F457545

General Info

Members Datasets Scaffolds Average Seq Length
513 314 494 220

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10407273|Ga0075365_104072731
Length 256
Sequence MDVQAKVLLADVEAAGMLVAMYKRVLMKISGEQLAGKHDSGIDPEIAVYLAQECKKVVDAGCQLVIIAGGGNMVRGAEKAGNGIKRVTADQMGMLAGLMNAMALTDIFEDNNIRTRCMSNVFAAQVAESYSYRLAEKHLRRGRVVIVAGGMGRPYFTHDTAAVNIALELDCQLVLKSTKVDGVYDKDPNKFDDAVLLSEVNFQFAVENPQIKVMDKAALGLAMEQNMPVVVFNPMKPDNLLKIASQEKVGTMISNK

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221652 Acidovorax sp. Root402 Isolate Unclassified
8 2643221683 Variovorax sp. Root473 Isolate Unclassified
9 2643221717 Acidovorax sp. Root267 Isolate Unclassified
10 2738543012 Acidovorax sp. CF301 Isolate Unclassified
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
13 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
14 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
15 2899924645 Variovorax sp. 369 Isolate Unclassified
16 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
17 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
18 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
19 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
168 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
296 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
300 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
301 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
306 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
313 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0.97
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.67
Nodule 0.58
Rhizoplane 0.39
Rhizosphere 56.73
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10044778 3300001979 Bacteria 1310
2 JGI24737J22298_10000007 3300001990 Bacteria 62489
3 JGI24735J21928_10000034 3300002067 Bacteria 67726
4 JGI24742J22300_10000005 3300002244 Bacteria 41211
5 JGI25158J39367_1003784 3300002739 Bacteria 2305
6 JGI25150J39212_1006863 3300002774 Bacteria 2320
7 JGI25159J45721_1005024 3300002987 Bacteria 4227
8 JGI25151J46595_10002542 3300003187 Bacteria 10827
9 JGI25151J46595_10007045 3300003187 Bacteria 5555
10 JGI25151J46595_10008683 3300003187 Bacteria 4865
11 JGI25151J46595_10039600 3300003187 Bacteria 1738
12 JGI25151J46595_10091474 3300003187 Bacteria 846
13 JGI25153J46596_10007108 3300003215 Bacteria 5555
14 JGI25153J46596_10007758 3300003215 Bacteria 5221
15 rootH2_10224510 3300003320 Bacteria 2212
16 JGI25160J50197_1007500 3300003354 Bacteria 4259
17 JGI25160J50197_1007596 3300003354 Bacteria 4227
18 JGI25161J50226_1002010 3300003374 Bacteria 5555
19 JGI25161J50226_1002361 3300003374 Bacteria 4872
20 Ga0006562J51391_1049139 3300003578 Bacteria 2861
21 Ga0055535_1000653 3300003761 Bacteria 27554
22 Ga0055542_1000004 3300003762 Bacteria 553532
23 Ga0055526_1006879 3300003771 Bacteria 6058
24 Ga0055526_1007672 3300003771 Bacteria 5555
25 Ga0055537_1000517 3300003773 Bacteria 22772
26 Ga0055537_1002315 3300003773 Bacteria 6502
27 Ga0055537_1002840 3300003773 Bacteria 5555
28 Ga0055524_1005639 3300003775 Bacteria 5555
29 Ga0055524_1005646 3300003775 Bacteria 5552
30 Ga0055536_1006273 3300003781 Bacteria 5602
31 Ga0055536_1024284 3300003781 Bacteria 1759
32 Ga0055536_1024330 3300003781 Bacteria 1756
33 Ga0055534_1000797 3300003784 Bacteria 14671
34 Ga0055534_1003001 3300003784 Bacteria 5555
35 Ga0055534_1011629 3300003784 Bacteria 1779
36 Ga0055528_1004506 3300003790 Bacteria 6693
37 Ga0055528_1005202 3300003790 Bacteria 6115
38 Ga0055528_1006016 3300003790 Bacteria 5555
39 Ga0055530_10001721 3300003791 Bacteria 15384
40 Ga0055530_10008861 3300003791 Bacteria 3961
41 Ga0055530_10011398 3300003791 Bacteria 3194
42 Ga0055540_1002282 3300003792 Bacteria 10335
43 Ga0055540_1003550 3300003792 Bacteria 7467
44 Ga0055540_1004363 3300003792 Bacteria 6415
45 Ga0055540_1005361 3300003792 Bacteria 5423
46 Ga0055540_1017192 3300003792 Bacteria 2026
47 Ga0055531_10002807 3300003794 Bacteria 11427
48 Ga0055531_10008215 3300003794 Bacteria 5555
49 Ga0055531_10008224 3300003794 Bacteria 5552
50 Ga0055543_1003884 3300004625 Bacteria 4227
51 Ga0055543_1029180 3300004625 Bacteria 968
52 Ga0065165_1004840 3300005262 Bacteria 8007
53 Ga0065165_1017569 3300005262 Bacteria 2629
54 Ga0065714_10004042 3300005288 Bacteria 8585
55 Ga0065704_10133195 3300005289 Bacteria 1602
56 Ga0070658_10028498 3300005327 Bacteria 4484
57 Ga0070658_10452388 3300005327 Bacteria 1106
58 Ga0070676_10003654 3300005328 Bacteria 8051
59 Ga0070676_10114210 3300005328 Bacteria 1686
60 Ga0070683_100000790 3300005329 Bacteria 23356
61 Ga0068869_100535024 3300005334 Bacteria 982
62 Ga0070666_10368851 3300005335 Bacteria 1029
63 Ga0070680_100019436 3300005336 Bacteria 5383
64 Ga0070680_100029244 3300005336 Bacteria 4426
65 Ga0070682_100007825 3300005337 Bacteria 6015
66 Ga0070689_100346510 3300005340 Bacteria 1245
67 Ga0070661_100110419 3300005344 Bacteria 2053
68 Ga0070668_100131615 3300005347 Bacteria 2008
69 Ga0070675_100438294 3300005354 Bacteria 1170
70 Ga0070674_100268317 3300005356 Bacteria 1348
71 Ga0070709_10254842 3300005434 Bacteria 1266
72 Ga0070681_10159705 3300005458 Bacteria 2178
73 Ga0068867_100268217 3300005459 Bacteria 1394
74 Ga0070679_100057666 3300005530 Unclassified 3871
75 Ga0070679_100126782 3300005530 Bacteria 2535
76 Ga0068853_100036078 3300005539 Bacteria 4202
77 Ga0068853_100232147 3300005539 Bacteria 1688
78 Ga0068853_100666819 3300005539 Bacteria 991
79 Ga0070665_100039465 3300005548 Bacteria 4746
80 Ga0070665_100285089 3300005548 Bacteria 1654
81 Ga0068855_100055916 3300005563 Bacteria 4632
82 Ga0068855_100080008 3300005563 Bacteria 3790
83 Ga0068855_100277879 3300005563 Bacteria 1861
84 Ga0068855_100358776 3300005563 Bacteria 1604
85 Ga0068855_100367545 3300005563 Bacteria 1582
86 Ga0068855_101211446 3300005563 Bacteria 785
87 Ga0070664_100007978 3300005564 Bacteria 8552
88 Ga0068857_100059733 3300005577 Bacteria 3387
89 Ga0068854_100135220 3300005578 Bacteria 1886
90 Ga0068856_100038473 3300005614 Bacteria 4696
91 Ga0068859_100208092 3300005617 Bacteria 2042
92 Ga0068851_10051078 3300005834 Bacteria 2100
93 Ga0068860_100327594 3300005843 Unclassified 1504
94 Ga0075365_10004226 3300006038 Bacteria 7569
95 Ga0075365_10006167 3300006038 Bacteria 6565
96 Ga0075365_10013778 3300006038 Bacteria 4850
97 Ga0075365_10268847 3300006038 Bacteria 1199
98 Ga0075365_10407273 3300006038 Unclassified 960
99 Ga0075368_10001014 3300006042 Bacteria 8786
100 Ga0075368_10161071 3300006042 Bacteria 940
101 Ga0075363_100003480 3300006048 Bacteria 6700
102 Ga0075363_100178211 3300006048 Bacteria 1208
103 Ga0075363_100192479 3300006048 Bacteria 1163
104 Ga0075364_10008637 3300006051 Bacteria 6093
105 Ga0075364_10008913 3300006051 Bacteria 6008
106 Ga0075364_10027493 3300006051 Bacteria 3634
107 Ga0075364_10040227 3300006051 Bacteria 3032
108 Ga0075432_10007554 3300006058 Bacteria 3703
109 Ga0070716_100006359 3300006173 Bacteria 5767
110 Ga0075362_10011738 3300006177 Bacteria 3457
111 Ga0075362_10064354 3300006177 Bacteria 1663
112 Ga0075362_10162644 3300006177 Bacteria 1075
113 Ga0075367_10004716 3300006178 Bacteria 6700
114 Ga0075367_10451794 3300006178 Bacteria 814
115 Ga0075369_10028077 3300006186 Bacteria 2356
116 Ga0075369_10048636 3300006186 Bacteria 1831
