524 Bacteria 6025201
374 2924712699 2924710171 Bacteria 6752351
375 2924731023 2924726620 Bacteria 6271473
376 2924736100 2924733363 Bacteria 7574837
377 2924746673 2924741084 Bacteria 6661321
378 2924751000 2924748358 Bacteria 6154725
379 2924754869 2924754689 Bacteria 6774424
380 2924765697 2924762789 Bacteria 6561353
381 2924780916 2924776078 Bacteria 7492003
382 2924784761 2924784321 Bacteria 7416538
383 2928524386 2928521798 Bacteria 4960112
384 2929140745 2929138655 Bacteria 5810547
385 2937813359 2937813078 Bacteria 7783518
386 2937826606 2937822353 Bacteria 7290551
387 2937839957 2937836603 Bacteria 6811263
388 2937845765 2937843397 Bacteria 5256375
389 2937854503 2937848649 Bacteria 6983481
390 2937864807 2937861824 Bacteria 6660327
391 2937877019 2937868953 Bacteria 6639878
392 2937879457 2937877337 Bacteria 7246526
393 2937895342 2937891427 Bacteria 6357007
394 2937974902 2937972304 Bacteria 7532020
395 2937986361 2937980651 Bacteria 6517427
396 2937999087 2937994558 Bacteria 7036190
397 2954015337 2954011201 Bacteria 4762601
398 2958036907 2958034702 Bacteria 6989922
399 2958050529 2958041894 Bacteria 13082850
400 2958053835 2958041894 Bacteria 13082850
401 2958086632 2958084443 Bacteria 7312792
402 2958102060 2958100919 Bacteria 6800575
403 2958114235 2958108152 Bacteria 6681128
404 2958122460 2958115193 Bacteria 6923548
405 2958131923 2958130278 Bacteria 6897202
406 2958149186 2958144490 Bacteria 6677056
407 2958162840 2958158011 Bacteria 6058449
408 2958169561 2958165035 Bacteria 6906348
409 2958181726 2958179912 Bacteria 6874908
410 2961079569 2961077736 Bacteria 7079850
411 2961117082 2961114664 Bacteria 6680456
412 2961127876 2961127735 Bacteria 7196641
413 2961143634 2961136820 Bacteria 6775228
414 2961168021 2961163497 Bacteria 6901077
415 2961174678 2961170736 Bacteria 7072258
416 2961188722 2961183825 Bacteria 6688536
417 2963648697 2963644680 Bacteria 6530403
418 2965022840 2965018300 Bacteria 6883036
419 2965027377 2965025482 Bacteria 6532201
420 2965037713 2965032056 Bacteria 6887443
421 2965044179 2965040258 Bacteria 6855979
422 2965051086 2965047637 Bacteria 6623551
423 2965066712 2965062239 Bacteria 7412989
424 2965092828 2965089291 Bacteria 6866420
425 2965109572 2965102966 Bacteria 6800987
426 2968000613 2967996073 Bacteria 6787468
427 2968010014 2968003550 Bacteria 6929263
428 2968019262 2968016561 Bacteria 7022047
429 2968083924 2968083720 Bacteria 7351627
430 2968092540 2968091066 Bacteria 6052692
431 2968101691 2968097103 Bacteria 6107094
432 2968112990 2968110612 Bacteria 6814636
433 2968123845 2968117919 Bacteria 6536078
434 2968128730 2968128360 Bacteria 6270294
435 2968139538 2968138860 Bacteria 6605449
436 2968176421 2968171901 Bacteria 6894245
437 2970472406 2970469710 Bacteria 6969209
438 2970490946 2970489779 Bacteria 6517260
439 2970507264 2970503327 Bacteria 7099517
440 2970513868 2970510686 Bacteria 7006402
441 2970529978 2970524798 Bacteria 6840927
442 2970547733 2970540015 Bacteria 6977556
443 2970548334 2970547951 Bacteria 6931819
444 2970559360 2970554993 Bacteria 6814252
445 2970595548 2970593180 Bacteria 7073582
446 2970621718 2970619444 Bacteria 6986144
447 2977828878 2977821940 Bacteria 6906439
448 2977845359 2977843712 Bacteria 6753583
449 2977854387 2977851361 Bacteria 6694324
450 2977862240 2977858184 Bacteria 6215359
