F457512

General Info

Members Datasets Scaffolds Average Seq Length
513 230 512 358

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10098520|rootH2_100985204
Length 382
Sequence LKTTLANLDTIEKTAETGTATTTRNATPSRPPRIAIAGVSGYAGGELARLLLRHPGMEGTSPMFLGRAGESHAETVNTLESLHPQLIGIGTNATHPIEPFHWDRLADAGTEILFLALPHEQSREWAPEAIARGIRVIDLSGAWRLYEESNRAVYKLHDADPEAAAKLQAEAVYGIPELHRAEIRTARLVANPGCYSTSIILALAPLVRAGVVELEAGIVCDAKSGVSGSGKAPTAKTHFMYAADNLSAYSVFGHRHTGELVEQLCLNADQIQFTPHLLPIPRGILSTMYLRLKEPANAQEIDGIFREFYKGSPLVRLHATPQLPQIQHVVRTNFCDLGFALRTDGKRLIVVSCLDNLLKGAAGQAVQNMNLMCGWKEEEGLL

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 1.95
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10017637 3300003320 Bacteria 3141
2 rootH2_10027635 3300003320 Bacteria 3395
3 rootH2_10038072 3300003320 Bacteria 7955
4 rootH2_10052867 3300003320 Bacteria 2629
5 rootH2_10098140 3300003320 Bacteria 4458
6 rootH2_10098520 3300003320 Bacteria 3931
7 rootH2_10161785 3300003320 Bacteria 1865
8 Ga0070658_10011270 3300005327 Bacteria 7166
9 Ga0070658_10034607 3300005327 Bacteria 4064
10 Ga0070676_10031391 3300005328 Bacteria 3035
11 Ga0070683_100000792 3300005329 Bacteria 23321
12 Ga0070683_100003479 3300005329 Bacteria 12804
13 Ga0070683_100012617 3300005329 Bacteria 7346
14 Ga0070683_100018257 3300005329 Bacteria 6209
15 Ga0070683_100035550 3300005329 Bacteria 4554
16 Ga0070683_100048999 3300005329 Unclassified 3906
17 Ga0070683_100069401 3300005329 Bacteria 3286
18 Ga0070670_100027205 3300005331 Bacteria 4920
19 Ga0070670_100071556 3300005331 Unclassified 2977
20 Ga0068869_100006994 3300005334 Bacteria 7184
21 Ga0068869_100058184 3300005334 Bacteria 2825
22 Ga0070666_10140881 3300005335 Unclassified 1679
23 Ga0070680_100036892 3300005336 Bacteria 3949
24 Ga0070680_100107218 3300005336 Bacteria 2323
25 Ga0068868_100078509 3300005338 Bacteria 2643
26 Ga0070660_100007166 3300005339 Bacteria 7755
27 Ga0070660_100036356 3300005339 Bacteria 3730
28 Ga0070660_100043549 3300005339 Bacteria 3431
29 Ga0070660_100122438 3300005339 Bacteria 2076
30 Ga0070661_100064112 3300005344 Bacteria 2700
31 Ga0070661_100093999 3300005344 Bacteria 2221
32 Ga0070661_100174428 3300005344 Bacteria 1634
33 Ga0070671_100000503 3300005355 Bacteria 27368
34 Ga0070671_100097864 3300005355 Bacteria 2461
35 Ga0070659_100003118 3300005366 Bacteria 11799
36 Ga0070667_100015426 3300005367 Bacteria 6317
37 Ga0070703_10015547 3300005406 Bacteria 2178
38 Ga0070709_10020114 3300005434 Unclassified 3869
39 Ga0070714_100015486 3300005435 Bacteria 6132
40 Ga0070713_100008019 3300005436 Bacteria 7465
41 Ga0070713_100036370 3300005436 Bacteria 3973
42 Ga0070713_100101208 3300005436 Unclassified 2496
43 Ga0070711_100049536 3300005439 Bacteria 2877
44 Ga0070708_100020640 3300005445 Bacteria 5560
45 Ga0070708_100021802 3300005445 Bacteria 5424
46 Ga0070678_100004919 3300005456 Bacteria 7645
47 Ga0070681_10000287 3300005458 Bacteria 40681
48 Ga0070681_10143057 3300005458 Bacteria 2321
49 Ga0070698_100022939 3300005471 Bacteria 6526
50 Ga0070699_100135889 3300005518 Bacteria 2169
51 Ga0070679_100000282 3300005530 Bacteria 42961
52 Ga0070679_100002632 3300005530 Bacteria 16329
53 Ga0070679_100034032 3300005530 Bacteria 5048
54 Ga0070679_100244327 3300005530 Bacteria 1752
55 Ga0070684_100003574 3300005535 Bacteria 11696
56 Ga0070684_100048524 3300005535 Bacteria 3683
57 Ga0070684_100157449 3300005535 Bacteria 2060
58 Ga0070697_100000776 3300005536 Bacteria 23935
59 Ga0068853_100000027 3300005539 Bacteria 127120
60 Ga0068853_100001150 3300005539 Bacteria 18766
61 Ga0068853_100002831 3300005539 Bacteria 13147
62 Ga0070693_100186954 3300005547 Bacteria 1337
63 Ga0070665_100009430 3300005548 Bacteria 9880
64 Ga0070665_100012032 3300005548 Bacteria 8730
65 Ga0068855_100002127 3300005563 Bacteria 24511
66 Ga0068855_100008987 3300005563 Bacteria 12071
67 Ga0068855_100009004 3300005563 Bacteria 12061
68 Ga0068855_100036783 3300005563 Bacteria 5825
69 Ga0068855_100040728 3300005563 Bacteria 5512
70 Ga0068855_100050722 3300005563 Bacteria 4889
71 Ga0068855_100081216 3300005563 Bacteria 3758
72 Ga0068855_100090474 3300005563 Bacteria 3532
73 Ga0068855_100119760 3300005563 Bacteria 3013
74 Ga0068855_100285405 3300005563 Bacteria 1832
75 Ga0068857_100001410 3300005577 Bacteria 18997
76 Ga0068857_100002473 3300005577 Bacteria 15104
77 Ga0068857_100137985 3300005577 Unclassified 2203
78 Ga0068854_100000021 3300005578 Bacteria 130648
79 Ga0068854_100060080 3300005578 Bacteria 2748
80 Ga0068854_100064972 3300005578 Bacteria 2652
81 Ga0068856_100014641 3300005614 Bacteria 7576
82 Ga0068856_100016361 3300005614 Bacteria 7176
83 Ga0068856_100023183 3300005614 Bacteria 6038
84 Ga0068856_100040932 3300005614 Bacteria 4552
85 Ga0068856_100074297 3300005614 Bacteria 3365
86 Ga0068856_100159838 3300005614 Unclassified 2263
87 Ga0068852_100000003 3300005616 Bacteria 246525
88 Ga0068852_100002237 3300005616 Bacteria 13272
89 Ga0068852_100005657 3300005616 Bacteria 8965
90 Ga0068852_100011835 3300005616 Bacteria 6592
91 Ga0068852_100044875 3300005616 Bacteria 3757
92 Ga0068864_100032385 3300005618 Bacteria 4442
93 Ga0068864_100199953 3300005618 Bacteria 1835
94 Ga0068851_10021869 3300005834 Bacteria 3109
95 Ga0068851_10040679 3300005834 Bacteria 2336
96 Ga0068851_10042026 3300005834 Unclassified 2300
97 Ga0068863_100001840 3300005841 Bacteria 21088
98 Ga0068863_100003044 3300005841 Bacteria 16567
99 Ga0068858_100033836 3300005842 Bacteria 4740
100 Ga0068858_100035030 3300005842 Bacteria 4656
101 Ga0068860_100002006 3300005843 Bacteria 21480
102 Ga0068860_100107923 3300005843 Bacteria 2660
103 Ga0068862_100008400 3300005844 Bacteria 8545
104 Ga0081540_1007495 3300005983 Bacteria 7769
105 Ga0070717_10000563 3300006028 Bacteria 23636
106 Ga0070716_100000610 3300006173 Bacteria 15125
107 Ga0097621_100026306 3300006237 Bacteria 4562
108 Ga0097621_100164934 3300006237 Unclassified 1907
109 Ga0068871_100002006 3300006358 Bacteria 13778
110 Ga0075435_100011449 3300007076 Bacteria 6528
111 Ga0099794_10010911 3300007265 Bacteria 3874
112 Ga0099794_10053312 3300007265 Bacteria 1950
113 Ga0099794_10102620 3300007265 Unclassified 1428
114 Ga0099795_10003256 3300007788 Bacteria 3995
115 Ga0105240_10000077 3300009093 Bacteria 197213
116 Ga0105240_10000114 3300009093 Bacteria 166405
117 Ga0105240_10001813 3300009093 Bacteria 35941
118 Ga0105240_10007394 3300009093 Bacteria 15970
119 Ga0105240_10009351 3300009093 Bacteria 13892
120 Ga0105240_10012755 3300009093 Bacteria 11583
121 Ga0105240_10022222 3300009093 Bacteria 8415
122 Ga0105240_10065279 3300009093 Bacteria 4519
123 Ga0105240_10083315 3300009093 Bacteria 3925
124 Ga0105240_10091300 3300009093 Bacteria 3721
125 Ga0105240_10099876 3300009093 Bacteria 3532
126 Ga0105240_10162328 3300009093 Bacteria 2653
127 Ga0105240_10246318 3300009093 Unclassified 2069
128 Ga0105240_10330295 3300009093 Unclassified 1735
129 Ga0105240_10528272 3300009093 Unclassified 1308
130 Ga0111539_10003011 3300009094 Bacteria 22347
131 Ga0105245_10005219 3300009098 Bacteria 11412
132 Ga0105245_10010024 3300009098 Bacteria 8250
133 Ga0105245_10048851 3300009098 Bacteria 3786
134 Ga0105247_10012196 3300009101 Bacteria 5165
135 Ga0105247_10074426 3300009101 Unclassified 2130
136 Ga0105241_10000437 3300009174 Bacteria 31386