117 Ga0075366_10001300 3300006195 Bacteria 12443
118 Ga0075366_10003213 3300006195 Bacteria 8577
119 Ga0075366_10008907 3300006195 Bacteria 5591
120 Ga0075366_10041421 3300006195 Bacteria 2727
121 Ga0075366_10060494 3300006195 Bacteria 2250
122 Ga0075366_10187532 3300006195 Bacteria 1257
123 Ga0075370_10000780 3300006353 Bacteria 12730
124 Ga0075370_10002390 3300006353 Bacteria 8691
125 Ga0075370_10016460 3300006353 Bacteria 3978
126 Ga0075370_10113329 3300006353 Bacteria 1575
127 Ga0075370_10144971 3300006353 Bacteria 1389
128 Ga0075430_100015261 3300006846 Bacteria 6540
129 Ga0075430_100042562 3300006846 Bacteria 3841
130 Ga0075431_100003069 3300006847 Bacteria 16172
131 Ga0075429_100235572 3300006880 Bacteria 1603
132 Ga0075436_100085530 3300006914 Bacteria 2190
133 Ga0097620_100208088 3300006931 Bacteria 2042
134 Ga0099826_10002851 3300006948 Bacteria 11417
135 Ga0099794_10026857 3300007265 Bacteria 2665
136 Ga0099795_10019960 3300007788 Bacteria 2176
137 Ga0105244_10002657 3300009036 Bacteria 13396
138 Ga0105240_10008406 3300009093 Bacteria 14769
139 Ga0105240_10044959 3300009093 Bacteria 5605
140 Ga0111539_10001310 3300009094 Bacteria 33242
141 Ga0105243_10004818 3300009148 Bacteria 10599
142 Ga0105243_10005046 3300009148 Bacteria 10362
143 Ga0105243_10036317 3300009148 Bacteria 3825
144 Ga0105241_10060812 3300009174 Unclassified 2907
145 Ga0105242_10001329 3300009176 Bacteria 19517
146 Ga0105242_10348159 3300009176 Bacteria 1368
147 Ga0105238_10035099 3300009551 Bacteria 5100
148 Ga0105028_103540 3300009993 Bacteria 1629
149 Ga0105246_10106464 3300011119 Bacteria 2052
150 Ga0105246_10247360 3300011119 Bacteria 1413
151 Ga0157373_10000174 3300013100 Bacteria 52668
152 Ga0157373_10122873 3300013100 Bacteria 1825
153 Ga0157370_10013475 3300013104 Bacteria 8421
154 Ga0163163_10001146 3300014325 Bacteria 22535
155 Ga0163163_11203875 3300014325 Bacteria 820
156 Ga0157380_10407189 3300014326 Bacteria 1292
157 Ga0182008_10001979 3300014497 Bacteria 13156
158 Ga0182008_10002280 3300014497 Bacteria 12100
159 Ga0182008_10082107 3300014497 Bacteria 1586
160 Ga0182006_1001462 3300015261 Bacteria 14236
161 Ga0182006_1062887 3300015261 Bacteria 1395
162 Ga0182007_10000299 3300015262 Bacteria 32151
163 Ga0182007_10042179 3300015262 Bacteria 1519
164 Ga0163161_10001140 3300017792 Bacteria 19990
165 Ga0163161_10082676 3300017792 Bacteria 2366
166 Ga0213872_10023213 3300021361 Bacteria 2854
167 Ga0209672_101027 3300025228 Bacteria 12075
168 Ga0209147_101909 3300025229 Bacteria 6266
169 Ga0209258_100022 3300025242 Bacteria 553584
170 Ga0207425_1000496 3300025245 Bacteria 24684
171 Ga0209148_1000034 3300025254 Bacteria 553584
172 Ga0209129_1000023 3300025258 Bacteria 420646
173 Ga0209129_1001929 3300025258 Bacteria 10868
174 Ga0209129_1002608 3300025258 Bacteria 8601
175 Ga0209565_1000114 3300025263 Bacteria 116078
176 Ga0209565_1000125 3300025263 Bacteria 110485
177 Ga0209565_1000471 3300025263 Bacteria 30241
178 Ga0209673_1000192 3300025273 Bacteria 123155
179 Ga0209673_1001614 3300025273 Bacteria 19696
180 Ga0209673_1001782 3300025273 Bacteria 17830
181 Ga0209673_1002246 3300025273 Bacteria 13947
182 Ga0209130_1000069 3300025284 Bacteria 179177
183 Ga0209130_1001539 3300025284 Bacteria 14744
184 Ga0209675_1000029 3300025291 Bacteria 281053
185 Ga0209675_1000693 3300025291 Bacteria 23430
186 Ga0209675_1000694 3300025291 Bacteria 23424
187 Ga0209675_1002147 3300025291 Bacteria 10398
188 Ga0209676_1000005 3300025292 Bacteria 1076001
189 Ga0209676_1000285 3300025292 Bacteria 104459
190 Ga0209676_1000614 3300025292 Bacteria 52075
191 Ga0209676_1000923 3300025292 Bacteria 36308
192 Ga0209676_1011510 3300025292 Bacteria 3560
193 Ga0209676_1026475 3300025292 Bacteria 1841
194 Ga0209676_1044079 3300025292 Bacteria 1226
195 Ga0209025_1000316 3300025294 Bacteria 107447
196 Ga0209025_1000435 3300025294 Bacteria 82663
197 Ga0209025_1000652 3300025294 Bacteria 60620
198 Ga0209025_1002952 3300025294 Bacteria 16911
199 Ga0209025_1061052 3300025294 Bacteria 1410
200 Ga0209564_1000270 3300025295 Bacteria 108503
201 Ga0209564_1000791 3300025295 Bacteria 43583
202 Ga0209564_1031023 3300025295 Bacteria 1643
203 Ga0209758_1000064 3300025297 Bacteria 311812
204 Ga0209758_1003278 3300025297 Bacteria 15010
205 Ga0209050_1000007 3300025298 Bacteria 1187891
206 Ga0209050_1001583 3300025298 Bacteria 23577
207 Ga0209050_1033076 3300025298 Bacteria 1575
208 Ga0209256_1000020 3300025299 Bacteria 542402
209 Ga0209256_1000022 3300025299 Bacteria 481843
210 Ga0207426_1000001 3300025302 Bacteria 1341301
211 Ga0207426_1000031 3300025302 Bacteria 460699
212 Ga0209051_1000036 3300025303 Bacteria 339863
213 Ga0209051_1000465 3300025303 Bacteria 53039
214 Ga0209051_1000711 3300025303 Bacteria 36515
215 Ga0209051_1001116 3300025303 Bacteria 24506
216 Ga0209051_1004581 3300025303 Bacteria 8446
217 Ga0209257_1000011 3300025304 Bacteria 1112630
218 Ga0209257_1000821 3300025304 Bacteria 45031
219 Ga0209257_1006110 3300025304 Bacteria 7992
220 Ga0209257_1006761 3300025304 Bacteria 7225
221 Ga0207655_1000916 3300025728 Bacteria 30603
222 Ga0207680_10358175 3300025903 Bacteria 1026
223 Ga0207645_10022009 3300025907 Bacteria 4151
224 Ga0207645_10348834 3300025907 Bacteria 990
225 Ga0207705_10197077 3300025909 Bacteria 1525
226 Ga0207705_10342064 3300025909 Bacteria 1152
227 Ga0207707_10075713 3300025912 Bacteria 2937
228 Ga0207695_10029139 3300025913 Bacteria 6108
229 Ga0207660_10069613 3300025917 Unclassified 2556
230 Ga0207660_10175378 3300025917 Bacteria 1662
231 Ga0207660_10538243 3300025917 Bacteria 949
232 Ga0207657_10025239 3300025919 Bacteria 5484
233 Ga0207652_10166015 3300025921 Bacteria 1980
234 Ga0207681_10084940 3300025923 Bacteria 2245
235 Ga0207694_10197101 3300025924 Bacteria 1637
236 Ga0207687_10057424 3300025927 Bacteria 2734
237 Ga0207664_10327231 3300025929 Bacteria 1353
238 Ga0207690_10715605 3300025932 Bacteria 824
239 Ga0207709_10000478 3300025935 Bacteria 36537
240 Ga0207709_10000653 3300025935 Bacteria 28149
241 Ga0207665_10006683 3300025939 Bacteria 7652
242 Ga0207661_10002965 3300025944 Bacteria 11742
243 Ga0207679_10008810 3300025945 Bacteria 6433
244 Ga0207667_10055995 3300025949 Unclassified 4144
245 Ga0207668_11468768 3300025972 Unclassified 615
246 Ga0207639_10017519 3300026041 Bacteria 5079
247 Ga0207639_10744970 3300026041 Bacteria 911
248 Ga0207702_10025529 3300026078 Bacteria 4905
249 Ga0207702_10093728 3300026078 Bacteria 2634
250 Ga0207674_10094142 3300026116 Bacteria 2982
251 Ga0207683_10087308 3300026121 Bacteria 2774
252 Ga0207698_10411764 3300026142 Bacteria 1295
253 Ga0209179_1006148 3300027512 Bacteria 1919
254 Ga0209282_1000094 3300027666 Bacteria 61877
255 Ga0209588_1004797 3300027671 Bacteria 3837
256 Ga0209588_1011598 3300027671 Bacteria 2664
257 Ga0209813_10005486 3300027866 Bacteria 3083
258 Ga0209813_10082942 3300027866 Bacteria 1063
259 Ga0209974_10008414 3300027876 Bacteria 3527
260 Ga0268266_10245149 3300028379 Bacteria 1655
261 Ga0268265_10163604 3300028380 Bacteria 1893
262 Ga0307515_10008425 3300028794 Bacteria 20103
263 Ga0265338_10032966 3300028800 Bacteria 5040
264 Ga0307511_10000058 3300030521 Bacteria 93342
265 Ga0316177_1055055 3300030731 Bacteria 3662
266 Ga0314311_1100942 3300030733 Bacteria 6601
267 Ga0316181_1019206 3300030744 Bacteria 6983
