F457564

General Info

Members Datasets Scaffolds Average Seq Length
513 303 1026 340

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10073121|Ga0157370_100731213
Length 397
Sequence VSLLAMAWGQSALMLADTPLSRAGSFPQVLRLTDGRWQTSLSSALKPIMAGAVLRGDEDLLTGRWTWIVMLAGVLSGCGNGDSLERFDGPTMGSRYSIQYVRHSSTPGPKAVQTEVENILAEVDRLFSTYRSDSVIERFNALPADRCQVMPGPVLELIRVGEQLSSQSEGSYDLTVEPLLNLWGFGPQGRKEKVPTAEALAEVRQRVGHAHLRIDGDKLCKDAAVEVDFNSIAAGYAVDTIAAKLEAMGIHNYLAEATGELKAAGKKLDGSPWRIALEEPRDDQQVAERIIAVDGYGVSTSGDYRNYFEQDGRRYSHTFDARSGAPVLHALASVTVIHPSALMADGLSTLLLILGPERGWDYAEAHDIGAFFVIRADTGFVTRTTQAFERLSGGKTE

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
16 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
55 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
58 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
74 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
75 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
76 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
77 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
78 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
79 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
80 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
81 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
84 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
85 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
86 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
87 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
90 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
91 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
92 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
174 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
175 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
178 2511231004 Pseudomonas sp. GM102 Isolate Nodule
179 2511231007 Pseudomonas sp. GM18 Isolate Nodule
180 2511231008 Pseudomonas sp. GM21 Isolate Nodule
181 2511231010 Pseudomonas sp. GM25 Isolate Nodule
182 2511231016 Pseudomonas sp. GM50 Isolate Nodule
183 2511231018 Pseudomonas sp. GM60 Isolate Nodule
184 2511231019 Pseudomonas sp. GM67 Isolate Nodule
185 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
186 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
187 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
188 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
189 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
190 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
191 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
192 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
193 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
194 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
195 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
196 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
197 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
198 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
199 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
200 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
201 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
202 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
203 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
204 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
205 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
206 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
207 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
208 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
209 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
210 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
211 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
212 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
213 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
214 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
215 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
216 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
217 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
218 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
219 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
220 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
221 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
222 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
223 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
224 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
225 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
226 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
227 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
228 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
229 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
230 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
231 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
232 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
233 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
234 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
235 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
236 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
237 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
238 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
239 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
240 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
241 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
242 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
243 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
244 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