137 Ga0105241_10003331 3300009174 Bacteria 11957
138 Ga0105241_10007832 3300009174 Bacteria 7854
139 Ga0105248_10000004 3300009177 Bacteria 695244
140 Ga0105248_10000432 3300009177 Bacteria 47503
141 Ga0105248_10022761 3300009177 Bacteria 6954
142 Ga0105237_10002257 3300009545 Bacteria 23982
143 Ga0105237_10010282 3300009545 Bacteria 9969
144 Ga0105237_10034550 3300009545 Bacteria 5119
145 Ga0105237_10035438 3300009545 Bacteria 5050
146 Ga0105238_10000446 3300009551 Bacteria 43281
147 Ga0105238_10002307 3300009551 Bacteria 19223
148 Ga0105238_10002444 3300009551 Bacteria 18639
149 Ga0105238_10015019 3300009551 Bacteria 7841
150 Ga0105238_10021176 3300009551 Bacteria 6627
151 Ga0105238_10026024 3300009551 Bacteria 5963
152 Ga0105238_10029569 3300009551 Bacteria 5581
153 Ga0105238_10074110 3300009551 Bacteria 3397
154 Ga0105238_10414108 3300009551 Bacteria 1342
155 Ga0105239_10002434 3300010375 Bacteria 23717
156 Ga0105239_10043282 3300010375 Bacteria 4935
157 Ga0105239_10053930 3300010375 Bacteria 4409
158 Ga0105239_10161947 3300010375 Bacteria 2500
159 Ga0105246_10015238 3300011119 Bacteria 4850
160 Ga0157373_10027352 3300013100 Unclassified 4114
161 Ga0157371_10205161 3300013102 Unclassified 1414
162 Ga0157370_10000001 3300013104 Bacteria 529517
163 Ga0157370_10022663 3300013104 Bacteria 6250
164 Ga0157370_10037579 3300013104 Bacteria 4693
165 Ga0157370_10045673 3300013104 Bacteria 4201
166 Ga0157370_10053619 3300013104 Bacteria 3845
167 Ga0157370_10076409 3300013104 Bacteria 3155
168 Ga0157369_10000066 3300013105 Bacteria 144815
169 Ga0157369_10003762 3300013105 Bacteria 18032
170 Ga0157369_10007441 3300013105 Bacteria 12610
171 Ga0157369_10008466 3300013105 Bacteria 11798
172 Ga0157369_10010517 3300013105 Bacteria 10532
173 Ga0157369_10012127 3300013105 Bacteria 9784
174 Ga0157369_10012725 3300013105 Bacteria 9542
175 Ga0157369_10014626 3300013105 Bacteria 8854
176 Ga0157369_10042417 3300013105 Bacteria 4963
177 Ga0157369_10059391 3300013105 Bacteria 4124
178 Ga0157369_10060457 3300013105 Bacteria 4086
179 Ga0157369_10091656 3300013105 Bacteria 3244
180 Ga0157369_10166023 3300013105 Bacteria 2328
181 Ga0157374_10025259 3300013296 Bacteria 5331
182 Ga0157374_10030708 3300013296 Bacteria 4881
183 Ga0157374_10045548 3300013296 Bacteria 4060
184 Ga0157374_10088042 3300013296 Bacteria 2957
185 Ga0157374_10128996 3300013296 Bacteria 2446
186 Ga0157374_10371242 3300013296 Unclassified 1424
187 Ga0157378_10003175 3300013297 Bacteria 14590
188 Ga0157378_10092907 3300013297 Bacteria 2746
189 Ga0157378_10117634 3300013297 Bacteria 2445
190 Ga0157378_10205735 3300013297 Unclassified 1864
191 Ga0157378_10210166 3300013297 Bacteria 1845
192 Ga0163162_10002114 3300013306 Bacteria 18662
193 Ga0163162_10013640 3300013306 Bacteria 7940
194 Ga0157372_10000038 3300013307 Bacteria 167357
195 Ga0157372_10000125 3300013307 Bacteria 82978
196 Ga0157372_10018813 3300013307 Bacteria 7432
197 Ga0157372_10026353 3300013307 Bacteria 6325
198 Ga0157372_10028416 3300013307 Bacteria 6102
199 Ga0157372_10049065 3300013307 Bacteria 4693
200 Ga0157372_10052812 3300013307 Bacteria 4527
201 Ga0157372_10088200 3300013307 Bacteria 3522
202 Ga0157372_10123935 3300013307 Unclassified 2971
203 Ga0157375_10001926 3300013308 Bacteria 17858
204 Ga0157375_10014912 3300013308 Bacteria 6948
205 Ga0157375_10038110 3300013308 Bacteria 4612
206 Ga0163163_10003247 3300014325 Bacteria 13786
207 Ga0163163_10016223 3300014325 Bacteria 6915
208 Ga0157379_10005672 3300014968 Bacteria 10732
209 Ga0157379_10009933 3300014968 Bacteria 8287
210 Ga0157379_10062411 3300014968 Bacteria 3333
211 Ga0157379_10219999 3300014968 Bacteria 1720
212 Ga0157379_10313617 3300014968 Bacteria 1431
213 Ga0157376_10007015 3300014969 Bacteria 7995
214 Ga0157376_10011852 3300014969 Bacteria 6445
215 Ga0157376_10093934 3300014969 Bacteria 2605
216 Ga0157376_10430061 3300014969 Bacteria 1283
217 Ga0209437_102581 3300025233 Bacteria 3477
218 Ga0209233_1000573 3300025261 Bacteria 19670
219 Ga0207697_10006406 3300025315 Bacteria 5329
220 Ga0207656_10080655 3300025321 Bacteria 1462
221 Ga0207710_10008656 3300025900 Bacteria 4291
222 Ga0207680_10028230 3300025903 Bacteria 3136
223 Ga0207647_10031764 3300025904 Bacteria 3396
224 Ga0207645_10026377 3300025907 Bacteria 3756
225 Ga0207705_10000171 3300025909 Bacteria 69439
226 Ga0207705_10004468 3300025909 Bacteria 10565
227 Ga0207705_10006166 3300025909 Bacteria 8917
228 Ga0207705_10009357 3300025909 Bacteria 7124
229 Ga0207705_10032229 3300025909 Bacteria 3744
230 Ga0207654_10000028 3300025911 Bacteria 125787
231 Ga0207654_10000799 3300025911 Bacteria 17331
232 Ga0207654_10017967 3300025911 Bacteria 3707
233 Ga0207654_10122010 3300025911 Unclassified 1638
234 Ga0207707_10001971 3300025912 Bacteria 18643
235 Ga0207707_10037860 3300025912 Bacteria 4214
236 Ga0207707_10126576 3300025912 Bacteria 2234
237 Ga0207695_10000026 3300025913 Bacteria 624558
238 Ga0207695_10000063 3300025913 Bacteria 349527
239 Ga0207695_10002403 3300025913 Bacteria 27739
240 Ga0207695_10002545 3300025913 Bacteria 26782
241 Ga0207695_10004318 3300025913 Bacteria 19473
242 Ga0207695_10008796 3300025913 Bacteria 12589
243 Ga0207695_10028006 3300025913 Bacteria 6260
244 Ga0207695_10038761 3300025913 Bacteria 5125
245 Ga0207695_10135709 3300025913 Bacteria 2414
246 Ga0207671_10000279 3300025914 Bacteria 76291
247 Ga0207671_10000526 3300025914 Bacteria 51619
248 Ga0207671_10124751 3300025914 Bacteria 1971
249 Ga0207660_10011517 3300025917 Bacteria 5761
250 Ga0207657_10002476 3300025919 Bacteria 19978
251 Ga0207657_10006402 3300025919 Bacteria 12218
252 Ga0207657_10027696 3300025919 Bacteria 5186
253 Ga0207657_10035979 3300025919 Bacteria 4435
254 Ga0207649_10069715 3300025920 Unclassified 2240
255 Ga0207649_10128687 3300025920 Bacteria 1717
256 Ga0207649_10131853 3300025920 Bacteria 1699
257 Ga0207649_10135711 3300025920 Unclassified 1677
258 Ga0207652_10005620 3300025921 Bacteria 10172
259 Ga0207652_10013635 3300025921 Bacteria 6571
260 Ga0207652_10039679 3300025921 Bacteria 3996
261 Ga0207652_10105041 3300025921 Bacteria 2499
262 Ga0207652_10131453 3300025921 Bacteria 2233
263 Ga0207652_10199212 3300025921 Bacteria 1802
264 Ga0207694_10000144 3300025924 Bacteria 74051
265 Ga0207694_10000346 3300025924 Bacteria 43815
266 Ga0207694_10017194 3300025924 Bacteria 5465
267 Ga0207694_10023538 3300025924 Bacteria 4675
268 Ga0207694_10035400 3300025924 Bacteria 3830
269 Ga0207694_10054154 3300025924 Bacteria 3112
270 Ga0207694_10373331 3300025924 Bacteria 1183
271 Ga0207650_10002471 3300025925 Bacteria 12856
272 Ga0207700_10021670 3300025928 Bacteria 4393
273 Ga0207700_10126563 3300025928 Bacteria 2080
274 Ga0207644_10001529 3300025931 Bacteria 14901
275 Ga0207644_10044588 3300025931 Bacteria 3151
276 Ga0207706_10002079 3300025933 Bacteria 19618
277 Ga0207665_10000034 3300025939 Bacteria 88735
278 Ga0207665_10003682 3300025939 Bacteria 10234
279 Ga0207691_10018719 3300025940 Bacteria 6560
280 Ga0207711_10000032 3300025941 Bacteria 199046
281 Ga0207711_10037558 3300025941 Bacteria 4115
282 Ga0207711_10047215 3300025941 Bacteria 3680
283 Ga0207711_10053010 3300025941 Bacteria 3478
284 Ga0207689_10000887 3300025942 Bacteria 28759
285 Ga0207661_10004714 3300025944 Bacteria 9549