268 Ga0316182_1047971 3300030745 Bacteria 5194
269 Ga0265332_10067153 3300031238 Bacteria 1529
270 Ga0265329_10082943 3300031242 Bacteria 1015
271 Ga0265331_10124280 3300031250 Bacteria 1179
272 Ga0265327_10000017 3300031251 Bacteria 445264
273 Ga0307408_100000068 3300031548 Bacteria 120700
274 Ga0307408_100132601 3300031548 Bacteria 1945
275 Ga0307408_100341473 3300031548 Bacteria 1267
276 Ga0307408_100491632 3300031548 Bacteria 1072
277 Ga0265314_10008715 3300031711 Bacteria 8672
278 Ga0307405_10032313 3300031731 Bacteria 3092
279 Ga0307405_10082305 3300031731 Bacteria 2106
280 Ga0307405_10086786 3300031731 Bacteria 2060
281 Ga0307405_10137454 3300031731 Bacteria 1698
282 Ga0307405_10212619 3300031731 Bacteria 1413
283 Ga0307413_10248791 3300031824 Bacteria 1317
284 Ga0307406_10090663 3300031901 Bacteria 2057
285 Ga0307406_10102637 3300031901 Bacteria 1951
286 Ga0307406_10118449 3300031901 Bacteria 1836
287 Ga0307407_10026099 3300031903 Bacteria 3089
288 Ga0307412_10006621 3300031911 Bacteria 6564
289 Ga0307412_10094973 3300031911 Bacteria 2095
290 Ga0307412_10095465 3300031911 Bacteria 2090
291 Ga0307412_10688084 3300031911 Bacteria 876
292 Ga0307412_10692446 3300031911 Bacteria 874
293 Ga0307416_100444167 3300032002 Bacteria 1348
294 Ga0307414_10036114 3300032004 Bacteria 3295
295 Ga0307414_10269774 3300032004 Bacteria 1424
296 Ga0307414_10628549 3300032004 Bacteria 966
297 Ga0307411_10017336 3300032005 Bacteria 4100
298 Ga0307507_10134508 3300033179 Bacteria 1921
299 Ga0316586_1026312 3300033527 Unclassified 981
300 Ga0373926_0046319 3300035083 Bacteria 1560
301 Ga0373934_0000979 3300035086 Bacteria 10357
302 Ga0373923_0041834 3300035111 Bacteria 1890
303 Ga0373953_0019485 3300035117 Bacteria 2524
304 Ga0373953_0143801 3300035117 Bacteria 1020
305 Ga0373954_0062103 3300035118 Bacteria 1764
306 Ga0373956_0000668 3300035119 Bacteria 14111
307 Ga0373956_0018855 3300035119 Bacteria 2923
308 Ga0373957_0004821 3300035120 Bacteria 4133
309 Ga0373955_0187867 3300035172 Bacteria 1227
310 Ga0373931_0299448 3300035691 Bacteria 993
311 Ga0373935_0036800 3300035692 Bacteria 3061
312 Ga0373927_0024467 3300035695 Bacteria 3950
313 Ga0373933_0000312 3300035724 Bacteria 31477
314 Ga0373947_0116830 3300035725 Bacteria 1692
315 Ga0373937_0000096 3300036401 Bacteria 81963
316 Ga0395899_0001564 3300037312 Bacteria 19269
317 Ga0395899_0010468 3300037312 Bacteria 7102
318 Ga0395899_0093123 3300037312 Bacteria 2181
319 Ga0395900_0008553 3300037418 Bacteria 10523
320 Ga0395900_0011209 3300037418 Bacteria 9167
321 Ga0395900_0013558 3300037418 Bacteria 8326
322 Ga0395900_0076219 3300037418 Bacteria 3447
323 Ga0395898_0004494 3300037466 Bacteria 15256
324 Ga0395898_0007540 3300037466 Bacteria 11555
325 Ga0395898_0007677 3300037466 Bacteria 11451
326 Ga0395905_0000126 3300037471 Bacteria 126035
327 Ga0395905_0015111 3300037471 Bacteria 7347
328 Ga0395905_0024157 3300037471 Bacteria 5736
329 Ga0395905_0037725 3300037471 Bacteria 4535
330 Ga0395905_0048325 3300037471 Bacteria 3987
331 Ga0395905_0070268 3300037471 Bacteria 3280
332 Ga0395905_0094906 3300037471 Bacteria 2798
333 Ga0395905_0125771 3300037471 Bacteria 2410
334 Ga0395905_0386306 3300037471 Bacteria 1294
335 Ga0395901_0015000 3300038443 Bacteria 7876
336 Ga0395901_0017894 3300038443 Bacteria 7233
337 Ga0395901_0084733 3300038443 Bacteria 3312
338 Ga0395901_0160671 3300038443 Bacteria 2360
339 Ga0395901_0160828 3300038443 Bacteria 2358
340 Ga0395901_0250051 3300038443 Bacteria 1847
341 Ga0436361_0940876 3300039447 Bacteria 27043
342 Ga0439436_0012835 3300041404 Bacteria 2540
343 Ga0439442_007645 3300042002 Bacteria 2178
344 Ga0439449_0000873 3300042007 Bacteria 11760
345 Ga0450906_007623 3300042145 Bacteria 2130
346 Ga0450908_036457 3300042184 Bacteria 852
347 Ga0450918_000141 3300042531 Bacteria 15768
348 Ga0451577_0209182 3300042876 Bacteria 1762
349 Ga0466969_0017752 3300044656 Bacteria 3712
350 Ga0466972_0080552 3300044658 Bacteria 1550
351 Ga0466966_0079455 3300044684 Bacteria 2044
352 Ga0466961_0104533 3300044693 Bacteria 1783
353 Ga0453684_0102908 3300044712 Bacteria 3491
354 Ga0453684_0293852 3300044712 Bacteria 1849
355 Ga0466959_0253342 3300045049 Bacteria 1214
356 Ga0451576_0796482 3300045051 Bacteria 992
357 Ga0495627_002002 3300046453 Bacteria 10489
358 Ga0495627_048777 3300046453 Bacteria 1280
359 Ga0495592_0010946 3300046454 Bacteria 6845
360 Ga0495592_0022930 3300046454 Bacteria 4750
361 Ga0495641_0007072 3300046461 Bacteria 7104
362 Ga0495651_0000085 3300046462 Bacteria 68214
363 Ga0495651_0003739 3300046462 Bacteria 11646
364 Ga0495653_0004139 3300046463 Bacteria 11734
365 Ga0495582_0025641 3300046473 Bacteria 3230
366 Ga0495662_0038763 3300046476 Bacteria 2303
367 Ga0495664_0015172 3300046477 Bacteria 4377
368 Ga0495610_0018637 3300046512 Bacteria 3912
369 Ga0495616_0002423 3300046513 Bacteria 12409
370 Ga0495618_0075050 3300046514 Bacteria 2153
371 Ga0495620_0006615 3300046515 Bacteria 6350
372 Ga0495628_0010478 3300046516 Bacteria 7873
373 Ga0495637_0002677 3300046520 Bacteria 9730
374 Ga0495652_0011388 3300046529 Bacteria 8044
375 Ga0495652_0451044 3300046529 Bacteria 900
376 Ga0495654_0032417 3300046530 Bacteria 2649
377 Ga0495665_0019943 3300046531 Bacteria 3605
378 Ga0495640_0015289 3300046533 Bacteria 5777
379 Ga0495587_0047226 3300046536 Bacteria 2553
380 Ga0495645_0004672 3300046543 Bacteria 9347
381 Ga0495622_0103835 3300046557 Bacteria 1302
382 Ga0495633_0007710 3300046558 Bacteria 6159
383 Ga0495634_0025817 3300046642 Bacteria 4103
384 Ga0495625_0003637 3300046660 Bacteria 15115
385 Ga0495625_0036594 3300046660 Bacteria 3607
386 Ga0495635_0056444 3300046663 Bacteria 2703
387 Ga0495657_0003454 3300046675 Bacteria 12887
388 Ga0495599_0019078 3300046678 Bacteria 4275
389 Ga0495649_0000076 3300046694 Bacteria 84939
390 Ga0495600_0001200 3300046809 Bacteria 14187
391 Ga0495600_0181835 3300046809 Bacteria 1355
392 Ga0495660_0070752 3300046810 Bacteria 1851
393 Ga0495604_0140621 3300047317 Bacteria 1725
394 Ga0495636_0002422 3300047318 Bacteria 7152
395 Ga0495676_0037947 3300047321 Bacteria 4005
396 Ga0495680_0266809 3300047322 Bacteria 1209
397 Ga0495675_0133601 3300047444 Bacteria 1541
398 Ga0495684_0008067 3300047471 Bacteria 8144
399 Ga0495593_0024862 3300047673 Bacteria 3315
400 Ga0495593_0158764 3300047673 Bacteria 1142
401 Ga0495614_0085944 3300048089 Bacteria 1365
402 Ga0496100_0130434 3300048903 Bacteria 1770
403 Ga0496111_0396398 3300048914 Bacteria 1020
404 Ga0496116_0035233 3300048919 Bacteria 3517
405 Ga0496116_0128069 3300048919 Bacteria 1453
406 Ga0496117_0025290 3300048920 Bacteria 4671
407 Ga0496117_0097059 3300048920 Bacteria 1878
408 Ga0496118_0015988 3300048921 Bacteria 6910
409 Ga0496121_0051320 3300048924 Bacteria 3474
410 Ga0496121_0079901 3300048924 Bacteria 2594
411 Ga0496121_0091701 3300048924 Bacteria 2371
412 Ga0496121_0369268 3300048924 Bacteria 950
413 Ga0496122_0000428 3300048925 Bacteria 88816
414 Ga0496123_0000890 3300048926 Bacteria 47301
415 Ga0496123_0238266 3300048926 Bacteria 905
416 Ga0496124_0086941 3300048927 Bacteria 2557
417 Ga0496124_0243659 3300048927 Bacteria 1335
418 Ga0496125_0047829 3300048928 Bacteria 3572
419 Ga0496125_0112883 3300048928 Bacteria 1962
420 Ga0496126_0362585 3300048929 Bacteria 1183