245 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
246 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
247 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
248 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
249 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
250 2773857670 Pseudomonas sp. 478 Isolate Unclassified
251 2784132072 Pseudomonas sp. 460 Isolate Unclassified
252 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
253 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
254 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
255 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
256 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
257 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
258 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
259 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
260 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
261 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
262 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
263 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
264 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
265 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
266 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
267 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
268 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
269 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
270 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
271 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
272 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
273 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
274 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
275 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
276 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
277 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
278 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
279 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
280 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
281 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
282 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
283 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
284 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
285 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
286 2952252522 Salinicola sp. DM10 Isolate Unclassified
287 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
288 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
289 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
290 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
291 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
292 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
293 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
294 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
295 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
296 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
297 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
298 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
299 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
300 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
301 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
302 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
303 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.44
Metatranscriptomes 0
Isolates 24.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 2.14
Rhizoplane 10.14
Rhizosphere 73.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10073121 3300013104 Bacteria 3234
2 MRS2a_Contig_7 2124908027 Bacteria 72867
3 MRS1b_contig_1526283 2162886011 Bacteria 1751
4 Ga0055536_1005639 3300003781 Bacteria 6059
5 Ga0055536_1005815 3300003781 Bacteria 5928
6 Ga0055530_10001097 3300003791 Bacteria 21186
7 Ga0055530_10003753 3300003791 Bacteria 8389
8 Ga0055540_1000808 3300003792 Bacteria 21186
9 Ga0055540_1002421 3300003792 Bacteria 9871
10 Ga0055531_10000246 3300003794 Bacteria 58390
11 Ga0055531_10000511 3300003794 Bacteria 35158
12 Ga0065714_10000135 3300005288 Bacteria 9098
13 Ga0065714_10009949 3300005288 Bacteria 2693
14 Ga0065714_10064758 3300005288 Bacteria 19874
15 Ga0065714_10117957 3300005288 Bacteria 1384
16 Ga0065714_10121499 3300005288 Bacteria 1341
17 Ga0065714_10145031 3300005288 Bacteria 1144
18 Ga0065704_10075044 3300005289 Bacteria 5821
19 Ga0065712_10007729 3300005290 Bacteria 4449
20 Ga0065712_10067922 3300005290 Bacteria 20610
21 Ga0070661_100000060 3300005344 Bacteria 86915
22 Ga0070669_100035340 3300005353 Bacteria 3620
23 Ga0070664_100015243 3300005564 Bacteria 6282
24 Ga0075432_10001502 3300006058 Bacteria 7617
25 Ga0075432_10013113 3300006058 Bacteria 2816
26 Ga0075436_100157477 3300006914 Bacteria 1600
27 Ga0079104_1001049 3300006946 Bacteria 21034
28 Ga0099826_10019016 3300006948 Bacteria 5171
29 Ga0105251_10109589 3300009011 Bacteria 1258
30 Ga0105244_10001973 3300009036 Bacteria 15869
31 Ga0105244_10007446 3300009036 Bacteria 6959
32 Ga0105244_10016681 3300009036 Bacteria 4177
33 Ga0105244_10026379 3300009036 Bacteria 3145
34 Ga0105244_10030191 3300009036 Bacteria 2886
35 Ga0105244_10032822 3300009036 Bacteria 2744
36 Ga0105244_10093786 3300009036 Bacteria 1474
37 Ga0105250_10017865 3300009092 Bacteria 2880
38 Ga0105243_10006678 3300009148 Bacteria 8907
39 Ga0105243_10010964 3300009148 Bacteria 6853
40 Ga0105243_10053090 3300009148 Bacteria 3214
41 Ga0105242_10000734 3300009176 Bacteria 25556
42 Ga0105237_10000730 3300009545 Bacteria 45375
43 Ga0105246_10006863 3300011119 Bacteria 6965