286 Ga0207661_10036170 3300025944 Unclassified 3853
287 Ga0207667_10000123 3300025949 Bacteria 120422
288 Ga0207667_10001348 3300025949 Bacteria 30814
289 Ga0207667_10020339 3300025949 Bacteria 7387
290 Ga0207667_10027924 3300025949 Bacteria 6133
291 Ga0207667_10032147 3300025949 Bacteria 5657
292 Ga0207667_10091235 3300025949 Bacteria 3148
293 Ga0207667_10232254 3300025949 Bacteria 1888
294 Ga0207668_10050493 3300025972 Bacteria 2867
295 Ga0207640_10000007 3300025981 Bacteria 303287
296 Ga0207640_10045044 3300025981 Bacteria 2831
297 Ga0207640_10242759 3300025981 Unclassified 1393
298 Ga0207677_10005803 3300026023 Bacteria 6717
299 Ga0207703_10033416 3300026035 Bacteria 4078
300 Ga0207639_10000036 3300026041 Bacteria 148421
301 Ga0207639_10000530 3300026041 Bacteria 26266
302 Ga0207639_10007272 3300026041 Bacteria 7542
303 Ga0207678_10003636 3300026067 Bacteria 13858
304 Ga0207702_10001473 3300026078 Bacteria 23349
305 Ga0207702_10022339 3300026078 Bacteria 5244
306 Ga0207702_10031298 3300026078 Bacteria 4434
307 Ga0207641_10005283 3300026088 Bacteria 11034
308 Ga0207641_10018604 3300026088 Bacteria 5695
309 Ga0207641_10059533 3300026088 Bacteria 3253
310 Ga0207674_10000488 3300026116 Bacteria 52346
311 Ga0207674_10004578 3300026116 Bacteria 16604
312 Ga0207674_10005587 3300026116 Bacteria 14906
313 Ga0207674_10031853 3300026116 Bacteria 5535
314 Ga0207674_10039999 3300026116 Bacteria 4858
315 Ga0207698_10000016 3300026142 Bacteria 183355
316 Ga0207698_10000224 3300026142 Bacteria 35191
317 Ga0207698_10026520 3300026142 Bacteria 4100
318 Ga0207698_10031410 3300026142 Unclassified 3833
319 Ga0207698_10070608 3300026142 Bacteria 2768
320 Ga0207698_10320920 3300026142 Bacteria 1450
321 Ga0209588_1015948 3300027671 Bacteria 2315
322 Ga0209588_1018316 3300027671 Bacteria 2179
323 Ga0207428_10000834 3300027907 Bacteria 34716
324 Ga0268266_10005850 3300028379 Bacteria 11379
325 Ga0268266_10007181 3300028379 Bacteria 10089
326 Ga0268266_10343534 3300028379 Unclassified 1401
327 Ga0268266_10523017 3300028379 Bacteria 1134
328 Ga0268264_10002255 3300028381 Bacteria 17071
329 Ga0265318_10014355 3300028577 Bacteria 3327
330 Ga0265336_10004973 3300028666 Bacteria 4954
331 Ga0265336_10006882 3300028666 Bacteria 4072
332 Ga0265338_10004022 3300028800 Bacteria 20189
333 Ga0265338_10004888 3300028800 Bacteria 17850
334 Ga0265338_10015633 3300028800 Bacteria 8317
335 Ga0265338_10032498 3300028800 Bacteria 5088
336 Ga0265324_10061800 3300029957 Unclassified 1280
337 Ga0265760_10000016 3300031090 Bacteria 89697
338 Ga0265330_10000198 3300031235 Bacteria 46563
339 Ga0265330_10000456 3300031235 Bacteria 27248
340 Ga0265330_10001642 3300031235 Bacteria 12720
341 Ga0265330_10016391 3300031235 Bacteria 3420
342 Ga0265328_10000151 3300031239 Bacteria 32936
343 Ga0265328_10018297 3300031239 Bacteria 2704
344 Ga0265328_10024718 3300031239 Unclassified 2266
345 Ga0265320_10010509 3300031240 Bacteria 5511
346 Ga0265325_10000414 3300031241 Bacteria 30450
347 Ga0265325_10005283 3300031241 Bacteria 8006
348 Ga0265325_10027168 3300031241 Bacteria 3095
349 Ga0265325_10034215 3300031241 Bacteria 2705
350 Ga0265329_10016750 3300031242 Bacteria 2535
351 Ga0265329_10022825 3300031242 Bacteria 2089
352 Ga0265340_10017046 3300031247 Bacteria 3756
353 Ga0265340_10029716 3300031247 Unclassified 2745
354 Ga0265339_10000003 3300031249 Bacteria 305994
355 Ga0265339_10000118 3300031249 Bacteria 65006
356 Ga0265339_10002822 3300031249 Bacteria 12329
357 Ga0265339_10003521 3300031249 Bacteria 10938
358 Ga0265339_10038747 3300031249 Bacteria 2656
359 Ga0265331_10057713 3300031250 Bacteria 1840
360 Ga0265316_10000656 3300031344 Bacteria 38426
361 Ga0265316_10002683 3300031344 Bacteria 18331
362 Ga0265316_10008076 3300031344 Bacteria 9816
363 Ga0265316_10035653 3300031344 Bacteria 4029
364 Ga0265313_10000369 3300031595 Bacteria 48818
365 Ga0265313_10003433 3300031595 Bacteria 12821
366 Ga0265313_10043728 3300031595 Unclassified 2191
367 Ga0265314_10000064 3300031711 Bacteria 158787
368 Ga0265314_10001959 3300031711 Bacteria 21920
369 Ga0265314_10032530 3300031711 Bacteria 3835
370 Ga0265314_10047643 3300031711 Bacteria 3014
371 Ga0265342_10001297 3300031712 Bacteria 23461
372 Ga0265342_10001753 3300031712 Bacteria 19807
373 Ga0265342_10007944 3300031712 Bacteria 7693
374 Ga0265342_10026880 3300031712 Bacteria 3602
375 Ga0265342_10054849 3300031712 Bacteria 2367
376 Ga0265342_10057356 3300031712 Unclassified 2305
377 Ga0265342_10099829 3300031712 Unclassified 1655
378 Ga0265342_10107017 3300031712 Bacteria 1586
379 Ga0307510_10112878 3300033180 Bacteria 2453
380 Ga0373955_0044437 3300035172 Bacteria 2393
381 Ga0373924_0022076 3300035410 Bacteria 2486
382 Ga0373935_0259868 3300035692 Bacteria 1217
383 Ga0373937_0056327 3300036401 Bacteria 3610
384 Ga0373925_0007071 3300037068 Bacteria 8202
385 Ga0436363_1458381 3300039450 Bacteria 6582
386 Ga0439448_0009861 3300042005 Bacteria 2821
387 Ga0466961_0040753 3300044693 Bacteria 2977
388 Ga0466963_0001832 3300044694 Bacteria 11584
389 Ga0466959_0117593 3300045049 Bacteria 1892
390 Ga0466967_0036759 3300045976 Bacteria 4184
391 Ga0495592_0119548 3300046454 Bacteria 1855
392 Ga0495603_0026535 3300046455 Unclassified 3499
393 Ga0495629_0006935 3300046459 Bacteria 8356
394 Ga0495651_0004801 3300046462 Bacteria 10349
395 Ga0495651_0053270 3300046462 Bacteria 3116
396 Ga0495651_0197206 3300046462 Bacteria 1412
397 Ga0495653_0006329 3300046463 Bacteria 9715
398 Ga0495650_0000041 3300046471 Bacteria 363945
399 Ga0495650_0004908 3300046471 Bacteria 8938
400 Ga0495580_0004157 3300046472 Bacteria 12173
401 Ga0495580_0074326 3300046472 Bacteria 2372
402 Ga0495580_0198853 3300046472 Bacteria 1381
403 Ga0495582_0003149 3300046473 Bacteria 9258
404 Ga0495582_0018270 3300046473 Unclassified 3836
405 Ga0495639_0001419 3300046475 Bacteria 10707
406 Ga0495662_0000190 3300046476 Bacteria 25052
407 Ga0495664_0000299 3300046477 Bacteria 23707
408 Ga0495664_0133492 3300046477 Bacteria 1504
409 Ga0495585_0010167 3300046492 Bacteria 5618
410 Ga0495594_0000463 3300046499 Bacteria 20712
411 Ga0495594_0053788 3300046499 Bacteria 2218
412 Ga0495583_0009960 3300046506 Bacteria 5608
413 Ga0495606_0037780 3300046507 Bacteria 3275
414 Ga0495606_0086453 3300046507 Bacteria 1938
415 Ga0495608_0182333 3300046511 Unclassified 1328
416 Ga0495628_0026454 3300046516 Bacteria 4731
417 Ga0495644_0000349 3300046523 Bacteria 20904
418 Ga0495666_0005694 3300046526 Bacteria 6281
419 Ga0495642_0010787 3300046528 Bacteria 3500
420 Ga0495642_0040671 3300046528 Bacteria 1889
421 Ga0495652_0004544 3300046529 Bacteria 13240
422 Ga0495652_0027187 3300046529 Bacteria 5043
423 Ga0495652_0316391 3300046529 Bacteria 1129
424 Ga0495665_0000207 3300046531 Bacteria 30004
425 Ga0495640_0013799 3300046533 Bacteria 6137
426 Ga0495586_0000402 3300046535 Bacteria 26264
427 Ga0495587_0057424 3300046536 Bacteria 2288
428 Ga0495609_0020777 3300046538 Bacteria 3030
429 Ga0495645_0003029 3300046543 Bacteria 11372
430 Ga0495645_0024420 3300046543 Bacteria 4385
431 Ga0495645_0054812 3300046543 Bacteria 2896
432 Ga0495645_0055777 3300046543 Bacteria 2869
433 Ga0495633_0018701 3300046558 Bacteria 3516
434 Ga0495667_0002292 3300046559 Bacteria 12829
435 Ga0495668_0027433 3300046616 Bacteria 3227