421 Ga0501312_026510 3300049528 Bacteria 889
422 Ga0501315_011220 3300049531 Bacteria 1090
423 Ga0501034_0091084 3300049571 Bacteria 3047
424 Ga0501039_0257167 3300049575 Bacteria 1373
425 Ga0501043_0164160 3300049579 Bacteria 1735
426 Ga0501069_0004525 3300049585 Bacteria 7184
427 Ga0501070_0003856 3300049586 Bacteria 12935
428 Ga0501070_0009834 3300049586 Bacteria 8085
429 Ga0501074_0001507 3300049590 Bacteria 15711
430 Ga0501080_0085835 3300049742 Bacteria 2925
431 Ga0501080_0093861 3300049742 Bacteria 2786
432 Ga0501035_0107527 3300049822 Bacteria 2445
433 Ga0501035_0487941 3300049822 Bacteria 1015
434 Ga0501044_0062880 3300049823 Bacteria 3793
435 nmdc:mga03683_114248_c1 3300050489 Bacteria 1196
436 nmdc:mga03683_176389_c1 3300050489 Bacteria 973
437 nmdc:mga03683_192846_c1 3300050489 Bacteria 933
438 nmdc:mga03683_43400_c1 3300050489 Bacteria 1855
439 nmdc:mga03n38_123611_c1 3300050490 Bacteria 1275
440 nmdc:mga00v17_158342_c1 3300050491 Bacteria 1457
441 nmdc:mga00v17_37490_c1 3300050491 Bacteria 2896
442 nmdc:mga0yw44_101849_c1 3300050492 Bacteria 1830
443 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
444 nmdc:mga0yw44_34766_c1 3300050492 Unclassified 2955
445 nmdc:mga0yw44_41836_c1 3300050492 Bacteria 2730
446 nmdc:mga0yw44_728_c1 3300050492 Bacteria 12120
447 nmdc:mga0k408_23_c2 3300050493 Bacteria 40244
448 nmdc:mga0k408_251971_c1 3300050493 Bacteria 1054
449 nmdc:mga0k408_58999_c1 3300050493 Bacteria 2229
450 nmdc:mga0k408_6239_c1 3300050493 Bacteria 6360
451 nmdc:mga0k408_658_c1 3300050493 Bacteria 18912
452 nmdc:mga0k408_8277_c1 3300050493 Bacteria 5580
453 nmdc:mga04h51_524_c1 3300050495 Bacteria 9100
454 nmdc:mga04h51_98376_c1 3300050495 Bacteria 1063
455 nmdc:mga07m45_101136_c2 3300050496 Bacteria 1287
456 nmdc:mga07m45_113812_c1 3300050496 Bacteria 1560
457 nmdc:mga07m45_723_c1 3300050496 Bacteria 14073
458 nmdc:mga07m45_8622_c1 3300050496 Bacteria 5252
459 nmdc:mga07m45_8702_c1 3300050496 Bacteria 5229
460 nmdc:mga09592_2451_c1 3300050508 Bacteria 14964
461 nmdc:mga0qj67_14999_c1 3300050509 Bacteria 5862
462 nmdc:mga06r32_113877_c1 3300050510 Bacteria 2663
463 nmdc:mga0rr50_160269_c1 3300050513 Bacteria 1825
464 nmdc:mga08x19_104770_c1 3300050514 Bacteria 1880
465 nmdc:mga08x19_13687_c1 3300050514 Bacteria 4909
466 nmdc:mga0sz30_13426_c1 3300050516 Bacteria 1637
467 Ga0495601_0002619 3300053077 Bacteria 10205
468 Ga0495601_0056928 3300053077 Bacteria 2476
469 Ga0495612_0033536 3300053078 Bacteria 2078
470 Ga0495619_0003254 3300053085 Bacteria 10513
471 Ga0500643_000011 3300053087 Bacteria 385630
472 Ga0500646_0003085 3300053090 Bacteria 4272
473 Ga0500583_0041556 3300053092 Bacteria 2089
474 Ga0500651_0000982 3300053093 Bacteria 14037
475 Ga0500555_000001 3300053103 Bacteria 1353713
476 Ga0500562_000002 3300053108 Bacteria 977234
477 Ga0500571_000476 3300053110 Bacteria 16306
478 Ga0500607_012928 3300053121 Bacteria 4887
479 Ga0500608_064016 3300053122 Bacteria 1755
480 Ga0500658_0001283 3300053134 Bacteria 10185
481 Ga0500658_0001378 3300053134 Bacteria 9822
482 Ga0500561_0000001 3300053137 Bacteria 957685
483 Ga0500564_151059 3300053138 Bacteria 990
484 Ga0500568_0006223 3300053139 Bacteria 6025
485 Ga0500568_0007039 3300053139 Bacteria 5561
486 Ga0500568_0013279 3300053139 Bacteria 3757
487 Ga0500574_000989 3300053141 Bacteria 3979
488 Ga0500616_0054659 3300053153 Bacteria 2090
489 Ga0500627_0002683 3300053158 Bacteria 5329
490 Ga0500634_0027288 3300053161 Bacteria 3111
491 Ga0500634_0045115 3300053161 Bacteria 2385
492 Ga0500570_000003 3300053724 Bacteria 149500
493 Ga0587072_007378 3300059643 Bacteria 1709
494 Ga0501082_1103082 3300060353 Bacteria 694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0130434 Ga0496100_0130434_1222_1758 178
2 3300025972 Ga0207668_11468768 Ga0207668_114687681 183
3 3300005539 Ga0068853_100666819 Ga0068853_1006668191 187
4 3300046810 Ga0495660_0070752 Ga0495660_0070752_1205_1822 187
5 3300048928 Ga0496125_0112883 Ga0496125_0112883_292_954 187
6 3300053138 Ga0500564_151059 Ga0500564_151059_357_974 187
7 3300002739 JGI25158J39367_1003784 JGI25158J39367_10037842 190
8 3300002774 JGI25150J39212_1006863 JGI25150J39212_10068632 190
9 3300003187 JGI25151J46595_10008683 JGI25151J46595_100086836 190
10 3300003187 JGI25151J46595_10091474 JGI25151J46595_100914741 190
11 3300003215 JGI25153J46596_10007758 JGI25153J46596_100077583 190
12 3300003354 JGI25160J50197_1007500 JGI25160J50197_10075003 190
13 3300003374 JGI25161J50226_1002361 JGI25161J50226_10023611 190
14 3300003578 Ga0006562J51391_1049139 Ga0006562J51391_10491392 190
15 3300003771 Ga0055526_1006879 Ga0055526_10068792 190
16 3300003773 Ga0055537_1002315 Ga0055537_10023156 190
17 3300003775 Ga0055524_1005646 Ga0055524_10056461 190
18 3300003781 Ga0055536_1006273 Ga0055536_10062736 190
19 3300003784 Ga0055534_1011629 Ga0055534_10116291 190
20 3300003790 Ga0055528_1005202 Ga0055528_10052022 190
21 3300003791 Ga0055530_10001721 Ga0055530_1000172110 190
22 3300003792 Ga0055540_1005361 Ga0055540_10053616 190
23 3300003794 Ga0055531_10008224 Ga0055531_100082241 190
24 3300004625 Ga0055543_1003884 Ga0055543_10038845 190
25 3300005262 Ga0065165_1017569 Ga0065165_10175694 190
26 3300025258 Ga0209129_1002608 Ga0209129_10026087 190
27 3300025263 Ga0209565_1000471 Ga0209565_10004719 190
28 3300025273 Ga0209673_1000192 Ga0209673_100019286 190
29 3300025284 Ga0209130_1001539 Ga0209130_100153914 190
30 3300025291 Ga0209675_1000694 Ga0209675_10006949 190
31 3300025291 Ga0209675_1002147 Ga0209675_10021478 190
32 3300025292 Ga0209676_1000005 Ga0209676_1000005679 190
33 3300025292 Ga0209676_1000285 Ga0209676_100028586 190
34 3300025292 Ga0209676_1026475 Ga0209676_10264752 190
35 3300025294 Ga0209025_1002952 Ga0209025_10029525 190
36 3300025294 Ga0209025_1061052 Ga0209025_10610522 190
37 3300025295 Ga0209564_1000791 Ga0209564_100079116 190
38 3300025297 Ga0209758_1003278 Ga0209758_10032787 190
39 3300025298 Ga0209050_1000007 Ga0209050_1000007418 190
40 3300025298 Ga0209050_1033076 Ga0209050_10330762 190
41 3300025299 Ga0209256_1000022 Ga0209256_100002241 190
42 3300025302 Ga0207426_1000031 Ga0207426_1000031197 190
43 3300025303 Ga0209051_1000036 Ga0209051_100003630 190
44 3300025304 Ga0209257_1000011 Ga0209257_1000011653 190
45 3300048919 Ga0496116_0035233 Ga0496116_0035233_1638_2360 190
46 3300048920 Ga0496117_0097059 Ga0496117_0097059_539_1261 190
47 3300048924 Ga0496121_0091701 Ga0496121_0091701_397_1119 190
48 3300014497 Ga0182008_10082107 Ga0182008_100821072 191
49 3300015261 Ga0182006_1062887 Ga0182006_10628871 191
50 3300050496 nmdc:mga07m45_101136_c2 nmdc:mga07m45_101136_c2_309_998 191
51 3300050489 nmdc:mga03683_192846_c1 nmdc:mga03683_192846_c1_169_858 192
52 3300050493 nmdc:mga0k408_251971_c1 nmdc:mga0k408_251971_c1_140_829 192
53 3300003187 JGI25151J46595_10039600 JGI25151J46595_100396001 196
54 3300003773 Ga0055537_1000517 Ga0055537_100051722 196
55 3300003784 Ga0055534_1000797 Ga0055534_10007972 196
56 3300003790 Ga0055528_1004506 Ga0055528_10045062 196
57 3300003792 Ga0055540_1004363 Ga0055540_10043632 196
58 3300005289 Ga0065704_10133195 Ga0065704_101331952 196
59 3300005548 Ga0070665_100039465 Ga0070665_1000394655 196
60 3300006186 Ga0075369_10048636 Ga0075369_100486362 196
61 3300006353 Ga0075370_10016460 Ga0075370_100164602 196