44 Ga0157373_10021121 3300013100 Bacteria 4726
45 Ga0157373_10083999 3300013100 Bacteria 2244
46 Ga0157373_10144785 3300013100 Bacteria 1671
47 Ga0157371_10038718 3300013102 Bacteria 3411
48 Ga0157371_10049130 3300013102 Bacteria 2997
49 Ga0157370_10107033 3300013104 Bacteria 2616
50 Ga0157370_10276510 3300013104 Bacteria 1551
51 Ga0157369_10074491 3300013105 Bacteria 3640
52 Ga0157369_10436217 3300013105 Bacteria 1357
53 Ga0163162_10084063 3300013306 Bacteria 3258
54 Ga0163162_10486685 3300013306 Bacteria 1365
55 Ga0163162_10537459 3300013306 Bacteria 1298
56 Ga0157375_10083275 3300013308 Bacteria 3243
57 Ga0182008_10025018 3300014497 Bacteria 3036
58 Ga0182008_10026118 3300014497 Bacteria 2962
59 Ga0182008_10070110 3300014497 Bacteria 1724
60 Ga0182006_1001162 3300015261 Bacteria 16594
61 Ga0182006_1017471 3300015261 Bacteria 3046
62 Ga0182006_1027699 3300015261 Bacteria 2309
63 Ga0182007_10000898 3300015262 Bacteria 16505
64 Ga0182007_10038285 3300015262 Bacteria 1609
65 Ga0182005_1004617 3300015265 Bacteria 4417
66 Ga0182005_1005760 3300015265 Bacteria 3845
67 Ga0182005_1007236 3300015265 Bacteria 3340
68 Ga0163161_10265393 3300017792 Bacteria 1342
69 Ga0209760_100173 3300025207 Bacteria 35497
70 Ga0207427_100001 3300025231 Bacteria 1410763
71 Ga0209437_100003 3300025233 Bacteria 1517827
72 Ga0209759_1007027 3300025256 Bacteria 3686
73 Ga0209233_1000007 3300025261 Bacteria 1411234
74 Ga0209676_1000002 3300025292 Bacteria 1732948
75 Ga0209676_1000166 3300025292 Bacteria 156596
76 Ga0209676_1010672 3300025292 Bacteria 3791
77 Ga0209050_1000275 3300025298 Bacteria 110235
78 Ga0209051_1000001 3300025303 Bacteria 1732974
79 Ga0209051_1000008 3300025303 Bacteria 706935
80 Ga0209257_1000181 3300025304 Bacteria 158039
81 Ga0209257_1009270 3300025304 Bacteria 5322
82 Ga0207696_1007200 3300025711 Bacteria 4378
83 Ga0207696_1014078 3300025711 Bacteria 2757
84 Ga0207655_1000620 3300025728 Bacteria 42667
85 Ga0207655_1000835 3300025728 Bacteria 33137
86 Ga0207655_1001260 3300025728 Bacteria 24152
87 Ga0207655_1022519 3300025728 Bacteria 3155
88 Ga0207655_1024452 3300025728 Bacteria 2959
89 Ga0207713_1012130 3300025735 Bacteria 4633
90 Ga0207713_1014917 3300025735 Bacteria 4010
91 Ga0207713_1071318 3300025735 Bacteria 1282
92 Ga0207671_10000079 3300025914 Bacteria 149692
93 Ga0207649_10000002 3300025920 Bacteria 498633
94 Ga0207681_10009465 3300025923 Bacteria 5954
95 Ga0207664_10233340 3300025929 Bacteria 1600
96 Ga0207686_10003582 3300025934 Bacteria 8335
97 Ga0207709_10000045 3300025935 Bacteria 240671
98 Ga0207709_10004335 3300025935 Bacteria 8209
99 Ga0207679_10000006 3300025945 Bacteria 498868
100 Ga0209281_1000011 3300027111 Bacteria 695292
101 Ga0209282_1050392 3300027666 Bacteria 2394
102 Ga0307511_10071472 3300030521 Bacteria 2531
103 Ga0316178_1178610 3300030735 Bacteria 2096
104 Ga0316183_1068060 3300030742 Bacteria 4084
105 Ga0265340_10083879 3300031247 Bacteria 1497
106 Ga0307408_100035839 3300031548 Bacteria 3483
107 Ga0307408_100248620 3300031548 Bacteria 1465
108 Ga0307408_100375770 3300031548 Bacteria 1213
109 Ga0307405_10023953 3300031731 Bacteria 3479
110 Ga0307405_10246030 3300031731 Bacteria 1327
111 Ga0307405_10348412 3300031731 Bacteria 1141
112 Ga0307406_10026781 3300031901 Bacteria 3466
113 Ga0307406_10035768 3300031901 Bacteria 3056
114 Ga0307407_10019883 3300031903 Bacteria 3427
115 Ga0307412_10026717 3300031911 Bacteria 3591
116 Ga0307412_10027432 3300031911 Bacteria 3550
117 Ga0307412_10233970 3300031911 Bacteria 1416
118 Ga0307409_100215705 3300031995 Bacteria 1728
119 Ga0307414_10137710 3300032004 Bacteria 1906
120 Ga0307411_10035978 3300032005 Bacteria 3097
121 Ga0307411_10284568 3300032005 Bacteria 1317
122 Ga0237819_00498 3300038705 Bacteria 13229
123 Ga0439438_008029 3300041405 Bacteria 3545
124 Ga0439438_008752 3300041405 Bacteria 3327
125 Ga0439438_010525 3300041405 Bacteria 2920
126 Ga0439438_010710 3300041405 Bacteria 2886
127 Ga0439438_020931 3300041405 Bacteria 1829
128 Ga0439438_030424 3300041405 Bacteria 1439
129 Ga0439447_008277 3300041407 Bacteria 3230
130 Ga0439447_009094 3300041407 Bacteria 3030
131 Ga0439447_014468 3300041407 Bacteria 2212
132 Ga0439447_033150 3300041407 Bacteria 1288
133 Ga0439466_0023521 3300041411 Bacteria 2166
134 Ga0439466_0032165 3300041411 Bacteria 1790
135 Ga0439431_0018657 3300041997 Bacteria 1643
136 Ga0439437_000055 3300042000 Bacteria 7840
137 Ga0439445_0009151 3300042004 Bacteria 2330
138 Ga0439432_049489 3300042006 Bacteria 1313
139 Ga0439451_004528 3300042009 Bacteria 2827
140 Ga0439451_006616 3300042009 Bacteria 2367
141 Ga0439451_007378 3300042009 Bacteria 2243
142 Ga0439452_003126 3300042010 Bacteria 5867
143 Ga0439452_008621 3300042010 Bacteria 3056
144 Ga0439452_013397 3300042010 Bacteria 2303
145 Ga0439452_018394 3300042010 Bacteria 1861
146 Ga0439456_023583 3300042013 Bacteria 1304
147 Ga0450911_000007 3300042115 Bacteria 212322
148 Ga0450911_003027 3300042115 Bacteria 3081
149 Ga0450902_017141 3300042137 Bacteria 1182
150 Ga0450904_000804 3300042139 Bacteria 5253
151 Ga0450904_002970 3300042139 Bacteria 1908
152 Ga0450906_004590 3300042145 Bacteria 2881
153 Ga0450906_005342 3300042145 Bacteria 2645
154 Ga0450907_005144 3300042146 Bacteria 2219
155 Ga0450907_010829 3300042146 Bacteria 1514
156 Ga0450910_008836 3300042147 Bacteria 1422
157 Ga0439446_0014078 3300042156 Bacteria 2203
158 Ga0450908_006891 3300042184 Bacteria 2151
159 Ga0450909_007971 3300042185 Bacteria 1537
160 Ga0439434_0033409 3300042435 Bacteria 1567
161 Ga0439434_0048129 3300042435 Bacteria 1318
162 Ga0439460_0021266 3300042461 Bacteria 1771