436 Ga0495634_0001368 3300046642 Bacteria 22109
437 Ga0495625_0000429 3300046660 Bacteria 63350
438 Ga0495625_0011018 3300046660 Bacteria 7418
439 Ga0495625_0021360 3300046660 Bacteria 4986
440 Ga0495635_0000327 3300046663 Bacteria 30454
441 Ga0495588_0015041 3300046674 Bacteria 3717
442 Ga0495657_0086857 3300046675 Bacteria 2014
443 Ga0495623_0008684 3300046679 Bacteria 6595
444 Ga0495646_0000504 3300046680 Bacteria 20916
445 Ga0495658_0028305 3300046683 Bacteria 3024
446 Ga0495669_0005415 3300046684 Bacteria 5325
447 Ga0495613_0001165 3300046689 Bacteria 20067
448 Ga0495624_0036687 3300046690 Bacteria 3158
449 Ga0495649_0065013 3300046694 Bacteria 1958
450 Ga0495600_0000281 3300046809 Bacteria 27632
451 Ga0495600_0135631 3300046809 Bacteria 1599
452 Ga0495581_0000186 3300047315 Bacteria 28698
453 Ga0495581_0091765 3300047315 Bacteria 1762
454 Ga0495604_0000997 3300047317 Bacteria 23548
455 Ga0495674_0013938 3300047319 Bacteria 7541
456 Ga0495674_0043246 3300047319 Bacteria 4010
457 Ga0495672_0003429 3300047320 Bacteria 13589
458 Ga0495672_0076444 3300047320 Bacteria 1880
459 Ga0495680_0099254 3300047322 Bacteria 2171
460 Ga0495675_0000760 3300047444 Bacteria 20188
461 Ga0495677_0009816 3300047445 Bacteria 3528
462 Ga0495684_0016630 3300047471 Bacteria 5667
463 Ga0495684_0163588 3300047471 Bacteria 1659
464 Ga0495686_0000031 3300047472 Bacteria 350171
465 Ga0495686_0003102 3300047472 Bacteria 14686
466 Ga0495686_0003168 3300047472 Bacteria 14498
467 Ga0495686_0006279 3300047472 Bacteria 9142
468 Ga0495593_0027074 3300047673 Bacteria 3159
469 Ga0495614_0000114 3300048089 Bacteria 27689
470 Ga0496101_0062793 3300048904 Bacteria 2702
471 Ga0496102_0135201 3300048905 Bacteria 2310
472 Ga0496103_0113793 3300048906 Bacteria 1720
473 Ga0496104_0000160 3300048907 Bacteria 61329
474 Ga0496107_0168020 3300048910 Unclassified 1627
475 Ga0496112_0030870 3300048915 Bacteria 5192
476 Ga0496115_0039997 3300048918 Bacteria 3725
477 Ga0496115_0042121 3300048918 Bacteria 3637
478 Ga0496115_0088095 3300048918 Bacteria 2534
479 Ga0496115_0244129 3300048918 Bacteria 1480
480 Ga0496120_0090659 3300048923 Bacteria 1634
481 Ga0496126_0000005 3300048929 Bacteria 891906
482 Ga0496126_0001110 3300048929 Bacteria 45105
483 Ga0496126_0006253 3300048929 Bacteria 13310
484 Ga0495682_0020280 3300049460 Bacteria 2496
485 Ga0495682_0020453 3300049460 Bacteria 2485
486 Ga0501031_0008745 3300049568 Bacteria 6585
487 Ga0501032_0001060 3300049569 Bacteria 21986
488 Ga0501033_0005342 3300049570 Bacteria 10180
489 Ga0501034_0004644 3300049571 Bacteria 15206
490 Ga0501036_0057608 3300049572 Bacteria 3291
491 Ga0501038_0000072 3300049574 Bacteria 83742
492 Ga0501039_0023932 3300049575 Bacteria 4689
493 Ga0501043_0003848 3300049579 Bacteria 12338
494 Ga0501046_0002025 3300049580 Bacteria 19248
495 Ga0501047_0002667 3300049581 Bacteria 16982
496 Ga0501047_0247378 3300049581 Bacteria 1632
497 Ga0501068_0039701 3300049584 Bacteria 2823
498 Ga0501070_0088492 3300049586 Bacteria 2563
499 Ga0501070_0167423 3300049586 Bacteria 1811
500 Ga0501073_0027431 3300049589 Bacteria 4072
501 Ga0501074_0337868 3300049590 Unclassified 1069
502 Ga0501075_0047466 3300049591 Bacteria 3227
503 Ga0501081_0170388 3300049743 Bacteria 1572
504 Ga0501035_0013569 3300049822 Bacteria 7518
505 Ga0501044_0030722 3300049823 Bacteria 5659
506 Ga0501044_0059716 3300049823 Bacteria 3906
507 Ga0501044_0063084 3300049823 Bacteria 3787
508 nmdc:mga08y16_1389_c1 3300050511 Bacteria 24220
509 nmdc:mga0rr50_16575_c1 3300050513 Bacteria 4899
510 Ga0500644_0041029 3300053088 Bacteria 1535
511 Ga0500651_0000002 3300053093 Bacteria 476609
512 Ga0501082_0403312 3300060353 Bacteria 1193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10092907 Ga0157378_100929073 287
2 3300049590 Ga0501074_0337868 Ga0501074_0337868_14_907 296
3 3300060353 Ga0501082_0403312 Ga0501082_0403312_34_927 296
4 3300035692 Ga0373935_0259868 Ga0373935_0259868_249_1196 314
5 3300046472 Ga0495580_0198853 Ga0495580_0198853_25_972 314
6 3300046472 Ga0495580_0074326 Ga0495580_0074326_42_989 315
7 3300046660 Ga0495625_0011018 Ga0495625_0011018_5838_6797 317
8 3300049460 Ga0495682_0020280 Ga0495682_0020280_714_1673 317
9 3300046528 Ga0495642_0040671 Ga0495642_0040671_537_1499 318
10 3300046529 Ga0495652_0316391 Ga0495652_0316391_48_1010 318
11 3300003320 rootH2_10161785 rootH2_101617853 320
12 3300013102 Ga0157371_10205161 Ga0157371_102051612 321
13 3300050511 nmdc:mga08y16_1389_c1 nmdc:mga08y16_1389_c1_19710_20690 322
14 3300046471 Ga0495650_0000041 Ga0495650_0000041_274025_275005 324
15 3300049591 Ga0501075_0047466 Ga0501075_0047466_1190_2176 324
16 3300049743 Ga0501081_0170388 Ga0501081_0170388_32_1018 324
17 3300033180 Ga0307510_10112878 Ga0307510_101128782 326
18 3300044693 Ga0466961_0040753 Ga0466961_0040753_1549_2616 326
19 3300005334 Ga0068869_100058184 Ga0068869_1000581843 328
20 3300009094 Ga0111539_10003011 Ga0111539_1000301112 328
21 3300027907 Ga0207428_10000834 Ga0207428_1000083411 328
22 3300046454 Ga0495592_0119548 Ga0495592_0119548_407_1414 328
23 3300005536 Ga0070697_100000776 Ga0070697_1000007768 329
24 3300005844 Ga0068862_100008400 Ga0068862_1000084003 330
25 3300046511 Ga0495608_0182333 Ga0495608_0182333_17_1015 330
26 3300007265 Ga0099794_10053312 Ga0099794_100533121 332
27 3300007076 Ga0075435_100011449 Ga0075435_1000114494 333
28 3300048929 Ga0496126_0000005 Ga0496126_0000005_299924_301033 333
29 3300005406 Ga0070703_10015547 Ga0070703_100155472 341
30 3300005434 Ga0070709_10020114 Ga0070709_100201143 341
31 3300005445 Ga0070708_100020640 Ga0070708_1000206404 341
32 3300005445 Ga0070708_100021802 Ga0070708_1000218022 341
33 3300005471 Ga0070698_100022939 Ga0070698_1000229394 341
34 3300005518 Ga0070699_100135889 Ga0070699_1001358892 341
35 3300005547 Ga0070693_100186954 Ga0070693_1001869542 341
36 3300006173 Ga0070716_100000610 Ga0070716_1000006105 341
37 3300007265 Ga0099794_10010911 Ga0099794_100109115 341
38 3300007265 Ga0099794_10102620 Ga0099794_101026202 341
39 3300007788 Ga0099795_10003256 Ga0099795_100032562 341
40 3300025939 Ga0207665_10000034 Ga0207665_1000003443 341
41 3300025939 Ga0207665_10003682 Ga0207665_100036827 341
42 3300027671 Ga0209588_1015948 Ga0209588_10159483 341
43 3300027671 Ga0209588_1018316 Ga0209588_10183163 341
44 3300046455 Ga0495603_0026535 Ga0495603_0026535_2421_3452 341
45 3300046472 Ga0495580_0004157 Ga0495580_0004157_3171_4202 341
46 3300046473 Ga0495582_0018270 Ga0495582_0018270_512_1543 341
47 3300047472 Ga0495686_0003102 Ga0495686_0003102_9255_10322 341
48 3300050513 nmdc:mga0rr50_16575_c1 nmdc:mga0rr50_16575_c1_112_1143 341
49 3300031090 Ga0265760_10000016 Ga0265760_1000001673 342
50 3300046543 Ga0495645_0054812 Ga0495645_0054812_673_1704 342
51 3300046543 Ga0495645_0055777 Ga0495645_0055777_1521_2555 342
52 3300046675 Ga0495657_0086857 Ga0495657_0086857_219_1250 342
53 3300047472 Ga0495686_0003168 Ga0495686_0003168_13417_14448 342
54 3300005329 Ga0070683_100018257 Ga0070683_1000182573 345
55 3300005339 Ga0070660_100122438 Ga0070660_1001224382 345
56 3300005344 Ga0070661_100064112 Ga0070661_1000641122 345
57 3300005530 Ga0070679_100002632 Ga0070679_1000026323 345
58 3300005563 Ga0068855_100040728 Ga0068855_1000407283 345
59 3300013104 Ga0157370_10053619 Ga0157370_100536193 345