62 3300006353 Ga0075370_10144971 Ga0075370_101449712 196
63 3300006948 Ga0099826_10002851 Ga0099826_1000285111 196
64 3300014497 Ga0182008_10001979 Ga0182008_100019792 196
65 3300015261 Ga0182006_1001462 Ga0182006_10014622 196
66 3300015262 Ga0182007_10000299 Ga0182007_1000029921 196
67 3300025263 Ga0209565_1000114 Ga0209565_100011445 196
68 3300025273 Ga0209673_1001614 Ga0209673_10016147 196
69 3300025291 Ga0209675_1000029 Ga0209675_1000029210 196
70 3300025294 Ga0209025_1000652 Ga0209025_100065215 196
71 3300025295 Ga0209564_1031023 Ga0209564_10310232 196
72 3300025303 Ga0209051_1000465 Ga0209051_10004659 196
73 3300027666 Ga0209282_1000094 Ga0209282_100009429 196
74 3300030731 Ga0316177_1055055 Ga0316177_10550555 196
75 3300030733 Ga0314311_1100942 Ga0314311_11009427 196
76 3300030744 Ga0316181_1019206 Ga0316181_10192065 196
77 3300030745 Ga0316182_1047971 Ga0316182_10479715 196
78 3300031548 Ga0307408_100132601 Ga0307408_1001326012 196
79 3300031548 Ga0307408_100341473 Ga0307408_1003414732 196
80 3300031731 Ga0307405_10032313 Ga0307405_100323132 196
81 3300031901 Ga0307406_10102637 Ga0307406_101026372 196
82 3300031901 Ga0307406_10118449 Ga0307406_101184493 196
83 3300031911 Ga0307412_10095465 Ga0307412_100954653 196
84 3300031911 Ga0307412_10688084 Ga0307412_106880841 196
85 3300032004 Ga0307414_10036114 Ga0307414_100361144 196
86 3300032005 Ga0307411_10017336 Ga0307411_100173363 196
87 3300046453 Ga0495627_002002 Ga0495627_002002_776_1465 196
88 3300046453 Ga0495627_048777 Ga0495627_048777_254_943 196
89 3300046520 Ga0495637_0002677 Ga0495637_0002677_9012_9701 196
90 3300046809 Ga0495600_0181835 Ga0495600_0181835_143_865 196
91 3300048919 Ga0496116_0128069 Ga0496116_0128069_352_1041 196
92 3300050496 nmdc:mga07m45_8702_c1 nmdc:mga07m45_8702_c1_2474_3196 196
93 3300053153 Ga0500616_0054659 Ga0500616_0054659_803_1492 196
94 3300005288 Ga0065714_10004042 Ga0065714_100040427 197
95 3300005459 Ga0068867_100268217 Ga0068867_1002682172 197
96 3300006177 Ga0075362_10162644 Ga0075362_101626442 197
97 3300025273 Ga0209673_1002246 Ga0209673_10022468 197
98 3300025292 Ga0209676_1044079 Ga0209676_10440792 197
99 3300031548 Ga0307408_100491632 Ga0307408_1004916322 197
100 3300031731 Ga0307405_10137454 Ga0307405_101374542 197
101 3300031824 Ga0307413_10248791 Ga0307413_102487912 197
102 3300031903 Ga0307407_10026099 Ga0307407_100260992 197
103 3300031911 Ga0307412_10006621 Ga0307412_100066213 197
104 3300032004 Ga0307414_10269774 Ga0307414_102697742 197
105 3300041404 Ga0439436_0012835 Ga0439436_0012835_1478_2200 197
106 3300042002 Ga0439442_007645 Ga0439442_007645_1359_2081 197
107 3300042145 Ga0450906_007623 Ga0450906_007623_115_837 197
108 3300042184 Ga0450908_036457 Ga0450908_036457_71_793 197
109 3300042531 Ga0450918_000141 Ga0450918_000141_1507_2229 197
110 3300037418 Ga0395900_0011209 Ga0395900_0011209_3231_3947 198
111 3300037471 Ga0395905_0048325 Ga0395905_0048325_2674_3390 198
112 3300037471 Ga0395905_0094906 Ga0395905_0094906_20_736 198
113 3300006038 Ga0075365_10004226 Ga0075365_100042267 199
114 3300006048 Ga0075363_100178211 Ga0075363_1001782112 199
115 3300006051 Ga0075364_10027493 Ga0075364_100274934 199
116 3300006058 Ga0075432_10007554 Ga0075432_100075543 199
117 3300006195 Ga0075366_10060494 Ga0075366_100604942 199
118 3300046660 Ga0495625_0003637 Ga0495625_0003637_12914_13636 199
119 3300050489 nmdc:mga03683_176389_c1 nmdc:mga03683_176389_c1_161_883 199
120 3300050490 nmdc:mga03n38_123611_c1 nmdc:mga03n38_123611_c1_256_978 199
121 3300050491 nmdc:mga00v17_158342_c1 nmdc:mga00v17_158342_c1_169_891 199
122 3300050492 nmdc:mga0yw44_41836_c1 nmdc:mga0yw44_41836_c1_148_870 199
123 3300050493 nmdc:mga0k408_58999_c1 nmdc:mga0k408_58999_c1_1314_2036 199
124 3300053122 Ga0500608_064016 Ga0500608_064016_204_926 200
125 3300002987 JGI25159J45721_1005024 JGI25159J45721_10050245 201
126 3300003187 JGI25151J46595_10007045 JGI25151J46595_100070451 201
127 3300003215 JGI25153J46596_10007108 JGI25153J46596_100071081 201
128 3300003354 JGI25160J50197_1007596 JGI25160J50197_10075965 201
129 3300003374 JGI25161J50226_1002010 JGI25161J50226_10020106 201
130 3300003761 Ga0055535_1000653 Ga0055535_10006532 201
131 3300003762 Ga0055542_1000004 Ga0055542_100000444 201
132 3300003771 Ga0055526_1007672 Ga0055526_10076721 201
133 3300003773 Ga0055537_1002840 Ga0055537_10028401 201
134 3300003775 Ga0055524_1005639 Ga0055524_10056391 201
135 3300003781 Ga0055536_1024330 Ga0055536_10243302 201
136 3300003784 Ga0055534_1003001 Ga0055534_10030011 201
137 3300003790 Ga0055528_1006016 Ga0055528_10060161 201
138 3300003791 Ga0055530_10008861 Ga0055530_100088614 201
139 3300003791 Ga0055530_10011398 Ga0055530_100113982 201
140 3300003792 Ga0055540_1002282 Ga0055540_10022822 201
141 3300003794 Ga0055531_10002807 Ga0055531_100028073 201
142 3300003794 Ga0055531_10008215 Ga0055531_100082151 201
143 3300004625 Ga0055543_1029180 Ga0055543_10291802 201
144 3300005262 Ga0065165_1004840 Ga0065165_10048401 201
145 3300005344 Ga0070661_100110419 Ga0070661_1001104193 201
146 3300005539 Ga0068853_100036078 Ga0068853_1000360784 201
147 3300005564 Ga0070664_100007978 Ga0070664_1000079783 201
148 3300005577 Ga0068857_100059733 Ga0068857_1000597334 201
149 3300005578 Ga0068854_100135220 Ga0068854_1001352202 201
150 3300005834 Ga0068851_10051078 Ga0068851_100510783 201
151 3300006353 Ga0075370_10113329 Ga0075370_101133291 201
152 3300009036 Ga0105244_10002657 Ga0105244_1000265712 201
153 3300009148 Ga0105243_10005046 Ga0105243_100050462 201
154 3300009176 Ga0105242_10348159 Ga0105242_103481592 201
155 3300011119 Ga0105246_10106464 Ga0105246_101064643 201
156 3300011119 Ga0105246_10247360 Ga0105246_102473602 201
157 3300013100 Ga0157373_10122873 Ga0157373_101228732 201
158 3300017792 Ga0163161_10082676 Ga0163161_100826763 201
159 3300025228 Ga0209672_101027 Ga0209672_1010271 201
160 3300025229 Ga0209147_101909 Ga0209147_1019094 201
161 3300025242 Ga0209258_100022 Ga0209258_10002244 201
162 3300025245 Ga0207425_1000496 Ga0207425_100049615 201
163 3300025254 Ga0209148_1000034 Ga0209148_100003444 201
164 3300025258 Ga0209129_1000023 Ga0209129_1000023122 201
165 3300025263 Ga0209565_1000125 Ga0209565_100012582 201
166 3300025273 Ga0209673_1001782 Ga0209673_10017827 201
167 3300025284 Ga0209130_1000069 Ga0209130_1000069125 201
168 3300025291 Ga0209675_1000693 Ga0209675_100069314 201
169 3300025292 Ga0209676_1000923 Ga0209676_100092314 201
170 3300025292 Ga0209676_1011510 Ga0209676_10115105 201
171 3300025294 Ga0209025_1000316 Ga0209025_100031665 201
172 3300025295 Ga0209564_1000270 Ga0209564_100027016 201
173 3300025297 Ga0209758_1000064 Ga0209758_100006423 201
174 3300025298 Ga0209050_1001583 Ga0209050_100158310 201
175 3300025299 Ga0209256_1000020 Ga0209256_1000020394 201
176 3300025302 Ga0207426_1000001 Ga0207426_10000011029 201
177 3300025303 Ga0209051_1001116 Ga0209051_100111610 201
178 3300025303 Ga0209051_1004581 Ga0209051_10045817 201
179 3300025304 Ga0209257_1000821 Ga0209257_100082132 201
180 3300025304 Ga0209257_1006110 Ga0209257_10061101 201
181 3300025728 Ga0207655_1000916 Ga0207655_100091618 201
182 3300025935 Ga0207709_10000653 Ga0207709_1000065312 201
183 3300025945 Ga0207679_10008810 Ga0207679_100088103 201