163 Ga0450916_001362 3300042530 Bacteria 2427
164 Ga0450893_0008028 3300042532 Bacteria 1717
165 Ga0439440_0023362 3300042993 Bacteria 1409
166 Ga0495617_009695 3300046452 Bacteria 3304
167 Ga0495617_011895 3300046452 Bacteria 2968
168 Ga0495617_021560 3300046452 Bacteria 2175
169 Ga0495627_039105 3300046453 Bacteria 1464
170 Ga0495627_040846 3300046453 Bacteria 1427
171 Ga0495603_0030032 3300046455 Bacteria 3275
172 Ga0495603_0142024 3300046455 Bacteria 1396
173 Ga0495590_0014754 3300046457 Bacteria 2848
174 Ga0495591_009903 3300046458 Bacteria 3743
175 Ga0495591_012959 3300046458 Bacteria 3076
176 Ga0495591_014234 3300046458 Bacteria 2870
177 Ga0495638_0081941 3300046460 Bacteria 1957
178 Ga0495638_0090250 3300046460 Bacteria 1847
179 Ga0495638_0111074 3300046460 Bacteria 1628
180 Ga0495638_0176915 3300046460 Bacteria 1220
181 Ga0495653_0026614 3300046463 Bacteria 4635
182 Ga0495653_0043544 3300046463 Bacteria 3489
183 Ga0495650_0022972 3300046471 Bacteria 2979
184 Ga0495650_0024011 3300046471 Bacteria 2888
185 Ga0495650_0024273 3300046471 Bacteria 2865
186 Ga0495650_0060567 3300046471 Bacteria 1519
187 Ga0495582_0043754 3300046473 Bacteria 2465
188 Ga0495605_0034922 3300046474 Bacteria 2543
189 Ga0495605_0066610 3300046474 Bacteria 1710
190 Ga0495605_0080652 3300046474 Bacteria 1523
191 Ga0495605_0113634 3300046474 Bacteria 1233
192 Ga0495639_0000001 3300046475 Bacteria 204442
193 Ga0495639_0048796 3300046475 Bacteria 1920
194 Ga0495584_0018371 3300046491 Bacteria 3553
195 Ga0495584_0019012 3300046491 Bacteria 3488
196 Ga0495584_0024077 3300046491 Bacteria 3086
197 Ga0495584_0059849 3300046491 Bacteria 1915
198 Ga0495584_0078474 3300046491 Bacteria 1661
199 Ga0495584_0103784 3300046491 Bacteria 1437
200 Ga0495585_0080812 3300046492 Bacteria 1761
201 Ga0495594_0037122 3300046499 Bacteria 2658
202 Ga0495594_0078319 3300046499 Bacteria 1844
203 Ga0495607_0001799 3300046501 Bacteria 18317
204 Ga0495607_0024476 3300046501 Bacteria 3763
205 Ga0495607_0032272 3300046501 Bacteria 3198
206 Ga0495607_0034959 3300046501 Bacteria 3044
207 Ga0495607_0046311 3300046501 Bacteria 2555
208 Ga0495607_0060066 3300046501 Bacteria 2165
209 Ga0495607_0090095 3300046501 Bacteria 1663
210 Ga0495583_0059209 3300046506 Bacteria 1717
211 Ga0495583_0077399 3300046506 Bacteria 1451
212 Ga0495583_0096419 3300046506 Bacteria 1267
213 Ga0495606_0040452 3300046507 Bacteria 3133
214 Ga0495610_0030283 3300046512 Bacteria 2838
215 Ga0495610_0074974 3300046512 Bacteria 1568
216 Ga0495610_0101035 3300046512 Bacteria 1292
217 Ga0495610_0115072 3300046512 Bacteria 1186
218 Ga0495616_0022837 3300046513 Bacteria 3373
219 Ga0495616_0023497 3300046513 Bacteria 3315
220 Ga0495616_0026758 3300046513 Bacteria 3065
221 Ga0495616_0028447 3300046513 Bacteria 2959
222 Ga0495616_0048020 3300046513 Bacteria 2146
223 Ga0495620_0015986 3300046515 Bacteria 3776
224 Ga0495620_0020457 3300046515 Bacteria 3231
225 Ga0495628_0252126 3300046516 Bacteria 1317
226 Ga0495630_0124104 3300046517 Bacteria 1959
227 Ga0495630_0211122 3300046517 Bacteria 1481
228 Ga0495630_0292220 3300046517 Bacteria 1245
229 Ga0495631_0011435 3300046518 Bacteria 4363
230 Ga0495631_0040100 3300046518 Bacteria 2075
231 Ga0495632_0019416 3300046519 Bacteria 3703
232 Ga0495632_0023718 3300046519 Bacteria 3271
233 Ga0495632_0024157 3300046519 Bacteria 3234
234 Ga0495637_0019599 3300046520 Bacteria 3125
235 Ga0495637_0021574 3300046520 Bacteria 2951
236 Ga0495637_0026129 3300046520 Bacteria 2625
237 Ga0495637_0031535 3300046520 Bacteria 2343
238 Ga0495637_0043731 3300046520 Bacteria 1909
239 Ga0495637_0068644 3300046520 Bacteria 1436
240 Ga0495637_0070047 3300046520 Bacteria 1417
241 Ga0495643_0027590 3300046522 Bacteria 3189
242 Ga0495643_0092729 3300046522 Bacteria 1556
243 Ga0495648_0008456 3300046524 Bacteria 8098
244 Ga0495648_0098972 3300046524 Bacteria 1614
245 Ga0495666_0076388 3300046526 Bacteria 1587
246 Ga0495642_0012882 3300046528 Bacteria 3227
247 Ga0495642_0014796 3300046528 Bacteria 3026
248 Ga0495654_0001192 3300046530 Bacteria 18488
249 Ga0495654_0030691 3300046530 Bacteria 2733
250 Ga0495654_0067126 3300046530 Bacteria 1708
251 Ga0495654_0067534 3300046530 Bacteria 1702
252 Ga0495654_0071360 3300046530 Bacteria 1645
253 Ga0495587_0011390 3300046536 Bacteria 5636
254 Ga0495587_0031435 3300046536 Bacteria 3214
255 Ga0495609_0008808 3300046538 Bacteria 4910
256 Ga0495597_0018372 3300046542 Bacteria 3281
257 Ga0495597_0020816 3300046542 Bacteria 3051
258 Ga0495597_0053283 3300046542 Bacteria 1779
259 Ga0495597_0094274 3300046542 Bacteria 1268
260 Ga0495622_0000181 3300046557 Bacteria 51031
261 Ga0495622_0016310 3300046557 Bacteria 3457
262 Ga0495622_0025282 3300046557 Bacteria 2774
263 Ga0495622_0078547 3300046557 Bacteria 1519
264 Ga0495622_0099869 3300046557 Bacteria 1330
265 Ga0495656_0048133 3300046615 Bacteria 1811
266 Ga0495656_0097375 3300046615 Bacteria 1355
267 Ga0495611_0115352 3300046648 Bacteria 1251
268 Ga0495625_0040617 3300046660 Bacteria 3390
269 Ga0495625_0097654 3300046660 Bacteria 2021
270 Ga0495625_0127479 3300046660 Bacteria 1726
271 Ga0495625_0175843 3300046660 Bacteria 1426
272 Ga0495625_0181460 3300046660 Bacteria 1399
273 Ga0495625_0253555 3300046660 Bacteria 1141
274 Ga0495635_0034727 3300046663 Bacteria 3497
275 Ga0495635_0042697 3300046663 Bacteria 3130
276 Ga0495659_0000507 3300046664 Bacteria 14341
277 Ga0495659_0039740 3300046664 Bacteria 1673
278 Ga0495659_0040352 3300046664 Bacteria 1663
279 Ga0495661_0025983 3300046665 Bacteria 3774
280 Ga0495661_0033555 3300046665 Bacteria 3237
281 Ga0495661_0045193 3300046665 Bacteria 2694