60 3300013105 Ga0157369_10059391 Ga0157369_100593912 345
61 3300013307 Ga0157372_10026353 Ga0157372_100263533 345
62 3300025909 Ga0207705_10004468 Ga0207705_100044683 345
63 3300025912 Ga0207707_10126576 Ga0207707_101265762 345
64 3300025919 Ga0207657_10006402 Ga0207657_100064028 345
65 3300025921 Ga0207652_10005620 Ga0207652_100056203 345
66 3300025921 Ga0207652_10013635 Ga0207652_100136352 345
67 3300025924 Ga0207694_10035400 Ga0207694_100354002 345
68 3300026116 Ga0207674_10004578 Ga0207674_100045789 345
69 3300031241 Ga0265325_10034215 Ga0265325_100342153 345
70 3300039450 Ga0436363_1458381 Ga0436363_1458381_732_1769 345
71 3300046462 Ga0495651_0053270 Ga0495651_0053270_1633_2700 345
72 3300046543 Ga0495645_0024420 Ga0495645_0024420_3223_4290 345
73 3300046809 Ga0495600_0135631 Ga0495600_0135631_37_1104 345
74 3300005436 Ga0070713_100008019 Ga0070713_1000080195 346
75 3300013105 Ga0157369_10042417 Ga0157369_100424173 346
76 3300025928 Ga0207700_10021670 Ga0207700_100216704 346
77 3300045976 Ga0466967_0036759 Ga0466967_0036759_181_1224 346
78 3300048918 Ga0496115_0042121 Ga0496115_0042121_2101_3141 346
79 3300035172 Ga0373955_0044437 Ga0373955_0044437_1093_2139 347
80 3300035410 Ga0373924_0022076 Ga0373924_0022076_1059_2105 347
81 3300036401 Ga0373937_0056327 Ga0373937_0056327_767_1813 347
82 3300037068 Ga0373925_0007071 Ga0373925_0007071_961_2007 347
83 3300046499 Ga0495594_0053788 Ga0495594_0053788_394_1440 347
84 3300046683 Ga0495658_0028305 Ga0495658_0028305_772_1818 347
85 3300047315 Ga0495581_0091765 Ga0495581_0091765_663_1709 347
86 3300048905 Ga0496102_0135201 Ga0496102_0135201_807_1853 347
87 3300048906 Ga0496103_0113793 Ga0496103_0113793_573_1619 347
88 3300046507 Ga0495606_0037780 Ga0495606_0037780_611_1663 348
89 3300003320 rootH2_10038072 rootH2_100380724 349
90 3300003320 rootH2_10052867 rootH2_100528672 349
91 3300005563 Ga0068855_100285405 Ga0068855_1002854052 349
92 3300005618 Ga0068864_100199953 Ga0068864_1001999532 349
93 3300009093 Ga0105240_10065279 Ga0105240_100652794 349
94 3300025233 Ga0209437_102581 Ga0209437_1025813 349
95 3300025261 Ga0209233_1000573 Ga0209233_10005733 349
96 3300025921 Ga0207652_10105041 Ga0207652_101050412 349
97 3300046507 Ga0495606_0086453 Ga0495606_0086453_189_1265 349
98 3300048929 Ga0496126_0006253 Ga0496126_0006253_4096_5151 349
99 3300003320 rootH2_10027635 rootH2_100276354 350
100 3300005366 Ga0070659_100003118 Ga0070659_1000031188 350
101 3300005539 Ga0068853_100000027 Ga0068853_10000002759 350
102 3300005578 Ga0068854_100000021 Ga0068854_10000002131 350
103 3300009093 Ga0105240_10022222 Ga0105240_100222223 350
104 3300009177 Ga0105248_10022761 Ga0105248_100227613 350
105 3300013104 Ga0157370_10022663 Ga0157370_100226635 350
106 3300025913 Ga0207695_10028006 Ga0207695_100280065 350
107 3300025919 Ga0207657_10027696 Ga0207657_100276962 350
108 3300025941 Ga0207711_10053010 Ga0207711_100530103 350
109 3300025981 Ga0207640_10000007 Ga0207640_10000007150 350
110 3300026041 Ga0207639_10000036 Ga0207639_1000003683 350
111 3300046694 Ga0495649_0065013 Ga0495649_0065013_437_1522 350
112 3300047472 Ga0495686_0000031 Ga0495686_0000031_148772_149881 350
113 3300047472 Ga0495686_0006279 Ga0495686_0006279_1361_2473 350
114 3300048907 Ga0496104_0000160 Ga0496104_0000160_5761_6870 350
115 3300053093 Ga0500651_0000002 Ga0500651_0000002_117618_118685 350
116 3300009551 Ga0105238_10074110 Ga0105238_100741103 351
117 3300013105 Ga0157369_10091656 Ga0157369_100916563 351
118 3300025924 Ga0207694_10054154 Ga0207694_100541543 351
119 3300031242 Ga0265329_10022825 Ga0265329_100228252 351
120 3300005327 Ga0070658_10011270 Ga0070658_100112704 352
121 3300005339 Ga0070660_100036356 Ga0070660_1000363563 352
122 3300005530 Ga0070679_100244327 Ga0070679_1002443272 352
123 3300005983 Ga0081540_1007495 Ga0081540_10074954 352
124 3300009093 Ga0105240_10162328 Ga0105240_101623282 352
125 3300009551 Ga0105238_10021176 Ga0105238_100211764 352
126 3300013105 Ga0157369_10012725 Ga0157369_100127255 352
127 3300013307 Ga0157372_10088200 Ga0157372_100882004 352
128 3300014969 Ga0157376_10011852 Ga0157376_100118523 352
129 3300014969 Ga0157376_10093934 Ga0157376_100939342 352
130 3300025909 Ga0207705_10032229 Ga0207705_100322293 352
131 3300028379 Ga0268266_10005850 Ga0268266_100058506 352
132 3300028379 Ga0268266_10007181 Ga0268266_100071816 352
133 3300028379 Ga0268266_10343534 Ga0268266_103435342 352
134 3300028379 Ga0268266_10523017 Ga0268266_105230171 352
135 3300046471 Ga0495650_0004908 Ga0495650_0004908_4070_5203 352
136 3300046492 Ga0495585_0010167 Ga0495585_0010167_4282_5415 352
137 3300046499 Ga0495594_0000463 Ga0495594_0000463_633_1766 352
138 3300046523 Ga0495644_0000349 Ga0495644_0000349_14821_15954 352
139 3300046528 Ga0495642_0010787 Ga0495642_0010787_314_1447 352
140 3300046538 Ga0495609_0020777 Ga0495609_0020777_300_1433 352
141 3300046558 Ga0495633_0018701 Ga0495633_0018701_83_1216 352
142 3300046660 Ga0495625_0000429 Ga0495625_0000429_7286_8419 352
143 3300046684 Ga0495669_0005415 Ga0495669_0005415_3338_4471 352
144 3300047320 Ga0495672_0003429 Ga0495672_0003429_5260_6393 352
145 3300047445 Ga0495677_0009816 Ga0495677_0009816_2008_3141 352
146 3300049568 Ga0501031_0008745 Ga0501031_0008745_572_1705 352
147 3300049569 Ga0501032_0001060 Ga0501032_0001060_12887_14020 352
148 3300049570 Ga0501033_0005342 Ga0501033_0005342_4595_5728 352
149 3300049571 Ga0501034_0004644 Ga0501034_0004644_346_1479 352
150 3300049572 Ga0501036_0057608 Ga0501036_0057608_368_1501 352
151 3300049574 Ga0501038_0000072 Ga0501038_0000072_77203_78336 352
152 3300049575 Ga0501039_0023932 Ga0501039_0023932_2949_4082 352
153 3300049579 Ga0501043_0003848 Ga0501043_0003848_8326_9459 352
154 3300049580 Ga0501046_0002025 Ga0501046_0002025_13521_14654 352
155 3300049581 Ga0501047_0002667 Ga0501047_0002667_15776_16909 352
156 3300049584 Ga0501068_0039701 Ga0501068_0039701_1581_2714 352
157 3300049586 Ga0501070_0167423 Ga0501070_0167423_270_1403 352
158 3300049589 Ga0501073_0027431 Ga0501073_0027431_504_1637 352
159 3300049822 Ga0501035_0013569 Ga0501035_0013569_1791_2924 352
160 3300049823 Ga0501044_0030722 Ga0501044_0030722_4453_5586 352
161 3300049823 Ga0501044_0059716 Ga0501044_0059716_2199_3344 352
162 iso_pu_bacteria 2884215851 2884216824 352
163 3300003320 rootH2_10098520 rootH2_100985204 353
164 3300005339 Ga0070660_100043549 Ga0070660_1000435493 353
165 3300005355 Ga0070671_100000503 Ga0070671_10000050316 353
166 3300005548 Ga0070665_100009430 Ga0070665_1000094303 353
167 3300005563 Ga0068855_100036783 Ga0068855_1000367835 353
168 3300005841 Ga0068863_100003044 Ga0068863_1000030445 353
169 3300009093 Ga0105240_10012755 Ga0105240_100127556 353
170 3300009551 Ga0105238_10015019 Ga0105238_100150193 353
171 3300013104 Ga0157370_10037579 Ga0157370_100375793 353
172 3300013104 Ga0157370_10045673 Ga0157370_100456733 353
173 3300013296 Ga0157374_10128996 Ga0157374_101289962 353
174 3300013306 Ga0163162_10002114 Ga0163162_100021143 353
175 3300014325 Ga0163163_10003247 Ga0163163_100032473 353
176 3300014968 Ga0157379_10009933 Ga0157379_100099337 353
177 3300014968 Ga0157379_10313617 Ga0157379_103136172 353
178 3300014969 Ga0157376_10007015 Ga0157376_100070154 353