451 2977866633 2977864932 Bacteria 7534097
452 2977879580 2977872689 Bacteria 7270173
453 2977905273 2977898635 Bacteria 6675551
454 2977910798 2977907340 Bacteria 6577984
455 2977919145 2977915119 Bacteria 6829656
456 2977924818 2977922695 Bacteria 6956781
457 2977941914 2977935797 Bacteria 6252826
458 2977946890 2977942078 Bacteria 7570577
459 2977953386 2977950692 Bacteria 6893264
460 2977960287 2977957713 Bacteria 6877875
461 2977988722 2977986579 Bacteria 6581278
462 2979716979 2979710463 Bacteria 6785254
463 2979765782 2979764755 Bacteria 6610066
464 2979775938 2979772303 Bacteria 6618277
465 2979783102 2979779861 Bacteria 6219781
466 2979799371 2979793036 Bacteria 6808957
467 2979812460 2979808191 Bacteria 7179355
468 2987640685 2987636660 Bacteria 8088555
469 2987648299 2987645492 Bacteria 6117018
470 2987658259 2987652177 Bacteria 6969023
471 2987664035 2987659509 Bacteria 6966464
472 2987668566 2987666974 Bacteria 6509233
473 2987677139 2987673487 Bacteria 6884027
474 2989772388 2989771324 Bacteria 5605128
475 2995397225 2995392953 Bacteria 4539380
476 2996310928 2996310559 Bacteria 6357320
477 2996347132 2996341866 Bacteria 6643098
478 2996351277 2996348954 Bacteria 7239054
479 2996390735 2996386984 Bacteria 6978667
480 3000136134 3000135777 Bacteria 6891109
481 3002143975 3002141150 Bacteria 5254435
482 3003932974 3003930520 Bacteria 5667563
483 3004170229 3004167301 Bacteria 8330599
484 3004193090 3004188549 Bacteria 6952365
485 3004208882 3004203850 Bacteria 7307914
486 3004213068 3004211236 Bacteria 7417683
487 3004222169 3004218560 Bacteria 7421728
488 3004234072 3004232784 Bacteria 6662140
489 3004247031 3004239961 Bacteria 6892290
490 3004275054 3004268573 Bacteria 7043476
491 3004277975 3004275668 Bacteria 7114440
492 3004291378 3004289098 Bacteria 6135450
493 3004340141 3004334049 Bacteria 8449246
494 3005446957 3005445848 Bacteria 6906074
495 649873461 649633066 Bacteria 6690028
496 8002285892 8002285264 Bacteria 6717907
497 8004304510 8004300914 Bacteria 6132239
498 8004363811 8004361976 Bacteria 6858373
499 8004379560 8004374579 Bacteria 6898112
500 8004390259 8004387939 Bacteria 7049250
501 8004395654 8004395343 Bacteria 6620908
502 8004451747 8004445564 Bacteria 6322258
503 8004639560 8004633249 Bacteria 6723080
504 8004643070 8004640170 Bacteria 6723001
505 8004714420 8004703790 Bacteria 8006957
506 8004716322 8004714634 Bacteria 6776161
507 8004731755 8004727605 Bacteria 6643904
508 8005304810 8005301065 Bacteria 6614431
509 8005659758 8005658619 Bacteria 4500593
510 8045865539 8045864390 Bacteria 5043873
511 8055432877 8055431914 Bacteria 4551896
512 8055622040 8055617313 Bacteria 7548464
513 JGI25158J39367_1000152
514 JGI25157J39369_1001570
515 Ga0055542_1001709
516 Ga0055526_1032196
517 Ga0055536_1006498
518 Ga0055531_10009806
519 Ga0055531_10010071
520 Ga0070658_10188567
521 Ga0070668_100171319
522 Ga0070663_100037010
523 Ga0068853_100371051
524 Ga0070665_100361587
525 Ga0068855_100289433
526 Ga0081539_10003601
527 Ga0075365_10150783
528 Ga0075365_10213752
529 Ga0075368_10090469
530 Ga0075368_10156401
531 Ga0075364_10010992
532 Ga0075364_10092954
533 Ga0075362_10069251
534 Ga0075367_10250659
535 Ga0075369_10055176
536 Ga0075366_10104644
537 Ga0105240_10469410
538 Ga0123342_1034447
539 Ga0105239_10437077
540 Ga0157369_10039473
541 Ga0157369_10068649
542 Ga0182005_1043258