184 3300026041 Ga0207639_10017519 Ga0207639_100175193 201
185 3300026041 Ga0207639_10744970 Ga0207639_107449701 201
186 3300026116 Ga0207674_10094142 Ga0207674_100941423 201
187 3300028380 Ga0268265_10163604 Ga0268265_101636043 201
188 3300028794 Ga0307515_10008425 Ga0307515_1000842514 201
189 3300046512 Ga0495610_0018637 Ga0495610_0018637_2452_3174 201
190 3300046513 Ga0495616_0002423 Ga0495616_0002423_6997_7719 201
191 3300046515 Ga0495620_0006615 Ga0495620_0006615_132_854 201
192 3300046530 Ga0495654_0032417 Ga0495654_0032417_1879_2601 201
193 3300046557 Ga0495622_0103835 Ga0495622_0103835_532_1254 201
194 3300046660 Ga0495625_0036594 Ga0495625_0036594_1414_2136 201
195 3300047321 Ga0495676_0037947 Ga0495676_0037947_1220_1942 201
196 3300047673 Ga0495593_0024862 Ga0495593_0024862_1504_2226 201
197 3300048089 Ga0495614_0085944 Ga0495614_0085944_36_758 201
198 3300048920 Ga0496117_0025290 Ga0496117_0025290_481_1203 201
199 3300048921 Ga0496118_0015988 Ga0496118_0015988_438_1160 201
200 3300048924 Ga0496121_0051320 Ga0496121_0051320_1932_2654 201
201 3300048926 Ga0496123_0238266 Ga0496123_0238266_170_892 201
202 3300048927 Ga0496124_0243659 Ga0496124_0243659_314_1036 201
203 3300053093 Ga0500651_0000982 Ga0500651_0000982_11846_12568 201
204 3300053110 Ga0500571_000476 Ga0500571_000476_1427_2149 201
205 3300053121 Ga0500607_012928 Ga0500607_012928_2864_3586 201
206 3300053134 Ga0500658_0001283 Ga0500658_0001283_1508_2230 201
207 3300053134 Ga0500658_0001378 Ga0500658_0001378_1321_2043 201
208 3300053139 Ga0500568_0007039 Ga0500568_0007039_1654_2376 201
209 3300053141 Ga0500574_000989 Ga0500574_000989_1849_2571 201
210 3300053158 Ga0500627_0002683 Ga0500627_0002683_1625_2347 201
211 3300053161 Ga0500634_0027288 Ga0500634_0027288_1443_2165 201
212 3300053161 Ga0500634_0045115 Ga0500634_0045115_303_1025 201
213 3300059643 Ga0587072_007378 Ga0587072_007378_687_1409 201
214 3300009148 Ga0105243_10004818 Ga0105243_100048185 202
215 3300003792 Ga0055540_1017192 Ga0055540_10171922 203
216 3300025927 Ga0207687_10057424 Ga0207687_100574242 204
217 3300005563 Ga0068855_100367545 Ga0068855_1003675452 205
218 3300025909 Ga0207705_10197077 Ga0207705_101970772 205
219 3300025932 Ga0207690_10715605 Ga0207690_107156051 205
220 3300031238 Ga0265332_10067153 Ga0265332_100671532 205
221 3300031242 Ga0265329_10082943 Ga0265329_100829432 205
222 3300031711 Ga0265314_10008715 Ga0265314_100087151 205
223 3300037418 Ga0395900_0013558 Ga0395900_0013558_6617_7339 205
224 3300037466 Ga0395898_0007677 Ga0395898_0007677_8983_9705 205
225 3300037471 Ga0395905_0125771 Ga0395905_0125771_718_1440 205
226 3300037471 Ga0395905_0386306 Ga0395905_0386306_376_1098 205
227 3300038443 Ga0395901_0084733 Ga0395901_0084733_1493_2215 205
228 3300038443 Ga0395901_0250051 Ga0395901_0250051_79_801 205
229 3300037471 Ga0395905_0070268 Ga0395905_0070268_464_1186 206
230 3300044656 Ga0466969_0017752 Ga0466969_0017752_2437_3159 206
231 3300045049 Ga0466959_0253342 Ga0466959_0253342_312_1034 206
232 3300049571 Ga0501034_0091084 Ga0501034_0091084_997_1719 206
233 3300049579 Ga0501043_0164160 Ga0501043_0164160_341_1063 206
234 3300049742 Ga0501080_0093861 Ga0501080_0093861_623_1345 206
235 3300049822 Ga0501035_0487941 Ga0501035_0487941_185_907 206
236 3300050489 nmdc:mga03683_114248_c1 nmdc:mga03683_114248_c1_160_882 206
237 3300003781 Ga0055536_1024284 Ga0055536_10242842 207
238 3300003792 Ga0055540_1003550 Ga0055540_10035502 207
239 3300006177 Ga0075362_10064354 Ga0075362_100643541 207
240 3300025292 Ga0209676_1000614 Ga0209676_100061440 207
241 3300025303 Ga0209051_1000711 Ga0209051_100071114 207
242 3300025304 Ga0209257_1006761 Ga0209257_10067612 207
243 3300025935 Ga0207709_10000478 Ga0207709_1000047814 207
244 3300049528 Ga0501312_026510 Ga0501312_026510_141_863 207
245 3300005563 Ga0068855_101211446 Ga0068855_1012114461 208
246 3300026142 Ga0207698_10411764 Ga0207698_104117642 208
247 3300049575 Ga0501039_0257167 Ga0501039_0257167_555_1271 208
248 3300049822 Ga0501035_0107527 Ga0501035_0107527_629_1345 208
249 3300049823 Ga0501044_0062880 Ga0501044_0062880_1506_2222 208
250 3300031911 Ga0307412_10692446 Ga0307412_106924461 209
251 3300037312 Ga0395899_0001564 Ga0395899_0001564_1408_2130 209
252 3300037418 Ga0395900_0008553 Ga0395900_0008553_6761_7483 209
253 3300037466 Ga0395898_0004494 Ga0395898_0004494_543_1265 209
254 3300037471 Ga0395905_0015111 Ga0395905_0015111_1408_2130 209
255 3300038443 Ga0395901_0160828 Ga0395901_0160828_181_903 209
256 3300025923 Ga0207681_10084940 Ga0207681_100849403 210
257 3300048924 Ga0496121_0369268 Ga0496121_0369268_216_938 210
258 3300048925 Ga0496122_0000428 Ga0496122_0000428_63876_64598 210
259 3300048926 Ga0496123_0000890 Ga0496123_0000890_22364_23086 210
260 3300048927 Ga0496124_0086941 Ga0496124_0086941_358_1080 210
261 3300037471 Ga0395905_0000126 Ga0395905_0000126_4747_5469 211
262 3300050496 nmdc:mga07m45_8622_c1 nmdc:mga07m45_8622_c1_1309_1998 211
263 3300060353 Ga0501082_1103082 Ga0501082_1103082_34_672 212
264 3300015262 Ga0182007_10042179 Ga0182007_100421792 213
265 3300021361 Ga0213872_10023213 Ga0213872_100232131 213
266 3300039447 Ga0436361_0940876 Ga0436361_0940876_17350_18072 213
267 3300048924 Ga0496121_0079901 Ga0496121_0079901_1526_2248 214
268 3300048928 Ga0496125_0047829 Ga0496125_0047829_1475_2197 214
269 3300048929 Ga0496126_0362585 Ga0496126_0362585_276_998 214
270 3300027876 Ga0209974_10008414 Ga0209974_100084144 215
271 3300031548 Ga0307408_100000068 Ga0307408_100000068107 215
272 3300031731 Ga0307405_10086786 Ga0307405_100867862 215
273 3300031901 Ga0307406_10090663 Ga0307406_100906633 215
274 3300003187 JGI25151J46595_10002542 JGI25151J46595_100025429 216
275 3300006048 Ga0075363_100192479 Ga0075363_1001924792 216
276 3300006051 Ga0075364_10040227 Ga0075364_100402272 216
277 3300006178 Ga0075367_10451794 Ga0075367_104517941 216
278 3300006353 Ga0075370_10002390 Ga0075370_100023902 216
279 3300009148 Ga0105243_10036317 Ga0105243_100363174 216
280 3300009176 Ga0105242_10001329 Ga0105242_1000132918 216
281 3300014497 Ga0182008_10002280 Ga0182008_1000228011 216
282 3300017792 Ga0163161_10001140 Ga0163161_100011408 216
283 3300025258 Ga0209129_1001929 Ga0209129_10019293 216
284 3300025294 Ga0209025_1000435 Ga0209025_100043540 216
285 3300031731 Ga0307405_10082305 Ga0307405_100823053 216
286 3300031911 Ga0307412_10094973 Ga0307412_100949732 216
287 3300032002 Ga0307416_100444167 Ga0307416_1004441672 216
288 3300032004 Ga0307414_10628549 Ga0307414_106285492 216
289 3300046558 Ga0495633_0007710 Ga0495633_0007710_428_1147 216
290 iso_pu_bacteria 2831265667 2831267016 216
291 iso_pu_bacteria 2899924645 2899925183 216
292 3300005327 Ga0070658_10452388 Ga0070658_104523882 217
293 3300044658 Ga0466972_0080552 Ga0466972_0080552_116_838 217
294 3300044684 Ga0466966_0079455 Ga0466966_0079455_37_759 217
295 3300037471 Ga0395905_0037725 Ga0395905_0037725_3549_4271 218
296 3300005334 Ga0068869_100535024 Ga0068869_1005350241 219
297 3300037312 Ga0395899_0010468 Ga0395899_0010468_5850_6566 219
298 3300038443 Ga0395901_0017894 Ga0395901_0017894_2001_2717 219
299 3300042007 Ga0439449_0000873 Ga0439449_0000873_9444_10163 219
300 3300006195 Ga0075366_10187532 Ga0075366_101875322 220
301 3300030521 Ga0307511_10000058 Ga0307511_1000005850 220