282 Ga0495661_0059705 3300046665 Bacteria 2268
283 Ga0495661_0152640 3300046665 Bacteria 1246
284 Ga0495588_0001625 3300046674 Bacteria 9605
285 Ga0495646_0055615 3300046680 Bacteria 2375
286 Ga0495613_0196842 3300046689 Bacteria 1422
287 Ga0495670_0009756 3300046691 Bacteria 4718
288 Ga0495670_0027642 3300046691 Bacteria 2811
289 Ga0495671_0026028 3300046692 Bacteria 3036
290 Ga0495671_0026453 3300046692 Bacteria 3007
291 Ga0495671_0051402 3300046692 Bacteria 2050
292 Ga0495671_0065623 3300046692 Bacteria 1786
293 Ga0495649_0000890 3300046694 Bacteria 23784
294 Ga0495649_0024999 3300046694 Bacteria 3327
295 Ga0495649_0130454 3300046694 Bacteria 1326
296 Ga0495589_0017036 3300046794 Bacteria 3731
297 Ga0495589_0017300 3300046794 Bacteria 3700
298 Ga0495589_0029634 3300046794 Bacteria 2759
299 Ga0495600_0191119 3300046809 Bacteria 1316
300 Ga0495660_0035850 3300046810 Bacteria 2768
301 Ga0495660_0039595 3300046810 Bacteria 2617
302 Ga0495660_0062139 3300046810 Bacteria 2002
303 Ga0495660_0065163 3300046810 Bacteria 1945
304 Ga0495660_0066418 3300046810 Bacteria 1923
305 Ga0495660_0094641 3300046810 Bacteria 1546
306 Ga0495660_0143177 3300046810 Bacteria 1187
307 Ga0495660_0153864 3300046810 Bacteria 1133
308 Ga0495581_0043020 3300047315 Bacteria 2613
309 Ga0495581_0080317 3300047315 Bacteria 1887
310 Ga0495604_0047233 3300047317 Bacteria 3354
311 Ga0495636_0012607 3300047318 Bacteria 3347
312 Ga0495672_0017849 3300047320 Bacteria 4733
313 Ga0495672_0103134 3300047320 Bacteria 1543
314 Ga0495680_0039014 3300047322 Bacteria 3792
315 Ga0495683_0010757 3300047323 Bacteria 4824
316 Ga0495683_0021648 3300047323 Bacteria 3313
317 Ga0495683_0024749 3300047323 Bacteria 3079
318 Ga0495683_0078859 3300047323 Bacteria 1608
319 Ga0495683_0080628 3300047323 Bacteria 1587
320 Ga0495683_0083307 3300047323 Bacteria 1557
321 Ga0495687_013030 3300047443 Bacteria 4359
322 Ga0495687_018366 3300047443 Bacteria 3458
323 Ga0495677_0026233 3300047445 Bacteria 2113
324 Ga0495679_023646 3300047446 Bacteria 2081
325 Ga0495679_048632 3300047446 Bacteria 1281
326 Ga0495685_029479 3300047447 Bacteria 1887
327 Ga0495673_0000228 3300047469 Bacteria 82455
328 Ga0495673_0013221 3300047469 Bacteria 4345
329 Ga0495673_0026441 3300047469 Bacteria 2775
330 Ga0495673_0057482 3300047469 Bacteria 1679
331 Ga0495673_0077640 3300047469 Bacteria 1382
332 Ga0495681_0025364 3300047470 Bacteria 3101
333 Ga0495681_0026003 3300047470 Bacteria 3056
334 Ga0495681_0026370 3300047470 Bacteria 3025
335 Ga0495681_0027512 3300047470 Bacteria 2939
336 Ga0495681_0028707 3300047470 Bacteria 2857
337 Ga0495681_0041812 3300047470 Bacteria 2223
338 Ga0495681_0046219 3300047470 Bacteria 2077
339 Ga0495681_0051986 3300047470 Bacteria 1925
340 Ga0495681_0057609 3300047470 Bacteria 1803
341 Ga0495681_0060677 3300047470 Bacteria 1744
342 Ga0495684_0119166 3300047471 Bacteria 1989
343 Ga0495593_0029324 3300047673 Bacteria 3017
344 Ga0495593_0036406 3300047673 Bacteria 2669
345 Ga0495593_0054505 3300047673 Bacteria 2107
346 Ga0495593_0061426 3300047673 Bacteria 1965
347 Ga0495593_0071326 3300047673 Bacteria 1804
348 Ga0495593_0096144 3300047673 Bacteria 1522
349 Ga0495614_0029904 3300048089 Bacteria 2344
350 Ga0495626_0001572 3300048091 Bacteria 17894
351 Ga0495626_0016661 3300048091 Bacteria 3728
352 Ga0495626_0025814 3300048091 Bacteria 2869
353 Ga0495626_0058147 3300048091 Bacteria 1767
354 Ga0496107_0269193 3300048910 Bacteria 1268
355 Ga0496110_0285642 3300048913 Bacteria 1502
356 Ga0496115_0111482 3300048918 Bacteria 2248
357 Ga0496116_0000574 3300048919 Bacteria 49172
358 Ga0496116_0026189 3300048919 Bacteria 4271
359 Ga0496117_0015475 3300048920 Bacteria 6502
360 Ga0496118_0109297 3300048921 Bacteria 1841
361 Ga0496118_0128184 3300048921 Bacteria 1635
362 Ga0496121_0004070 3300048924 Bacteria 20079
363 Ga0496121_0033805 3300048924 Bacteria 4618
364 Ga0496121_0229992 3300048924 Bacteria 1299
365 Ga0496122_0037577 3300048925 Bacteria 3894
366 Ga0496122_0098817 3300048925 Bacteria 1958
367 Ga0496123_0040456 3300048926 Bacteria 3245
368 Ga0496123_0091507 3300048926 Bacteria 1803
369 Ga0496124_0103390 3300048927 Bacteria 2304
370 Ga0496124_0176856 3300048927 Bacteria 1646
371 Ga0496124_0197862 3300048927 Bacteria 1531
372 Ga0496124_0198089 3300048927 Bacteria 1530
373 Ga0496125_0047201 3300048928 Bacteria 3604
374 Ga0496125_0101484 3300048928 Bacteria 2117
375 Ga0496125_0104829 3300048928 Bacteria 2069
376 Ga0496125_0109562 3300048928 Bacteria 2004
377 Ga0496126_0226096 3300048929 Bacteria 1569
378 Ga0495678_017040 3300049459 Bacteria 3303
379 Ga0495678_021342 3300049459 Bacteria 2853
380 Ga0495678_047699 3300049459 Bacteria 1675
381 Ga0495682_0017830 3300049460 Bacteria 2675
382 Ga0501037_0079503 3300049573 Bacteria 2380
383 Ga0501222_004497 3300049662 Bacteria 1894
384 Ga0501269_008046 3300049766 Bacteria 1275
385 Ga0501226_000022 3300049853 Bacteria 111874
386 nmdc:mga03683_104271_c1 3300050489 Bacteria 1249
387 Ga0500634_0054873 3300053161 Bacteria 2133
388 2511258410 2511231004 Bacteria 6669789
389 2511270324 2511231007 Bacteria 6306603
390 2511276072 2511231008 Bacteria 6624100
391 2511289137 2511231010 Bacteria 6373152
392 2511324716 2511231016 Bacteria 6704427
393 2511338110 2511231018 Bacteria 6436256
394 2511342894 2511231019 Bacteria 6520662
395 2511825958 2511231156 Bacteria 6845832
396 2524003661 2523533628 Bacteria 4098242
397 2554814367 2554235132 Bacteria 6772433
398 2555668955 2554235341 Bacteria 6867980
399 2599326498 2599185155 Bacteria 5827168
400 2599357313 2599185160 Bacteria 6844013
401 2599361875 2599185161 Bacteria 6960462
402 2599368196 2599185162 Bacteria 6957254