543 Ga0209026_1000002
544 Ga0209148_1000038
545 Ga0209759_1000897
546 Ga0209129_1005525
547 Ga0209233_1000188
548 Ga0209455_1000068
549 Ga0209025_1002031
550 Ga0209758_1000889
551 Ga0209758_1042308
552 Ga0209050_1012220
553 Ga0209051_1003231
554 Ga0209257_1001432
555 Ga0207705_10214229
556 Ga0207657_10282944
557 Ga0207694_10151242
558 Ga0207694_10320690
559 Ga0207639_10058847
560 Ga0207639_10168692
561 Ga0207678_10013361
562 Ga0207702_10222362
563 Ga0207674_10216171
564 Ga0316582_0017333
565 Ga0395899_0000073
566 Ga0395899_0020087
567 Ga0395900_0000027
568 Ga0395900_0029856
569 Ga0395900_0092119
570 Ga0395900_0239615
571 Ga0395898_0000043
572 Ga0395898_0070910
573 Ga0395898_0203152
574 Ga0395898_0388991
575 Ga0395898_0465334
576 Ga0395905_0000032
577 Ga0395905_0059079
578 Ga0395905_0346084
579 Ga0395901_0000056
580 Ga0395901_0011424
581 Ga0395901_0269453
582 Ga0395901_0490270
583 Ga0466965_0038472
584 Ga0466970_0161975
585 Ga0466960_0056876
586 Ga0495638_0063946
587 Ga0495638_0091660
588 Ga0495606_0091987
589 Ga0495643_0024216
590 Ga0495597_0057824
591 Ga0495625_0106288
592 Ga0495625_0212348
593 Ga0496112_0282715
594 Ga0496117_0012593
595 Ga0496117_0024480
596 Ga0496118_0014301
597 Ga0496118_0104503
598 Ga0496118_0126159
599 Ga0496119_0014875
600 Ga0496119_0059506
601 Ga0496120_0011851
602 Ga0496120_0029862
603 Ga0496120_0075927
604 Ga0496120_0118525
605 Ga0496121_0041522
606 Ga0496122_0002761
607 Ga0496122_0006681
608 Ga0496123_0002214
609 Ga0496123_0036614
610 Ga0496123_0049707
611 Ga0496124_0013753
612 Ga0496124_0018773
613 Ga0496124_0340995
614 Ga0496125_0000039
615 Ga0496125_0006026
616 Ga0496126_0002949
617 Ga0496126_0026256
618 Ga0496126_0149540
619 Ga0501031_0079215
620 Ga0501031_0094350
621 Ga0501031_0100470
622 Ga0501032_0000133
623 Ga0501032_0000524
624 Ga0501032_0125432
625 Ga0501033_0000121
626 Ga0501033_0000732
627 Ga0501033_0002396
628 Ga0501033_0002920
629 Ga0501033_0212215
630 Ga0501033_0253358
631 Ga0501034_0000064
632 Ga0501034_0001550
633 Ga0501034_0008308
634 Ga0501034_0021366
635 Ga0501034_0175528
636 Ga0501036_0000084
637 Ga0501036_0000414
638 Ga0501037_0000148
639 Ga0501037_0000509
640 Ga0501037_0000596
641 Ga0501038_0000443
642 Ga0501038_0000684
643 Ga0501038_0056794
644 Ga0501038_0059254
645 Ga0501038_0231571
646 Ga0501039_0000103
647 Ga0501039_0000437
648 Ga0501040_0013017
649 Ga0501043_0000029
650 Ga0501043_0003432
651 Ga0501043_0004546
652 Ga0501043_0262910
653 Ga0501043_0311179
654 Ga0501046_0013687
655 Ga0501046_0208268
656 Ga0501047_0028325
657 Ga0501047_0029100
658 Ga0501047_0034333
659 Ga0501047_0091257
660 Ga0501047_0222194
661 Ga0501047_0374162
662 Ga0501048_0001718
663 Ga0501067_0017914
664 Ga0501068_0009883
665 Ga0501068_0016294
666 Ga0501068_0163999
667 Ga0501069_0000616
668 Ga0501069_0018993
669 Ga0501069_0019717
670 Ga0501070_0000149
671 Ga0501070_0002552
672 Ga0501070_0013356
673 Ga0501070_0123649
674 Ga0501070_0253108
675 Ga0501071_0005422
676 Ga0501073_0013987
677 Ga0501073_0078298
678 Ga0501073_0138560
679 Ga0501073_0275980
680 Ga0501074_0000065
681 Ga0501074_0012115
682 Ga0501074_0187104
683 Ga0501076_0577504
684 Ga0501079_0176565
685 Ga0501080_0000770
686 Ga0501080_0005558
687 Ga0501080_0007297
688 Ga0501080_0055021
689 Ga0501080_0324264
690 Ga0501080_0602340
691 Ga0501083_0004248
692 Ga0501083_0043125
693 Ga0501083_0049436