179 3300025903 Ga0207680_10028230 Ga0207680_100282303 353
180 3300025904 Ga0207647_10031764 Ga0207647_100317643 353
181 3300025909 Ga0207705_10000171 Ga0207705_1000017118 353
182 3300025913 Ga0207695_10135709 Ga0207695_101357093 353
183 3300025920 Ga0207649_10131853 Ga0207649_101318532 353
184 3300025920 Ga0207649_10135711 Ga0207649_101357112 353
185 3300025931 Ga0207644_10001529 Ga0207644_100015298 353
186 3300025941 Ga0207711_10037558 Ga0207711_100375583 353
187 3300025949 Ga0207667_10027924 Ga0207667_100279245 353
188 3300025949 Ga0207667_10032147 Ga0207667_100321474 353
189 3300026067 Ga0207678_10003636 Ga0207678_100036364 353
190 3300026088 Ga0207641_10005283 Ga0207641_100052835 353
191 3300045049 Ga0466959_0117593 Ga0466959_0117593_49_1164 353
192 3300046459 Ga0495629_0006935 Ga0495629_0006935_6260_7381 353
193 3300046462 Ga0495651_0004801 Ga0495651_0004801_3438_4559 353
194 3300046462 Ga0495651_0197206 Ga0495651_0197206_139_1278 353
195 3300046463 Ga0495653_0006329 Ga0495653_0006329_3949_5070 353
196 3300046473 Ga0495582_0003149 Ga0495582_0003149_6141_7262 353
197 3300046475 Ga0495639_0001419 Ga0495639_0001419_9155_10276 353
198 3300046476 Ga0495662_0000190 Ga0495662_0000190_15285_16406 353
199 3300046477 Ga0495664_0000299 Ga0495664_0000299_19679_20800 353
200 3300046477 Ga0495664_0133492 Ga0495664_0133492_145_1284 353
201 3300046506 Ga0495583_0009960 Ga0495583_0009960_3084_4190 353
202 3300046516 Ga0495628_0026454 Ga0495628_0026454_537_1658 353
203 3300046526 Ga0495666_0005694 Ga0495666_0005694_3986_5107 353
204 3300046529 Ga0495652_0004544 Ga0495652_0004544_9154_10275 353
205 3300046531 Ga0495665_0000207 Ga0495665_0000207_3936_5057 353
206 3300046533 Ga0495640_0013799 Ga0495640_0013799_3328_4449 353
207 3300046535 Ga0495586_0000402 Ga0495586_0000402_3731_4852 353
208 3300046543 Ga0495645_0003029 Ga0495645_0003029_7887_9008 353
209 3300046559 Ga0495667_0002292 Ga0495667_0002292_11477_12598 353
210 3300046616 Ga0495668_0027433 Ga0495668_0027433_1492_2613 353
211 3300046642 Ga0495634_0001368 Ga0495634_0001368_5225_6346 353
212 3300046663 Ga0495635_0000327 Ga0495635_0000327_7497_8618 353
213 3300046674 Ga0495588_0015041 Ga0495588_0015041_2012_3133 353
214 3300046679 Ga0495623_0008684 Ga0495623_0008684_5235_6356 353
215 3300046680 Ga0495646_0000504 Ga0495646_0000504_15839_16960 353
216 3300046689 Ga0495613_0001165 Ga0495613_0001165_15892_17013 353
217 3300046690 Ga0495624_0036687 Ga0495624_0036687_50_1171 353
218 3300046809 Ga0495600_0000281 Ga0495600_0000281_1350_2471 353
219 3300047315 Ga0495581_0000186 Ga0495581_0000186_22269_23390 353
220 3300047317 Ga0495604_0000997 Ga0495604_0000997_20459_21580 353
221 3300047319 Ga0495674_0013938 Ga0495674_0013938_6219_7340 353
222 3300047319 Ga0495674_0043246 Ga0495674_0043246_1725_2864 353
223 3300047320 Ga0495672_0076444 Ga0495672_0076444_426_1574 353
224 3300047322 Ga0495680_0099254 Ga0495680_0099254_591_1712 353
225 3300047444 Ga0495675_0000760 Ga0495675_0000760_8550_9671 353
226 3300047471 Ga0495684_0016630 Ga0495684_0016630_972_2093 353
227 3300047673 Ga0495593_0027074 Ga0495593_0027074_816_1937 353
228 3300048089 Ga0495614_0000114 Ga0495614_0000114_24513_25634 353
229 3300048915 Ga0496112_0030870 Ga0496112_0030870_1421_2542 353
230 3300048918 Ga0496115_0088095 Ga0496115_0088095_1298_2437 353
231 3300049460 Ga0495682_0020453 Ga0495682_0020453_450_1556 353
232 3300049581 Ga0501047_0247378 Ga0501047_0247378_20_1162 353
233 3300049586 Ga0501070_0088492 Ga0501070_0088492_1058_2200 353
234 3300049823 Ga0501044_0063084 Ga0501044_0063084_1856_2998 353
235 3300005327 Ga0070658_10034607 Ga0070658_100346073 354
236 3300005539 Ga0068853_100002831 Ga0068853_1000028317 354
237 3300005563 Ga0068855_100050722 Ga0068855_1000507224 354
238 3300005563 Ga0068855_100090474 Ga0068855_1000904743 354
239 3300005616 Ga0068852_100011835 Ga0068852_1000118354 354
240 3300009093 Ga0105240_10099876 Ga0105240_100998763 354
241 3300009177 Ga0105248_10000004 Ga0105248_10000004434 354
242 3300013104 Ga0157370_10076409 Ga0157370_100764092 354
243 3300013105 Ga0157369_10010517 Ga0157369_100105174 354
244 3300013296 Ga0157374_10045548 Ga0157374_100455484 354
245 3300013307 Ga0157372_10049065 Ga0157372_100490652 354
246 3300014968 Ga0157379_10219999 Ga0157379_102199992 354
247 3300025909 Ga0207705_10006166 Ga0207705_100061668 354
248 3300025909 Ga0207705_10009357 Ga0207705_100093574 354
249 3300025919 Ga0207657_10035979 Ga0207657_100359794 354
250 3300025921 Ga0207652_10199212 Ga0207652_101992122 354
251 3300025924 Ga0207694_10017194 Ga0207694_100171944 354
252 3300025941 Ga0207711_10000032 Ga0207711_10000032144 354
253 3300025949 Ga0207667_10091235 Ga0207667_100912353 354
254 3300026041 Ga0207639_10007272 Ga0207639_100072723 354
255 3300028800 Ga0265338_10015633 Ga0265338_100156334 354
256 3300042005 Ga0439448_0009861 Ga0439448_0009861_1495_2616 354
257 3300046660 Ga0495625_0021360 Ga0495625_0021360_2503_3630 354
258 3300048923 Ga0496120_0090659 Ga0496120_0090659_166_1281 354
259 3300048929 Ga0496126_0001110 Ga0496126_0001110_38996_40111 354
260 3300053088 Ga0500644_0041029 Ga0500644_0041029_181_1245 354
261 3300003320 rootH2_10017637 rootH2_100176373 355
262 3300003320 rootH2_10098140 rootH2_100981402 355
263 3300005328 Ga0070676_10031391 Ga0070676_100313913 355
264 3300005329 Ga0070683_100000792 Ga0070683_10000079213 355
265 3300005329 Ga0070683_100003479 Ga0070683_1000034797 355
266 3300005329 Ga0070683_100012617 Ga0070683_1000126175 355
267 3300005329 Ga0070683_100035550 Ga0070683_1000355502 355
268 3300005329 Ga0070683_100048999 Ga0070683_1000489996 355
269 3300005329 Ga0070683_100069401 Ga0070683_1000694013 355
270 3300005331 Ga0070670_100027205 Ga0070670_1000272054 355
271 3300005331 Ga0070670_100071556 Ga0070670_1000715562 355
272 3300005334 Ga0068869_100006994 Ga0068869_1000069943 355
273 3300005335 Ga0070666_10140881 Ga0070666_101408812 355
274 3300005336 Ga0070680_100036892 Ga0070680_1000368921 355
275 3300005336 Ga0070680_100107218 Ga0070680_1001072182 355
276 3300005338 Ga0068868_100078509 Ga0068868_1000785092 355
277 3300005339 Ga0070660_100007166 Ga0070660_1000071666 355
278 3300005344 Ga0070661_100093999 Ga0070661_1000939994 355
279 3300005344 Ga0070661_100174428 Ga0070661_1001744281 355
280 3300005355 Ga0070671_100097864 Ga0070671_1000978643 355
281 3300005367 Ga0070667_100015426 Ga0070667_1000154264 355
282 3300005435 Ga0070714_100015486 Ga0070714_1000154863 355
283 3300005436 Ga0070713_100036370 Ga0070713_1000363702 355
284 3300005436 Ga0070713_100101208 Ga0070713_1001012084 355
285 3300005439 Ga0070711_100049536 Ga0070711_1000495363 355
286 3300005456 Ga0070678_100004919 Ga0070678_1000049193 355
287 3300005458 Ga0070681_10000287 Ga0070681_100002875 355
288 3300005458 Ga0070681_10143057 Ga0070681_101430573 355
289 3300005530 Ga0070679_100000282 Ga0070679_10000028228 355
290 3300005530 Ga0070679_100034032 Ga0070679_1000340322 355
291 3300005535 Ga0070684_100003574 Ga0070684_1000035746 355
292 3300005535 Ga0070684_100048524 Ga0070684_1000485242 355
293 3300005535 Ga0070684_100157449 Ga0070684_1001574492 355
294 3300005539 Ga0068853_100001150 Ga0068853_1000011504 355
295 3300005548 Ga0070665_100012032 Ga0070665_1000120326 355
296 3300005563 Ga0068855_100002127 Ga0068855_10000212719 355