302 3300035691 Ga0373931_0299448 Ga0373931_0299448_178_840 220
303 3300048914 Ga0496111_0396398 Ga0496111_0396398_331_993 220
304 3300006353 Ga0075370_10000780 Ga0075370_1000078011 222
305 3300014325 Ga0163163_11203875 Ga0163163_112038751 222
306 3300044693 Ga0466961_0104533 Ga0466961_0104533_784_1500 222
307 3300044712 Ga0453684_0102908 Ga0453684_0102908_777_1487 222
308 3300044712 Ga0453684_0293852 Ga0453684_0293852_638_1360 222
309 3300045051 Ga0451576_0796482 Ga0451576_0796482_48_770 222
310 3300050496 nmdc:mga07m45_723_c1 nmdc:mga07m45_723_c1_9719_10429 222
311 3300006846 Ga0075430_100042562 Ga0075430_1000425622 223
312 3300006880 Ga0075429_100235572 Ga0075429_1002355722 223
313 3300049531 Ga0501315_011220 Ga0501315_011220_326_1045 223
314 3300050508 nmdc:mga09592_2451_c1 nmdc:mga09592_2451_c1_188_904 223
315 3300005327 Ga0070658_10028498 Ga0070658_100284982 224
316 3300005336 Ga0070680_100029244 Ga0070680_1000292442 224
317 3300005356 Ga0070674_100268317 Ga0070674_1002683172 224
318 3300005458 Ga0070681_10159705 Ga0070681_101597053 224
319 3300005530 Ga0070679_100126782 Ga0070679_1001267823 224
320 3300005548 Ga0070665_100285089 Ga0070665_1002850892 224
321 3300005563 Ga0068855_100080008 Ga0068855_1000800082 224
322 3300009093 Ga0105240_10008406 Ga0105240_100084064 224
323 3300009551 Ga0105238_10035099 Ga0105238_100350992 224
324 3300025907 Ga0207645_10348834 Ga0207645_103488342 224
325 3300025909 Ga0207705_10342064 Ga0207705_103420642 224
326 3300025912 Ga0207707_10075713 Ga0207707_100757133 224
327 3300025913 Ga0207695_10029139 Ga0207695_100291395 224
328 3300025917 Ga0207660_10175378 Ga0207660_101753782 224
329 3300025917 Ga0207660_10538243 Ga0207660_105382431 224
330 3300025919 Ga0207657_10025239 Ga0207657_100252392 224
331 3300025921 Ga0207652_10166015 Ga0207652_101660152 224
332 3300025924 Ga0207694_10197101 Ga0207694_101971012 224
333 3300025929 Ga0207664_10327231 Ga0207664_103272311 224
334 3300026078 Ga0207702_10093728 Ga0207702_100937283 224
335 3300026121 Ga0207683_10087308 Ga0207683_100873083 224
336 3300028379 Ga0268266_10245149 Ga0268266_102451491 224
337 3300038443 Ga0395901_0160671 Ga0395901_0160671_664_1386 224
338 iso_pu_bacteria 2904479285 2904481091 224
339 3300005335 Ga0070666_10368851 Ga0070666_103688512 227
340 3300005336 Ga0070680_100019436 Ga0070680_1000194365 227
341 3300005347 Ga0070668_100131615 Ga0070668_1001316153 227
342 3300005563 Ga0068855_100055916 Ga0068855_1000559165 227
343 3300025903 Ga0207680_10358175 Ga0207680_103581751 227
344 3300025917 Ga0207660_10069613 Ga0207660_100696133 227
345 3300025949 Ga0207667_10055995 Ga0207667_100559952 227
346 3300006846 Ga0075430_100015261 Ga0075430_1000152615 230
347 3300006847 Ga0075431_100003069 Ga0075431_10000306915 230
348 3300050509 nmdc:mga0qj67_14999_c1 nmdc:mga0qj67_14999_c1_4282_5082 230
349 3300050510 nmdc:mga06r32_113877_c1 nmdc:mga06r32_113877_c1_1108_1908 230
350 3300005328 Ga0070676_10114210 Ga0070676_101142102 234
351 3300005337 Ga0070682_100007825 Ga0070682_1000078253 234
352 3300005340 Ga0070689_100346510 Ga0070689_1003465102 234
353 3300005354 Ga0070675_100438294 Ga0070675_1004382942 234
354 3300005434 Ga0070709_10254842 Ga0070709_102548422 234
355 3300005563 Ga0068855_100277879 Ga0068855_1002778792 234
356 3300005614 Ga0068856_100038473 Ga0068856_1000384732 234
357 3300005617 Ga0068859_100208092 Ga0068859_1002080921 234
358 3300005843 Ga0068860_100327594 Ga0068860_1003275941 234
359 3300006038 Ga0075365_10013778 Ga0075365_100137782 234
360 3300006038 Ga0075365_10268847 Ga0075365_102688471 234
361 3300006042 Ga0075368_10001014 Ga0075368_100010143 234
362 3300006042 Ga0075368_10161071 Ga0075368_101610711 234
363 3300006048 Ga0075363_100003480 Ga0075363_1000034805 234
364 3300006051 Ga0075364_10008637 Ga0075364_100086375 234
365 3300006177 Ga0075362_10011738 Ga0075362_100117382 234
366 3300006178 Ga0075367_10004716 Ga0075367_100047165 234
367 3300006186 Ga0075369_10028077 Ga0075369_100280772 234
368 3300006195 Ga0075366_10003213 Ga0075366_100032135 234
369 3300006195 Ga0075366_10008907 Ga0075366_100089075 234
370 3300006931 Ga0097620_100208088 Ga0097620_1002080881 234
371 3300009993 Ga0105028_103540 Ga0105028_1035401 234
372 3300014325 Ga0163163_10001146 Ga0163163_100011465 234
373 3300014326 Ga0157380_10407189 Ga0157380_104071891 234
374 3300026078 Ga0207702_10025529 Ga0207702_100255294 234
375 3300027866 Ga0209813_10005486 Ga0209813_100054863 234
376 3300027866 Ga0209813_10082942 Ga0209813_100829422 234
377 3300028800 Ga0265338_10032966 Ga0265338_100329664 234
378 3300031250 Ga0265331_10124280 Ga0265331_101242802 234
379 3300031251 Ga0265327_10000017 Ga0265327_10000017386 234
380 3300031731 Ga0307405_10212619 Ga0307405_102126192 234
381 3300033179 Ga0307507_10134508 Ga0307507_101345083 234
382 3300033527 Ga0316586_1026312 Ga0316586_10263122 234
383 3300037312 Ga0395899_0093123 Ga0395899_0093123_366_1079 234
384 3300037418 Ga0395900_0076219 Ga0395900_0076219_1103_1816 234
385 3300037466 Ga0395898_0007540 Ga0395898_0007540_8333_9046 234
386 3300037471 Ga0395905_0024157 Ga0395905_0024157_976_1689 234
387 3300038443 Ga0395901_0015000 Ga0395901_0015000_4329_5042 234
388 3300042876 Ga0451577_0209182 Ga0451577_0209182_225_947 234
389 3300046694 Ga0495649_0000076 Ga0495649_0000076_63470_64177 234
390 3300050489 nmdc:mga03683_43400_c1 nmdc:mga03683_43400_c1_11_730 234
391 3300050491 nmdc:mga00v17_37490_c1 nmdc:mga00v17_37490_c1_11_730 234
392 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_518881_519591 234
393 3300050492 nmdc:mga0yw44_728_c1 nmdc:mga0yw44_728_c1_3351_4070 234
394 3300050493 nmdc:mga0k408_6239_c1 nmdc:mga0k408_6239_c1_253_981 234
395 3300050493 nmdc:mga0k408_8277_c1 nmdc:mga0k408_8277_c1_11_730 234
396 3300050495 nmdc:mga04h51_524_c1 nmdc:mga04h51_524_c1_1383_2102 234
397 3300050495 nmdc:mga04h51_98376_c1 nmdc:mga04h51_98376_c1_166_885 234
398 3300050496 nmdc:mga07m45_113812_c1 nmdc:mga07m45_113812_c1_32_751 234
399 3300050513 nmdc:mga0rr50_160269_c1 nmdc:mga0rr50_160269_c1_686_1405 234
400 3300050514 nmdc:mga08x19_104770_c1 nmdc:mga08x19_104770_c1_823_1542 234
401 3300050516 nmdc:mga0sz30_13426_c1 nmdc:mga0sz30_13426_c1_486_1205 234
402 3300053087 Ga0500643_000011 Ga0500643_000011_201195_201902 234
403 3300053090 Ga0500646_0003085 Ga0500646_0003085_747_1466 234
404 3300053092 Ga0500583_0041556 Ga0500583_0041556_1339_2058 234
405 3300053103 Ga0500555_000001 Ga0500555_000001_1141956_1142660 234
406 3300053108 Ga0500562_000002 Ga0500562_000002_47445_48152 234
407 3300053139 Ga0500568_0006223 Ga0500568_0006223_4057_4764 234
408 3300053139 Ga0500568_0013279 Ga0500568_0013279_870_1589 234
409 3300053724 Ga0500570_000003 Ga0500570_000003_28865_29569 234
410 iso_pu_bacteria 2547132374 2548496912 234
411 iso_pu_bacteria 2643221570 2643864980 234
412 iso_pu_bacteria 2643221596 2643990357 234
413 iso_pu_bacteria 2643221609 2644062483 234
414 iso_pu_bacteria 2643221611 2644076486 234
415 iso_pu_bacteria 2643221628 2644159518 234
416 iso_pu_bacteria 2643221652 2644295999 234
417 iso_pu_bacteria 2643221683 2644468507 234
418 iso_pu_bacteria 2643221717 2644645584 234
419 iso_pu_bacteria 2738543012 2739245432 234
420 iso_pu_bacteria 2816332133 2816474795 234
421 iso_pu_bacteria 2881101125 2881103165 234