694 Ga0501035_0000061
695 Ga0501035_0000105
696 Ga0501035_0000752
697 Ga0501035_0000986
698 Ga0501035_0002911
699 Ga0501035_0004909
700 Ga0501035_0005554
701 Ga0501035_0186461
702 Ga0501035_0289294
703 Ga0501044_0000517
704 Ga0501044_0001253
705 Ga0501044_0010118
706 Ga0501044_0011708
707 Ga0501044_0014289
708 Ga0501044_0039059
709 Ga0501044_0043345
710 Ga0501044_0186860
711 Ga0501045_0001489
712 nmdc:mga03n38_29452_c1
713 nmdc:mga00v17_66535_c1
714 nmdc:mga00v17_935_c1
715 nmdc:mga0yw44_134547_c1
716 nmdc:mga0yw44_44041_c1
717 nmdc:mga0yw44_63346_c1
718 nmdc:mga0sz30_16516_c1
719 Ga0500610_0013847
720 Ga0500618_032832
721 Ga0500568_0007027
722 Ga0500616_0004267
723 Ga0500622_0098606
724 Ga0500627_0008715
725 2958126929
726 2509115670
727 2509144037
728 2509374055
729 2509397199
730 2509442864
731 2510843625
732 2511132961
733 2511174269
734 2511388361
735 2512958262
736 2513612161
737 2514032585
738 2514419880
739 2514589836
740 2515639234
741 2535484967
742 2561466246
743 2585269488
744 2585273041
745 2585559660
746 2585902343
747 2585904962
748 2585995353
749 2585999907
750 2587979922
751 2588516173
752 2597813624
753 2599937638
754 2600375464
755 2643774327
756 2643775159
757 2643793605
758 2643837660
759 2643989449
760 2644131037
761 2644153971
762 2644242927
763 2688598943
764 2694631879
765 2694634702
766 2723576034
767 2739309022
768 2753359596
769 2756677430
770 2757572527
771 2758641858
772 2765465510
773 2770195535
774 2776271600
775 2776279887
776 2792751739
777 2793316327
778 2837653668
779 2837680445
780 2839995618
781 2841740487
782 2842872937
783 2844006834
784 2844014294
785 2847670764
786 2854901759
787 2854912187
788 2854919378
789 2856316220
790 2856324999
791 2856332944
792 2856336295
793 2856345867
794 2856352533
795 2856363333
796 2856367151
797 2857355552
798 2857371637
799 2869166423
800 2869255277
801 2869263784
802 2869275630
803 2869280944
804 2869287520
805 2871431047
806 2871436190
807 2871448821
808 2871455109
809 2871465184
810 2871471061
811 2871481027
812 2871495285
813 2871500425
814 2874115615
815 2874125674
816 2874133831
817 2874141388
818 2874150216
819 2874157286
820 2874163731
821 2874173154
822 2876368124
823 2876371360
824 2876385389
825 2876386096
826 2876395298
827 2876400255
828 2876411348
829 2876415669
830 2878041544
831 2878734603
832 2878743117
833 2878747668
834 2878758048
835 2878764514
836 2878771615
837 2878777636
838 2878785395
839 2878794493
840 2881152516
841 2881155946
842 2881161826
843 2881852702
844 2881865139
845 2882633030
846 2882914954
847 2885310713
848 2885317478
849 2885323973
850 2885342348
851 2888347904
852 2889011968
853 2889793677
854 2889919525
855 2891377292
856 2894656547
857 2894819944
858 2899807829
859 2903452144
860 2903501569
861 2903502052
862 2903527120
863 2903533347
864 2903545238
865 2904581633
866 2904661928
867 2906310060
868 2906322933
869 2906361115
870 2906368966
871 2906375705
872 2906383823
873 2906395409
874 2906404234
875 2906411741
876 2906416357
877 2906434260
878 2915652985
879 2919122885
880 2919169128
881 2919171164
882 2922154914
883 2922159670
884 2922172922
885 2922185451
886 2924712699
887 2924731023
888 2924736100
889 2924746673
890 2924751000
891 2924754869
892 2924765697
893 2924780916
894 2924784761
895 2928524386
896 2929140745
897 2937813359
898 2937826606
899 2937839957
900 2937845765