403 2599374985 2599185163 Bacteria 6995158
404 2599382418 2599185164 Bacteria 6841688
405 2599388865 2599185165 Bacteria 6843250
406 2599393843 2599185166 Bacteria 6959206
407 2599405608 2599185168 Bacteria 6997636
408 2599464186 2599185181 Bacteria 6844519
409 2599468482 2599185182 Bacteria 6883168
410 2599493205 2599185186 Bacteria 6831633
411 2599504643 2599185188 Bacteria 6164180
412 2599611426 2599185212 Bacteria 6765997
413 2599770464 2599185248 Bacteria 6696816
414 2599889523 2599185289 Bacteria 6778765
415 2599901051 2599185291 Bacteria 6775623
416 2599935024 2599185300 Bacteria 6062622
417 2599941629 2599185302 Bacteria 5954930
418 2599952851 2599185304 Bacteria 5951361
419 2599963111 2599185305 Bacteria 6748700
420 2599968690 2599185306 Bacteria 6637356
421 2599976947 2599185308 Bacteria 6621546
422 2599981798 2599185309 Bacteria 5969593
423 2599987707 2599185310 Bacteria 6014457
424 2599995199 2599185311 Bacteria 6354990
425 2599998401 2599185312 Bacteria 5912071
426 2600005593 2599185313 Bacteria 6658188
427 2600011116 2599185314 Bacteria 6621749
428 2600019938 2599185315 Bacteria 6771107
429 2600022414 2599185316 Bacteria 6320029
430 2600027434 2599185317 Bacteria 6435722
431 2600034206 2599185318 Bacteria 6961590
432 2600039714 2599185319 Bacteria 6637840
433 2600046037 2599185320 Bacteria 5963263
434 2600054637 2599185321 Bacteria 6764560
435 2600057374 2599185322 Bacteria 6763055
436 2600064552 2599185323 Bacteria 6688755
437 2600074417 2599185324 Bacteria 6590677
438 2600075689 2599185325 Bacteria 6324919
439 2600216461 2599185356 Bacteria 6843884
440 2600356857 2600254930 Bacteria 6431253
441 2601776946 2600255313 Bacteria 6842543
442 2602009692 2600255389 Bacteria 5275336
443 2608381756 2606217733 Bacteria 6360972
444 2621301056 2619619299 Bacteria 6649820
445 2624481753 2623620443 Bacteria 6427864
446 2624491332 2623620446 Bacteria 6500345
447 2644188816 2643221633 Bacteria 6733554
448 2644286771 2643221650 Bacteria 7029547
449 2652548633 2651869719 Bacteria 6047974
450 2671093697 2667528170 Bacteria 6786960
451 2671098514 2667528171 Bacteria 6900659
452 2671126198 2667528176 Bacteria 6724917
453 2678262781 2675903515 Bacteria 6580491
454 2715751652 2713897148 Bacteria 5883533
455 2715759821 2713897149 Bacteria 6506249
456 2738670320 2738541265 Bacteria 6594665
457 2738748713 2738541282 Bacteria 6593925
458 2738857755 2738541303 Bacteria 6591772
459 2745009117 2744054620 Bacteria 6551379
460 2774121071 2773857670 Bacteria 6407454
461 2784314144 2784132072 Bacteria 6596533
462 2794598200 2791355520 Bacteria 5948615
463 2808854427 2808606361 Bacteria 6136259
464 2808925780 2808606376 Bacteria 6248667
465 2808927652 2808606377 Bacteria 6646337
466 2808934507 2808606378 Bacteria 6177535
467 2808947881 2808606380 Bacteria 6248705
468 2808949808 2808606381 Bacteria 6646461
469 2808957930 2808606382 Bacteria 6841132
470 2808962932 2808606383 Bacteria 6138645
471 2808997651 2808606389 Bacteria 6138126
472 2809216648 2808606445 Bacteria 6057339
473 2817489593 2816332298 Bacteria 6852809
474 2819703593 2818991464 Bacteria 6907494
475 2825652860 2825651385 Bacteria 6715909
476 2826583214 2826581358 Bacteria 5963467
477 2842837562 2842832357 Bacteria 5959113
478 2842844492 2842843487 Bacteria 6004777
479 2842850526 2842849001 Bacteria 5924277
480 2842857491 2842854478 Bacteria 6143501
481 2860339722 2860339153 Bacteria 6846989
482 2878033735 2878029506 Bacteria 6418441
483 2913038755 2913036834 Bacteria 6704877
484 2917072744 2917070673 Bacteria 6868303
485 2919069101 2919063839 Bacteria 6302690
486 2919387859 2919385768 Bacteria 5897293
487 2919456816 2919456309 Bacteria 6586567
488 2919482028 2919481497 Bacteria 6907839
489 2919490585 2919487758 Bacteria 5929766
490 2919701158 2919697872 Bacteria 6553725
491 2923587103 2923586266 Bacteria 6565975
492 2929146207 2929144301 Bacteria 6622272
493 2931370426 2931369376 Bacteria 6847892
494 2931400378 2931396565 Bacteria 7251677
495 2935354907 2935353572 Unclassified 6955622
496 2952252596 2952252522 Bacteria 4171745
497 2969308523 2969304461 Bacteria 6601805
498 2974290088 2974289157 Bacteria 6080362
499 2988733732 2988728565 Bacteria 6124362
500 2990197401 2990196909 Bacteria 4054280
501 2998143842 2998139840 Bacteria 6073514
502 3007513306 3007511990 Bacteria 6481491
503 3007624950 3007619802 Bacteria 6411688
504 3007722779 3007718800 Bacteria 5971527
505 3007870099 3007866637 Bacteria 5899198
506 637319296 637000220 Bacteria 7074893
507 8019778242 8019775933 Bacteria 6858656
508 8029997035 8029995093 Bacteria 5990776
509 8054359914 8054357960 Bacteria 2867777
510 8056145146 8056143049 Bacteria 6307666
511 8056156594 8056155041 Bacteria 6486948
512 8056167434 8056166840 Bacteria 5820959
513 8056173439 8056172158 Bacteria 6133900
514 Ga0157370_10073121
515 MRS2a_Contig_7
516 MRS1b_contig_1526283
517 Ga0055536_1005639
518 Ga0055536_1005815
519 Ga0055530_10001097
520 Ga0055530_10003753
521 Ga0055540_1000808
522 Ga0055540_1002421
523 Ga0055531_10000246
524 Ga0055531_10000511
525 Ga0065714_10000135
526 Ga0065714_10009949
527 Ga0065714_10064758
528 Ga0065714_10117957
529 Ga0065714_10121499
530 Ga0065714_10145031
531 Ga0065704_10075044
532 Ga0065712_10007729
533 Ga0065712_10067922
534 Ga0070661_100000060
535 Ga0070669_100035340
536 Ga0070664_100015243
537 Ga0075432_10001502
538 Ga0075432_10013113
539 Ga0075436_100157477
540 Ga0079104_1001049
541 Ga0099826_10019016
542 Ga0105251_10109589
543 Ga0105244_10001973
544 Ga0105244_10007446
545 Ga0105244_10016681
546 Ga0105244_10026379
547 Ga0105244_10030191
548 Ga0105244_10032822
549 Ga0105244_10093786