297 3300005563 Ga0068855_100008987 Ga0068855_1000089874 355
298 3300005563 Ga0068855_100009004 Ga0068855_1000090046 355
299 3300005563 Ga0068855_100081216 Ga0068855_1000812163 355
300 3300005563 Ga0068855_100119760 Ga0068855_1001197602 355
301 3300005577 Ga0068857_100001410 Ga0068857_1000014105 355
302 3300005577 Ga0068857_100002473 Ga0068857_10000247314 355
303 3300005577 Ga0068857_100137985 Ga0068857_1001379852 355
304 3300005578 Ga0068854_100060080 Ga0068854_1000600802 355
305 3300005578 Ga0068854_100064972 Ga0068854_1000649723 355
306 3300005614 Ga0068856_100014641 Ga0068856_1000146414 355
307 3300005614 Ga0068856_100016361 Ga0068856_1000163613 355
308 3300005614 Ga0068856_100023183 Ga0068856_1000231833 355
309 3300005614 Ga0068856_100040932 Ga0068856_1000409323 355
310 3300005614 Ga0068856_100074297 Ga0068856_1000742973 355
311 3300005614 Ga0068856_100159838 Ga0068856_1001598382 355
312 3300005616 Ga0068852_100000003 Ga0068852_10000000330 355
313 3300005616 Ga0068852_100002237 Ga0068852_1000022375 355
314 3300005616 Ga0068852_100005657 Ga0068852_1000056576 355
315 3300005616 Ga0068852_100044875 Ga0068852_1000448753 355
316 3300005618 Ga0068864_100032385 Ga0068864_1000323854 355
317 3300005834 Ga0068851_10021869 Ga0068851_100218693 355
318 3300005834 Ga0068851_10040679 Ga0068851_100406793 355
319 3300005834 Ga0068851_10042026 Ga0068851_100420262 355
320 3300005841 Ga0068863_100001840 Ga0068863_1000018405 355
321 3300005842 Ga0068858_100033836 Ga0068858_1000338362 355
322 3300005842 Ga0068858_100035030 Ga0068858_1000350303 355
323 3300005843 Ga0068860_100002006 Ga0068860_1000020069 355
324 3300005843 Ga0068860_100107923 Ga0068860_1001079233 355
325 3300006028 Ga0070717_10000563 Ga0070717_100005637 355
326 3300006237 Ga0097621_100026306 Ga0097621_1000263063 355
327 3300006237 Ga0097621_100164934 Ga0097621_1001649342 355
328 3300006358 Ga0068871_100002006 Ga0068871_1000020065 355
329 3300009093 Ga0105240_10000077 Ga0105240_10000077140 355
330 3300009093 Ga0105240_10000114 Ga0105240_1000011455 355
331 3300009093 Ga0105240_10001813 Ga0105240_1000181315 355
332 3300009093 Ga0105240_10007394 Ga0105240_100073949 355
333 3300009093 Ga0105240_10009351 Ga0105240_100093513 355
334 3300009093 Ga0105240_10083315 Ga0105240_100833153 355
335 3300009093 Ga0105240_10091300 Ga0105240_100913003 355
336 3300009093 Ga0105240_10246318 Ga0105240_102463183 355
337 3300009093 Ga0105240_10330295 Ga0105240_103302952 355
338 3300009093 Ga0105240_10528272 Ga0105240_105282722 355
339 3300009098 Ga0105245_10005219 Ga0105245_100052198 355
340 3300009098 Ga0105245_10010024 Ga0105245_100100243 355
341 3300009098 Ga0105245_10048851 Ga0105245_100488514 355
342 3300009101 Ga0105247_10012196 Ga0105247_100121964 355
343 3300009101 Ga0105247_10074426 Ga0105247_100744262 355
344 3300009174 Ga0105241_10000437 Ga0105241_1000043713 355
345 3300009174 Ga0105241_10003331 Ga0105241_100033316 355
346 3300009174 Ga0105241_10007832 Ga0105241_100078325 355
347 3300009177 Ga0105248_10000432 Ga0105248_1000043231 355
348 3300009545 Ga0105237_10002257 Ga0105237_100022575 355
349 3300009545 Ga0105237_10010282 Ga0105237_100102825 355
350 3300009545 Ga0105237_10034550 Ga0105237_100345503 355
351 3300009545 Ga0105237_10035438 Ga0105237_100354384 355
352 3300009551 Ga0105238_10000446 Ga0105238_100004466 355
353 3300009551 Ga0105238_10002307 Ga0105238_1000230711 355
354 3300009551 Ga0105238_10002444 Ga0105238_1000244410 355
355 3300009551 Ga0105238_10026024 Ga0105238_100260244 355
356 3300009551 Ga0105238_10029569 Ga0105238_100295693 355
357 3300009551 Ga0105238_10414108 Ga0105238_104141082 355
358 3300010375 Ga0105239_10002434 Ga0105239_1000243417 355
359 3300010375 Ga0105239_10043282 Ga0105239_100432822 355
360 3300010375 Ga0105239_10053930 Ga0105239_100539303 355
361 3300010375 Ga0105239_10161947 Ga0105239_101619472 355
362 3300011119 Ga0105246_10015238 Ga0105246_100152383 355
363 3300013100 Ga0157373_10027352 Ga0157373_100273523 355
364 3300013104 Ga0157370_10000001 Ga0157370_10000001417 355
365 3300013105 Ga0157369_10000066 Ga0157369_1000006624 355
366 3300013105 Ga0157369_10003762 Ga0157369_100037625 355
367 3300013105 Ga0157369_10007441 Ga0157369_100074417 355
368 3300013105 Ga0157369_10008466 Ga0157369_100084665 355
369 3300013105 Ga0157369_10012127 Ga0157369_100121279 355
370 3300013105 Ga0157369_10014626 Ga0157369_100146263 355
371 3300013105 Ga0157369_10060457 Ga0157369_100604574 355
372 3300013105 Ga0157369_10166023 Ga0157369_101660233 355
373 3300013296 Ga0157374_10025259 Ga0157374_100252592 355
374 3300013296 Ga0157374_10030708 Ga0157374_100307084 355
375 3300013296 Ga0157374_10088042 Ga0157374_100880422 355
376 3300013296 Ga0157374_10371242 Ga0157374_103712422 355
377 3300013297 Ga0157378_10003175 Ga0157378_1000317510 355
378 3300013297 Ga0157378_10117634 Ga0157378_101176342 355
379 3300013297 Ga0157378_10205735 Ga0157378_102057352 355
380 3300013297 Ga0157378_10210166 Ga0157378_102101662 355
381 3300013306 Ga0163162_10013640 Ga0163162_100136403 355
382 3300013307 Ga0157372_10000038 Ga0157372_1000003841 355
383 3300013307 Ga0157372_10000125 Ga0157372_1000012519 355
384 3300013307 Ga0157372_10018813 Ga0157372_100188133 355
385 3300013307 Ga0157372_10028416 Ga0157372_100284163 355
386 3300013307 Ga0157372_10052812 Ga0157372_100528123 355
387 3300013307 Ga0157372_10123935 Ga0157372_101239352 355
388 3300013308 Ga0157375_10001926 Ga0157375_1000192611 355
389 3300013308 Ga0157375_10014912 Ga0157375_100149123 355
390 3300013308 Ga0157375_10038110 Ga0157375_100381103 355
391 3300014325 Ga0163163_10016223 Ga0163163_100162233 355
392 3300014968 Ga0157379_10005672 Ga0157379_100056729 355
393 3300014968 Ga0157379_10062411 Ga0157379_100624113 355
394 3300014969 Ga0157376_10430061 Ga0157376_104300612 355
395 3300025315 Ga0207697_10006406 Ga0207697_100064063 355
396 3300025321 Ga0207656_10080655 Ga0207656_100806552 355
397 3300025900 Ga0207710_10008656 Ga0207710_100086563 355
398 3300025907 Ga0207645_10026377 Ga0207645_100263773 355
399 3300025911 Ga0207654_10000028 Ga0207654_1000002872 355
400 3300025911 Ga0207654_10000799 Ga0207654_100007995 355
401 3300025911 Ga0207654_10017967 Ga0207654_100179672 355
402 3300025911 Ga0207654_10122010 Ga0207654_101220102 355
403 3300025912 Ga0207707_10001971 Ga0207707_1000197115 355
404 3300025912 Ga0207707_10037860 Ga0207707_100378603 355
405 3300025913 Ga0207695_10000026 Ga0207695_10000026147 355
406 3300025913 Ga0207695_10000063 Ga0207695_10000063209 355
407 3300025913 Ga0207695_10002403 Ga0207695_100024035 355
408 3300025913 Ga0207695_10002545 Ga0207695_1000254513 355
409 3300025913 Ga0207695_10004318 Ga0207695_100043184 355
410 3300025913 Ga0207695_10008796 Ga0207695_100087963 355
411 3300025913 Ga0207695_10038761 Ga0207695_100387613 355
412 3300025914 Ga0207671_10000279 Ga0207671_100002796 355
413 3300025914 Ga0207671_10000526 Ga0207671_1000052630 355
414 3300025914 Ga0207671_10124751 Ga0207671_101247512 355
415 3300025917 Ga0207660_10011517 Ga0207660_100115174 355
416 3300025919 Ga0207657_10002476 Ga0207657_1000247611 355
417 3300025920 Ga0207649_10069715 Ga0207649_100697154 355
418 3300025920 Ga0207649_10128687 Ga0207649_101286872 355
419 3300025921 Ga0207652_10039679 Ga0207652_100396793 355
420 3300025921 Ga0207652_10131453 Ga0207652_101314532 355