901 2937854503
902 2937864807
903 2937877019
904 2937879457
905 2937895342
906 2937974902
907 2937986361
908 2937999087
909 2954015337
910 2958036907
911 2958050529
912 2958053835
913 2958086632
914 2958102060
915 2958114235
916 2958122460
917 2958131923
918 2958149186
919 2958162840
920 2958169561
921 2958181726
922 2961079569
923 2961117082
924 2961127876
925 2961143634
926 2961168021
927 2961174678
928 2961188722
929 2963648697
930 2965022840
931 2965027377
932 2965037713
933 2965044179
934 2965051086
935 2965066712
936 2965092828
937 2965109572
938 2968000613
939 2968010014
940 2968019262
941 2968083924
942 2968092540
943 2968101691
944 2968112990
945 2968123845
946 2968128730
947 2968139538
948 2968176421
949 2970472406
950 2970490946
951 2970507264
952 2970513868
953 2970529978
954 2970547733
955 2970548334
956 2970559360
957 2970595548
958 2970621718
959 2977828878
960 2977845359
961 2977854387
962 2977862240
963 2977866633
964 2977879580
965 2977905273
966 2977910798
967 2977919145
968 2977924818
969 2977941914
970 2977946890
971 2977953386
972 2977960287
973 2977988722
974 2979716979
975 2979765782
976 2979775938
977 2979783102
978 2979799371
979 2979812460
980 2987640685
981 2987648299
982 2987658259
983 2987664035
984 2987668566
985 2987677139
986 2989772388
987 2995397225
988 2996310928
989 2996347132
990 2996351277
991 2996390735
992 3000136134
993 3002143975
994 3003932974
995 3004170229
996 3004193090
997 3004208882
998 3004213068
999 3004222169
1000 3004234072
1001 3004247031
1002 3004275054
1003 3004277975
1004 3004291378
1005 3004340141
1006 3005446957
1007 649873461
1008 8002285892
1009 8004304510
1010 8004363811
1011 8004379560
1012 8004390259
1013 8004395654
1014 8004451747
1015 8004639560
1016 8004643070
1017 8004714420
1018 8004716322
1019 8004731755
1020 8005304810
1021 8005659758
1022 8045865539
1023 8055432877
1024 8055622040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

188

329

0.95

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

105

178

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9307 146 292
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8859 146 295
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.8662 62 291
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8591 146 295
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8583 148 295
ID Description Score Start End Superfamily
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9327 147 289 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9305 142 296 3.40.1280.10
1gz0F02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9138 140 292 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9053 138 294 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9008 145 291 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A3S1N074-F1-model_v4 RNA methyltransferase 0.9642 73 295 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A4Q6F537-F1-model_v4 deleted 0.9601 204 292
AF-A0A537QY98-F1-model_v4 RNA methyltransferase 0.9599 215 295 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A177QDK4-F1-model_v4 RNA 2-O ribose methyltransferase substrate binding domain-containing protein 0.9543 60 293 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-K2BTX2-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9476 173 289 GO:0003723
GO:0005829
GO:0070039

Map