550 Ga0105250_10017865
551 Ga0105243_10006678
552 Ga0105243_10010964
553 Ga0105243_10053090
554 Ga0105242_10000734
555 Ga0105237_10000730
556 Ga0105246_10006863
557 Ga0157373_10021121
558 Ga0157373_10083999
559 Ga0157373_10144785
560 Ga0157371_10038718
561 Ga0157371_10049130
562 Ga0157370_10107033
563 Ga0157370_10276510
564 Ga0157369_10074491
565 Ga0157369_10436217
566 Ga0163162_10084063
567 Ga0163162_10486685
568 Ga0163162_10537459
569 Ga0157375_10083275
570 Ga0182008_10025018
571 Ga0182008_10026118
572 Ga0182008_10070110
573 Ga0182006_1001162
574 Ga0182006_1017471
575 Ga0182006_1027699
576 Ga0182007_10000898
577 Ga0182007_10038285
578 Ga0182005_1004617
579 Ga0182005_1005760
580 Ga0182005_1007236
581 Ga0163161_10265393
582 Ga0209760_100173
583 Ga0207427_100001
584 Ga0209437_100003
585 Ga0209759_1007027
586 Ga0209233_1000007
587 Ga0209676_1000002
588 Ga0209676_1000166
589 Ga0209676_1010672
590 Ga0209050_1000275
591 Ga0209051_1000001
592 Ga0209051_1000008
593 Ga0209257_1000181
594 Ga0209257_1009270
595 Ga0207696_1007200
596 Ga0207696_1014078
597 Ga0207655_1000620
598 Ga0207655_1000835
599 Ga0207655_1001260
600 Ga0207655_1022519
601 Ga0207655_1024452
602 Ga0207713_1012130
603 Ga0207713_1014917
604 Ga0207713_1071318
605 Ga0207671_10000079
606 Ga0207649_10000002
607 Ga0207681_10009465
608 Ga0207664_10233340
609 Ga0207686_10003582
610 Ga0207709_10000045
611 Ga0207709_10004335
612 Ga0207679_10000006
613 Ga0209281_1000011
614 Ga0209282_1050392
615 Ga0307511_10071472
616 Ga0316178_1178610
617 Ga0316183_1068060
618 Ga0265340_10083879
619 Ga0307408_100035839
620 Ga0307408_100248620
621 Ga0307408_100375770
622 Ga0307405_10023953
623 Ga0307405_10246030
624 Ga0307405_10348412
625 Ga0307406_10026781
626 Ga0307406_10035768
627 Ga0307407_10019883
628 Ga0307412_10026717
629 Ga0307412_10027432
630 Ga0307412_10233970
631 Ga0307409_100215705
632 Ga0307414_10137710
633 Ga0307411_10035978
634 Ga0307411_10284568
635 Ga0237819_00498
636 Ga0439438_008029
637 Ga0439438_008752
638 Ga0439438_010525
639 Ga0439438_010710
640 Ga0439438_020931
641 Ga0439438_030424
642 Ga0439447_008277
643 Ga0439447_009094
644 Ga0439447_014468
645 Ga0439447_033150
646 Ga0439466_0023521
647 Ga0439466_0032165
648 Ga0439431_0018657
649 Ga0439437_000055
650 Ga0439445_0009151
651 Ga0439432_049489
652 Ga0439451_004528
653 Ga0439451_006616
654 Ga0439451_007378
655 Ga0439452_003126
656 Ga0439452_008621
657 Ga0439452_013397
658 Ga0439452_018394
659 Ga0439456_023583
660 Ga0450911_000007
661 Ga0450911_003027
662 Ga0450902_017141
663 Ga0450904_000804
664 Ga0450904_002970
665 Ga0450906_004590
666 Ga0450906_005342
667 Ga0450907_005144
668 Ga0450907_010829
669 Ga0450910_008836
670 Ga0439446_0014078
671 Ga0450908_006891
672 Ga0450909_007971
673 Ga0439434_0033409
674 Ga0439434_0048129
675 Ga0439460_0021266
676 Ga0450916_001362
677 Ga0450893_0008028
678 Ga0439440_0023362
679 Ga0495617_009695
680 Ga0495617_011895
681 Ga0495617_021560
682 Ga0495627_039105
683 Ga0495627_040846
684 Ga0495603_0030032
685 Ga0495603_0142024
686 Ga0495590_0014754
687 Ga0495591_009903
688 Ga0495591_012959
689 Ga0495591_014234
690 Ga0495638_0081941
691 Ga0495638_0090250
692 Ga0495638_0111074
693 Ga0495638_0176915
694 Ga0495653_0026614
695 Ga0495653_0043544
696 Ga0495650_0022972
697 Ga0495650_0024011
698 Ga0495650_0024273
699 Ga0495650_0060567
700 Ga0495582_0043754
701 Ga0495605_0034922
702 Ga0495605_0066610
703 Ga0495605_0080652
704 Ga0495605_0113634
705 Ga0495639_0000001
706 Ga0495639_0048796
707 Ga0495584_0018371
708 Ga0495584_0019012
709 Ga0495584_0024077
710 Ga0495584_0059849
711 Ga0495584_0078474
712 Ga0495584_0103784
713 Ga0495585_0080812
714 Ga0495594_0037122
715 Ga0495594_0078319
716 Ga0495607_0001799
717 Ga0495607_0024476
718 Ga0495607_0032272
719 Ga0495607_0034959
720 Ga0495607_0046311
721 Ga0495607_0060066
722 Ga0495607_0090095
723 Ga0495583_0059209
724 Ga0495583_0077399
725 Ga0495583_0096419
726 Ga0495606_0040452
727 Ga0495610_0030283
728 Ga0495610_0074974
729 Ga0495610_0101035
730 Ga0495610_0115072
731 Ga0495616_0022837
732 Ga0495616_0023497
733 Ga0495616_0026758
734 Ga0495616_0028447
735 Ga0495616_0048020
736 Ga0495620_0015986
737 Ga0495620_0020457
738 Ga0495628_0252126
739 Ga0495630_0124104
740 Ga0495630_0211122
741 Ga0495630_0292220
742 Ga0495631_0011435
743 Ga0495631_0040100
744 Ga0495632_0019416
745 Ga0495632_0023718
746 Ga0495632_0024157
747 Ga0495637_0019599
748 Ga0495637_0021574
749 Ga0495637_0026129
750 Ga0495637_0031535
751 Ga0495637_0043731
752 Ga0495637_0068644
753 Ga0495637_0070047
754 Ga0495643_0027590
755 Ga0495643_0092729
756 Ga0495648_0008456
757 Ga0495648_0098972
758 Ga0495666_0076388
759 Ga0495642_0012882
760 Ga0495642_0014796
761 Ga0495654_0001192
762 Ga0495654_0030691
763 Ga0495654_0067126
764 Ga0495654_0067534
765 Ga0495654_0071360
766 Ga0495587_0011390
767 Ga0495587_0031435
768 Ga0495609_0008808
769 Ga0495597_0018372
770 Ga0495597_0020816
771 Ga0495597_0053283
772 Ga0495597_0094274
773 Ga0495622_0000181
774 Ga0495622_0016310
775 Ga0495622_0025282
776 Ga0495622_0078547
777 Ga0495622_0099869
778 Ga0495656_0048133
779 Ga0495656_0097375
780 Ga0495611_0115352
781 Ga0495625_0040617
782 Ga0495625_0097654
783 Ga0495625_0127479
784 Ga0495625_0175843
785 Ga0495625_0181460
786 Ga0495625_0253555
787 Ga0495635_0034727
788 Ga0495635_0042697
789 Ga0495659_0000507
790 Ga0495659_0039740
791 Ga0495659_0040352
792 Ga0495661_0025983
793 Ga0495661_0033555
794 Ga0495661_0045193
795 Ga0495661_0059705
796 Ga0495661_0152640
797 Ga0495588_0001625
798 Ga0495646_0055615
799 Ga0495613_0196842
800 Ga0495670_0009756
801 Ga0495670_0027642
802 Ga0495671_0026028
803 Ga0495671_0026453