422 iso_pu_bacteria 2894023352 2894026479 234
423 iso_pu_bacteria 2928115317 2928116346 234
424 iso_pu_bacteria 2932422444 2932424241 234
425 iso_pu_bacteria 2990710928 2990711879 234
426 3300001990 JGI24737J22298_10000007 JGI24737J22298_1000000720 235
427 3300002067 JGI24735J21928_10000034 JGI24735J21928_1000003427 235
428 3300002244 JGI24742J22300_10000005 JGI24742J22300_100000054 235
429 3300003320 rootH2_10224510 rootH2_102245103 235
430 3300005328 Ga0070676_10003654 Ga0070676_100036549 235
431 3300006038 Ga0075365_10006167 Ga0075365_100061676 235
432 3300006051 Ga0075364_10008913 Ga0075364_100089139 235
433 3300006195 Ga0075366_10041421 Ga0075366_100414214 235
434 3300025907 Ga0207645_10022009 Ga0207645_100220093 235
435 3300050492 nmdc:mga0yw44_101849_c1 nmdc:mga0yw44_101849_c1_726_1436 235
436 3300050493 nmdc:mga0k408_23_c2 nmdc:mga0k408_23_c2_38318_39028 235
437 3300053137 Ga0500561_0000001 Ga0500561_0000001_216695_217402 235
438 3300006038 Ga0075365_10407273 Ga0075365_104072731 236
439 3300006173 Ga0070716_100006359 Ga0070716_1000063596 236
440 3300006195 Ga0075366_10001300 Ga0075366_1000130012 236
441 3300006914 Ga0075436_100085530 Ga0075436_1000855302 236
442 3300007265 Ga0099794_10026857 Ga0099794_100268572 236
443 3300007788 Ga0099795_10019960 Ga0099795_100199602 236
444 3300025939 Ga0207665_10006683 Ga0207665_100066832 236
445 3300027512 Ga0209179_1006148 Ga0209179_10061483 236
446 3300027671 Ga0209588_1004797 Ga0209588_10047974 236
447 3300027671 Ga0209588_1011598 Ga0209588_10115983 236
448 3300035083 Ga0373926_0046319 Ga0373926_0046319_333_1088 236
449 3300035086 Ga0373934_0000979 Ga0373934_0000979_4507_5262 236
450 3300035111 Ga0373923_0041834 Ga0373923_0041834_12_767 236
451 3300035117 Ga0373953_0019485 Ga0373953_0019485_808_1563 236
452 3300035117 Ga0373953_0143801 Ga0373953_0143801_128_853 236
453 3300035118 Ga0373954_0062103 Ga0373954_0062103_631_1356 236
454 3300035119 Ga0373956_0000668 Ga0373956_0000668_1631_2386 236
455 3300035119 Ga0373956_0018855 Ga0373956_0018855_981_1736 236
456 3300035120 Ga0373957_0004821 Ga0373957_0004821_254_1009 236
457 3300035172 Ga0373955_0187867 Ga0373955_0187867_238_963 236
458 3300035692 Ga0373935_0036800 Ga0373935_0036800_114_869 236
459 3300035695 Ga0373927_0024467 Ga0373927_0024467_1401_2156 236
460 3300035724 Ga0373933_0000312 Ga0373933_0000312_3384_4139 236
461 3300035725 Ga0373947_0116830 Ga0373947_0116830_900_1655 236
462 3300036401 Ga0373937_0000096 Ga0373937_0000096_30505_31260 236
463 3300046454 Ga0495592_0010946 Ga0495592_0010946_4655_5410 236
464 3300046454 Ga0495592_0022930 Ga0495592_0022930_22_777 236
465 3300046461 Ga0495641_0007072 Ga0495641_0007072_3974_4729 236
466 3300046462 Ga0495651_0000085 Ga0495651_0000085_54434_55189 236
467 3300046462 Ga0495651_0003739 Ga0495651_0003739_2854_3609 236
468 3300046463 Ga0495653_0004139 Ga0495653_0004139_2910_3665 236
469 3300046473 Ga0495582_0025641 Ga0495582_0025641_1669_2424 236
470 3300046476 Ga0495662_0038763 Ga0495662_0038763_675_1430 236
471 3300046477 Ga0495664_0015172 Ga0495664_0015172_1823_2578 236
472 3300046514 Ga0495618_0075050 Ga0495618_0075050_548_1303 236
473 3300046516 Ga0495628_0010478 Ga0495628_0010478_4564_5319 236
474 3300046529 Ga0495652_0011388 Ga0495652_0011388_3382_4137 236
475 3300046529 Ga0495652_0451044 Ga0495652_0451044_44_799 236
476 3300046531 Ga0495665_0019943 Ga0495665_0019943_26_751 236
477 3300046533 Ga0495640_0015289 Ga0495640_0015289_676_1431 236
478 3300046536 Ga0495587_0047226 Ga0495587_0047226_30_785 236
479 3300046543 Ga0495645_0004672 Ga0495645_0004672_6941_7696 236
480 3300046642 Ga0495634_0025817 Ga0495634_0025817_3177_3932 236
481 3300046663 Ga0495635_0056444 Ga0495635_0056444_1651_2376 236
482 3300046675 Ga0495657_0003454 Ga0495657_0003454_11650_12405 236
483 3300046678 Ga0495599_0019078 Ga0495599_0019078_1023_1778 236
484 3300046809 Ga0495600_0001200 Ga0495600_0001200_7899_8654 236
485 3300047317 Ga0495604_0140621 Ga0495604_0140621_808_1533 236
486 3300047318 Ga0495636_0002422 Ga0495636_0002422_1806_2561 236
487 3300047322 Ga0495680_0266809 Ga0495680_0266809_238_963 236
488 3300047444 Ga0495675_0133601 Ga0495675_0133601_112_867 236
489 3300047471 Ga0495684_0008067 Ga0495684_0008067_6106_6861 236
490 3300047673 Ga0495593_0158764 Ga0495593_0158764_308_1063 236
491 3300050492 nmdc:mga0yw44_34766_c1 nmdc:mga0yw44_34766_c1_718_1488 236
492 3300050493 nmdc:mga0k408_658_c1 nmdc:mga0k408_658_c1_11722_12492 236
493 3300050514 nmdc:mga08x19_13687_c1 nmdc:mga08x19_13687_c1_1968_2723 236
494 3300053077 Ga0495601_0002619 Ga0495601_0002619_4517_5272 236
495 3300053077 Ga0495601_0056928 Ga0495601_0056928_320_1075 236
496 3300053078 Ga0495612_0033536 Ga0495612_0033536_252_1007 236
497 3300053085 Ga0495619_0003254 Ga0495619_0003254_8780_9535 236
498 3300005530 Ga0070679_100057666 Ga0070679_1000576663 237
499 3300005539 Ga0068853_100232147 Ga0068853_1002321472 237
500 3300005563 Ga0068855_100358776 Ga0068855_1003587761 237
501 3300009094 Ga0111539_10001310 Ga0111539_1000131019 237
502 3300013104 Ga0157370_10013475 Ga0157370_100134755 237
503 3300049585 Ga0501069_0004525 Ga0501069_0004525_3327_4067 240
504 3300049586 Ga0501070_0003856 Ga0501070_0003856_3131_3871 240
505 3300049586 Ga0501070_0009834 Ga0501070_0009834_1308_2048 240
506 3300049590 Ga0501074_0001507 Ga0501074_0001507_7029_7769 240
507 3300049742 Ga0501080_0085835 Ga0501080_0085835_587_1327 240
508 3300001979 JGI24740J21852_10044778 JGI24740J21852_100447782 246
509 3300005329 Ga0070683_100000790 Ga0070683_10000079015 246
510 3300009093 Ga0105240_10044959 Ga0105240_100449593 246
511 3300009174 Ga0105241_10060812 Ga0105241_100608124 246
512 3300013100 Ga0157373_10000174 Ga0157373_1000017452 246
513 3300025944 Ga0207661_10002965 Ga0207661_100029656 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

23

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.9609 1 234
2bnd-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with udp 0.9585 1 234
2bne-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with ump 0.9578 1 234
4a7w-assembly1.cif.gz_B crystal structure of uridylate kinase from helicobacter pylori 0.957 3 233
4a7x-assembly2.cif.gz_C crystal structure of uridylate kinase from helicobacter pylori 0.9564 3 233
ID Description Score Start End Superfamily
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9519 2 234 3.40.1160.10
af_A0A1D6G3Z5_82_358_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9385 1 237 3.40.1160.10
2jjxC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9323 2 237 3.40.1160.10
3ek5B00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9271 2 237 3.40.1160.10
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9137 2 234 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A4Q5NF69-F1-model_v4 deleted 0.9741 1 233
AF-A0A1F7RCI6-F1-model_v4 Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK) 0.9685 2 237 GO:0005524
GO:0005737
GO:0006225
GO:0033862
GO:0044210
AF-A0A4Q5NF69-F1-model_v4 deleted 0.9659 1 233
AF-A0A7C5VI28-F1-model_v4 Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK) 0.9633 2 234 GO:0005524
GO:0005737
GO:0006225
GO:0033862
GO:0044210
AF-A0A3B8QNA9-F1-model_v4 deleted 0.9632 2 234

Feature Viewer

pLDDT pTM Quality
88.74 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map