421 3300025924 Ga0207694_10000144 Ga0207694_1000014425 355
422 3300025924 Ga0207694_10000346 Ga0207694_100003463 355
423 3300025924 Ga0207694_10023538 Ga0207694_100235382 355
424 3300025924 Ga0207694_10373331 Ga0207694_103733311 355
425 3300025925 Ga0207650_10002471 Ga0207650_100024714 355
426 3300025928 Ga0207700_10126563 Ga0207700_101265632 355
427 3300025931 Ga0207644_10044588 Ga0207644_100445883 355
428 3300025933 Ga0207706_10002079 Ga0207706_1000207912 355
429 3300025940 Ga0207691_10018719 Ga0207691_100187192 355
430 3300025941 Ga0207711_10047215 Ga0207711_100472152 355
431 3300025942 Ga0207689_10000887 Ga0207689_100008879 355
432 3300025944 Ga0207661_10004714 Ga0207661_100047142 355
433 3300025944 Ga0207661_10036170 Ga0207661_100361702 355
434 3300025949 Ga0207667_10000123 Ga0207667_1000012365 355
435 3300025949 Ga0207667_10001348 Ga0207667_1000134824 355
436 3300025949 Ga0207667_10020339 Ga0207667_100203394 355
437 3300025949 Ga0207667_10232254 Ga0207667_102322542 355
438 3300025972 Ga0207668_10050493 Ga0207668_100504933 355
439 3300025981 Ga0207640_10045044 Ga0207640_100450443 355
440 3300025981 Ga0207640_10242759 Ga0207640_102427592 355
441 3300026023 Ga0207677_10005803 Ga0207677_100058035 355
442 3300026035 Ga0207703_10033416 Ga0207703_100334162 355
443 3300026041 Ga0207639_10000530 Ga0207639_100005306 355
444 3300026078 Ga0207702_10001473 Ga0207702_100014733 355
445 3300026078 Ga0207702_10022339 Ga0207702_100223392 355
446 3300026078 Ga0207702_10031298 Ga0207702_100312983 355
447 3300026088 Ga0207641_10018604 Ga0207641_100186042 355
448 3300026088 Ga0207641_10059533 Ga0207641_100595333 355
449 3300026116 Ga0207674_10000488 Ga0207674_1000048812 355
450 3300026116 Ga0207674_10005587 Ga0207674_1000558714 355
451 3300026116 Ga0207674_10031853 Ga0207674_100318534 355
452 3300026116 Ga0207674_10039999 Ga0207674_100399993 355
453 3300026142 Ga0207698_10000016 Ga0207698_10000016147 355
454 3300026142 Ga0207698_10000224 Ga0207698_100002247 355
455 3300026142 Ga0207698_10026520 Ga0207698_100265202 355
456 3300026142 Ga0207698_10031410 Ga0207698_100314103 355
457 3300026142 Ga0207698_10070608 Ga0207698_100706084 355
458 3300026142 Ga0207698_10320920 Ga0207698_103209202 355
459 3300028381 Ga0268264_10002255 Ga0268264_100022554 355
460 3300028577 Ga0265318_10014355 Ga0265318_100143552 355
461 3300028666 Ga0265336_10004973 Ga0265336_100049734 355
462 3300028666 Ga0265336_10006882 Ga0265336_100068823 355
463 3300028800 Ga0265338_10004022 Ga0265338_1000402217 355
464 3300028800 Ga0265338_10004888 Ga0265338_1000488811 355
465 3300028800 Ga0265338_10032498 Ga0265338_100324984 355
466 3300029957 Ga0265324_10061800 Ga0265324_100618002 355
467 3300031235 Ga0265330_10000198 Ga0265330_1000019815 355
468 3300031235 Ga0265330_10000456 Ga0265330_1000045622 355
469 3300031235 Ga0265330_10001642 Ga0265330_100016424 355
470 3300031235 Ga0265330_10016391 Ga0265330_100163913 355
471 3300031239 Ga0265328_10000151 Ga0265328_1000015124 355
472 3300031239 Ga0265328_10018297 Ga0265328_100182972 355
473 3300031239 Ga0265328_10024718 Ga0265328_100247182 355
474 3300031240 Ga0265320_10010509 Ga0265320_100105093 355
475 3300031241 Ga0265325_10000414 Ga0265325_100004145 355
476 3300031241 Ga0265325_10005283 Ga0265325_100052835 355
477 3300031241 Ga0265325_10027168 Ga0265325_100271683 355
478 3300031242 Ga0265329_10016750 Ga0265329_100167502 355
479 3300031247 Ga0265340_10017046 Ga0265340_100170462 355
480 3300031247 Ga0265340_10029716 Ga0265340_100297162 355
481 3300031249 Ga0265339_10000003 Ga0265339_10000003226 355
482 3300031249 Ga0265339_10000118 Ga0265339_1000011830 355
483 3300031249 Ga0265339_10002822 Ga0265339_100028228 355
484 3300031249 Ga0265339_10003521 Ga0265339_100035218 355
485 3300031249 Ga0265339_10038747 Ga0265339_100387472 355
486 3300031250 Ga0265331_10057713 Ga0265331_100577133 355
487 3300031344 Ga0265316_10000656 Ga0265316_1000065628 355
488 3300031344 Ga0265316_10002683 Ga0265316_100026835 355
489 3300031344 Ga0265316_10008076 Ga0265316_100080766 355
490 3300031344 Ga0265316_10035653 Ga0265316_100356533 355
491 3300031595 Ga0265313_10000369 Ga0265313_1000036913 355
492 3300031595 Ga0265313_10003433 Ga0265313_100034333 355
493 3300031595 Ga0265313_10043728 Ga0265313_100437282 355
494 3300031711 Ga0265314_10000064 Ga0265314_10000064131 355
495 3300031711 Ga0265314_10001959 Ga0265314_100019598 355
496 3300031711 Ga0265314_10032530 Ga0265314_100325303 355
497 3300031711 Ga0265314_10047643 Ga0265314_100476433 355
498 3300031712 Ga0265342_10001297 Ga0265342_100012979 355
499 3300031712 Ga0265342_10001753 Ga0265342_100017535 355
500 3300031712 Ga0265342_10007944 Ga0265342_100079445 355
501 3300031712 Ga0265342_10026880 Ga0265342_100268802 355
502 3300031712 Ga0265342_10054849 Ga0265342_100548492 355
503 3300031712 Ga0265342_10057356 Ga0265342_100573561 355
504 3300031712 Ga0265342_10099829 Ga0265342_100998292 355
505 3300031712 Ga0265342_10107017 Ga0265342_101070172 355
506 3300044694 Ga0466963_0001832 Ga0466963_0001832_10373_11440 355
507 3300046529 Ga0495652_0027187 Ga0495652_0027187_168_1235 355
508 3300046536 Ga0495587_0057424 Ga0495587_0057424_1180_2247 355
509 3300047471 Ga0495684_0163588 Ga0495684_0163588_287_1357 355
510 3300048904 Ga0496101_0062793 Ga0496101_0062793_1501_2568 355
511 3300048910 Ga0496107_0168020 Ga0496107_0168020_464_1531 355
512 3300048918 Ga0496115_0039997 Ga0496115_0039997_27_1094 355
513 3300048918 Ga0496115_0244129 Ga0496115_0244129_225_1292 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

194

356

0.99

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

33

186

0.92

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

203

359

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.9288 1 355
2g17-assembly1.cif.gz_A the structure of n-acetyl-gamma-glutamyl-phosphate reductase from salmonella typhimurium. 0.9261 1 355
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.9154 4 355
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9136 2 355
3dr3-assembly1.cif.gz_A structure of idp00107, a potential n-acetyl-gamma-glutamylphosphate reductase from shigella flexneri 0.9102 4 355
ID Description Score Start End Superfamily
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9316 167 333 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.926 167 333 3.30.360.10
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8888 167 329 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8789 166 329 3.30.360.10
af_Q58496_153_306_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8788 174 325 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2V9ZKY3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9626 113 355 GO:0003942
GO:0006526
GO:0070401
AF-E6PZX9-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) (EC 1.2.1.38) 0.9552 1 270 GO:0003942
GO:0006526
GO:0051287
AF-A0A2V9ZKY3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9549 113 355 GO:0003942
GO:0006526
GO:0070401
AF-A0A3N5HIN7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9489 211 355
AF-A0A2V8UE92-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.945 77 355 GO:0003942
GO:0006526
GO:0051287
GO:0070401

Feature Viewer

pLDDT pTM Quality
91.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map