804 Ga0495671_0051402
805 Ga0495671_0065623
806 Ga0495649_0000890
807 Ga0495649_0024999
808 Ga0495649_0130454
809 Ga0495589_0017036
810 Ga0495589_0017300
811 Ga0495589_0029634
812 Ga0495600_0191119
813 Ga0495660_0035850
814 Ga0495660_0039595
815 Ga0495660_0062139
816 Ga0495660_0065163
817 Ga0495660_0066418
818 Ga0495660_0094641
819 Ga0495660_0143177
820 Ga0495660_0153864
821 Ga0495581_0043020
822 Ga0495581_0080317
823 Ga0495604_0047233
824 Ga0495636_0012607
825 Ga0495672_0017849
826 Ga0495672_0103134
827 Ga0495680_0039014
828 Ga0495683_0010757
829 Ga0495683_0021648
830 Ga0495683_0024749
831 Ga0495683_0078859
832 Ga0495683_0080628
833 Ga0495683_0083307
834 Ga0495687_013030
835 Ga0495687_018366
836 Ga0495677_0026233
837 Ga0495679_023646
838 Ga0495679_048632
839 Ga0495685_029479
840 Ga0495673_0000228
841 Ga0495673_0013221
842 Ga0495673_0026441
843 Ga0495673_0057482
844 Ga0495673_0077640
845 Ga0495681_0025364
846 Ga0495681_0026003
847 Ga0495681_0026370
848 Ga0495681_0027512
849 Ga0495681_0028707
850 Ga0495681_0041812
851 Ga0495681_0046219
852 Ga0495681_0051986
853 Ga0495681_0057609
854 Ga0495681_0060677
855 Ga0495684_0119166
856 Ga0495593_0029324
857 Ga0495593_0036406
858 Ga0495593_0054505
859 Ga0495593_0061426
860 Ga0495593_0071326
861 Ga0495593_0096144
862 Ga0495614_0029904
863 Ga0495626_0001572
864 Ga0495626_0016661
865 Ga0495626_0025814
866 Ga0495626_0058147
867 Ga0496107_0269193
868 Ga0496110_0285642
869 Ga0496115_0111482
870 Ga0496116_0000574
871 Ga0496116_0026189
872 Ga0496117_0015475
873 Ga0496118_0109297
874 Ga0496118_0128184
875 Ga0496121_0004070
876 Ga0496121_0033805
877 Ga0496121_0229992
878 Ga0496122_0037577
879 Ga0496122_0098817
880 Ga0496123_0040456
881 Ga0496123_0091507
882 Ga0496124_0103390
883 Ga0496124_0176856
884 Ga0496124_0197862
885 Ga0496124_0198089
886 Ga0496125_0047201
887 Ga0496125_0101484
888 Ga0496125_0104829
889 Ga0496125_0109562
890 Ga0496126_0226096
891 Ga0495678_017040
892 Ga0495678_021342
893 Ga0495678_047699
894 Ga0495682_0017830
895 Ga0501037_0079503
896 Ga0501222_004497
897 Ga0501269_008046
898 Ga0501226_000022
899 nmdc:mga03683_104271_c1
900 Ga0500634_0054873
901 2511258410
902 2511270324
903 2511276072
904 2511289137
905 2511324716
906 2511338110
907 2511342894
908 2511825958
909 2524003661
910 2554814367
911 2555668955
912 2599326498
913 2599357313
914 2599361875
915 2599368196
916 2599374985
917 2599382418
918 2599388865
919 2599393843
920 2599405608
921 2599464186
922 2599468482
923 2599493205
924 2599504643
925 2599611426
926 2599770464
927 2599889523
928 2599901051
929 2599935024
930 2599941629
931 2599952851
932 2599963111
933 2599968690
934 2599976947
935 2599981798
936 2599987707
937 2599995199
938 2599998401
939 2600005593
940 2600011116
941 2600019938
942 2600022414
943 2600027434
944 2600034206
945 2600039714
946 2600046037
947 2600054637
948 2600057374
949 2600064552
950 2600074417
951 2600075689
952 2600216461
953 2600356857
954 2601776946
955 2602009692
956 2608381756
957 2621301056
958 2624481753
959 2624491332
960 2644188816
961 2644286771
962 2652548633
963 2671093697
964 2671098514
965 2671126198
966 2678262781
967 2715751652
968 2715759821
969 2738670320
970 2738748713
971 2738857755
972 2745009117
973 2774121071
974 2784314144
975 2794598200
976 2808854427
977 2808925780
978 2808927652
979 2808934507
980 2808947881
981 2808949808
982 2808957930
983 2808962932
984 2808997651
985 2809216648
986 2817489593
987 2819703593
988 2825652860
989 2826583214
990 2842837562
991 2842844492
992 2842850526
993 2842857491
994 2860339722
995 2878033735
996 2913038755
997 2917072744
998 2919069101
999 2919387859
1000 2919456816
1001 2919482028
1002 2919490585
1003 2919701158
1004 2923587103
1005 2929146207
1006 2931370426
1007 2931400378
1008 2935354907
1009 2952252596
1010 2969308523
1011 2974290088
1012 2988733732
1013 2990197401
1014 2998143842
1015 3007513306
1016 3007624950
1017 3007722779
1018 3007870099
1019 637319296
1020 8019778242
1021 8029997035
1022 8054359914
1023 8056145146
1024 8056156594
1025 8056167434
1026 8056173439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02424

ApbE

ApbE family

92

372

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mgy-assembly3.cif.gz_G crystal structure of pseudomonas stutzeri flavinyl transferase apbe, apo form 0.9722 81 393
5mgy-assembly7.cif.gz_E crystal structure of pseudomonas stutzeri flavinyl transferase apbe, apo form 0.9687 82 393
5mgy-assembly5.cif.gz_C crystal structure of pseudomonas stutzeri flavinyl transferase apbe, apo form 0.9683 82 392
5mgy-assembly8.cif.gz_F crystal structure of pseudomonas stutzeri flavinyl transferase apbe, apo form 0.9663 82 393
5mgy-assembly6.cif.gz_D crystal structure of pseudomonas stutzeri flavinyl transferase apbe, apo form 0.9662 82 393
ID Description Score Start End Superfamily
5mgyC00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.9683 82 392 3.10.520.10
6nxjB00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.9523 83 391 3.10.520.10
6nxjB00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.9428 83 391 3.10.520.10
5mgyC00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.9377 82 392 3.10.520.10
3pndD00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8902 85 390 3.10.520.10
ID Description Score Start End GO Terms
AF-U6ZSD6-F1-model_v4 deleted 0.9862 92 397
AF-U6ZSD6-F1-model_v4 deleted 0.983 92 397
AF-A0A4Z0M2U4-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9757 92 390 GO:0016740
GO:0046872
AF-A0A1X7MA03-F1-model_v4 deleted 0.9738 299 390
AF-A0A2D5GFM7-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9682 202 392 GO:0016740
GO:0046872

Map