F457568

General Info

Members Datasets Scaffolds Average Seq Length
513 319 1026 174

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10715812|Ga0157372_107158122
Length 200
Sequence MTRCKRRVETDRKENHQMQIKWLAFMSITRAIACATVLAHFLAAPALAEEVKAGDLVITQAWSRATPGGAKVAGGYLTIENVGSTPDRLIGGSADVADKVQVHEMATNNGVMTMRPLDKGLAIEPGKTVMLAPGGHHLMLQGLKSPLKQGDKVPVTLEFEKAGKVKLSLDVQGIGAQAPAGAGNAGGNMDMKKMPGGMKM

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
111 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
112 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
304 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
305 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
306 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
307 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
308 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
309 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
310 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
311 2791355199
312 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
313 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
314 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
315 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
316 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
317 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
318 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
319 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 1.75
Rhizoplane 9.55
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10715812 3300013307 Bacteria 1165
2 JGI25153J46596_10001608 3300003215 Bacteria 13391
3 rootL2_10046849 3300003322 Bacteria 1905
4 JGI25404J52841_10018728 3300003659 Bacteria 1500
5 Ga0070658_10519192 3300005327 Bacteria 1030
6 Ga0070683_100022065 3300005329 Bacteria 5686
7 Ga0070690_100135182 3300005330 Bacteria 1669
8 Ga0070670_100401096 3300005331 Bacteria 1211
9 Ga0068869_100043742 3300005334 Bacteria 3218
10 Ga0068869_100058481 3300005334 Bacteria 2819
11 Ga0070680_100009263 3300005336 Bacteria 7555
12 Ga0070680_100523904 3300005336 Bacteria 1015
13 Ga0070682_100124134 3300005337 Bacteria 1738
14 Ga0068868_100211000 3300005338 Bacteria 1623
15 Ga0068868_100244512 3300005338 Bacteria 1508
16 Ga0070660_100121369 3300005339 Bacteria 2086
17 Ga0070660_100412604 3300005339 Bacteria 1117
18 Ga0070689_100328141 3300005340 Bacteria 1279
19 Ga0070689_100623459 3300005340 Bacteria 936
20 Ga0070691_10081734 3300005341 Bacteria 1583
21 Ga0070691_10117597 3300005341 Bacteria 1335
22 Ga0070687_100149609 3300005343 Bacteria 1369
23 Ga0070661_100300986 3300005344 Bacteria 1248
24 Ga0070668_100063024 3300005347 Bacteria 2873
25 Ga0070668_100275165 3300005347 Bacteria 1404
26 Ga0070675_100382737 3300005354 Bacteria 1253
27 Ga0070675_100639854 3300005354 Bacteria 966
28 Ga0070671_100090345 3300005355 Bacteria 2564
29 Ga0070671_100198218 3300005355 Bacteria 1702
30 Ga0070671_100436148 3300005355 Bacteria 1123
31 Ga0070674_100173621 3300005356 Bacteria 1645
32 Ga0070674_100200782 3300005356 Bacteria 1540
33 Ga0070659_100124003 3300005366 Bacteria 2095
34 Ga0070659_100282984 3300005366 Bacteria 1380
35 Ga0070667_101031346 3300005367 Bacteria 768
36 Ga0070709_10006973 3300005434 Bacteria 6170
37 Ga0070709_10330190 3300005434 Bacteria 1122
38 Ga0070714_100005674 3300005435 Bacteria 9552
39 Ga0070714_100566105 3300005435 Bacteria 1089
40 Ga0070713_100003086 3300005436 Bacteria 10954
41 Ga0070713_100022619 3300005436 Bacteria 4860
42 Ga0070713_100174649 3300005436 Bacteria 1927
43 Ga0070710_10001162 3300005437 Bacteria 12453
44 Ga0070710_10021741 3300005437 Bacteria 3348
45 Ga0070701_10051251 3300005438 Bacteria 2141
46 Ga0070711_100009117 3300005439 Bacteria 6096
47 Ga0070711_100229881 3300005439 Bacteria 1446
48 Ga0070705_100139865 3300005440 Bacteria 1592
49 Ga0070700_100005487 3300005441 Bacteria 6728
50 Ga0070700_100413978 3300005441 Bacteria 1017
51 Ga0070700_101386164 3300005441 Bacteria 594
52 Ga0070694_100714779 3300005444 Bacteria 816
53 Ga0070694_100750809 3300005444 Bacteria 797
54 Ga0070663_100067561 3300005455 Bacteria 2593
55 Ga0070663_100164603 3300005455 Bacteria 1710
56 Ga0070663_100186844 3300005455 Bacteria 1610
57 Ga0070678_100205468 3300005456 Bacteria 1628
58 Ga0070662_100134055 3300005457 Bacteria 1913
59 Ga0070662_100150235 3300005457 Bacteria 1813
60 Ga0070681_10229357 3300005458 Bacteria 1771
61 Ga0068867_100153662 3300005459 Bacteria 1809
62 Ga0070706_101226588 3300005467 Bacteria 689
63 Ga0070706_101273399 3300005467 Bacteria 675
64 Ga0070698_100019028 3300005471 Bacteria 7223
65 Ga0070698_100227028 3300005471 Bacteria 1800
66 Ga0070698_100685996 3300005471 Bacteria 966
67 Ga0070699_100216515 3300005518 Bacteria 1706
68 Ga0070699_101590451 3300005518 Bacteria 599
69 Ga0070679_100182988 3300005530 Bacteria 2067
70 Ga0070684_100182433 3300005535 Bacteria 1909
71 Ga0070697_100146013 3300005536 Bacteria 1991
72 Ga0070697_101455483 3300005536 Bacteria 612
73 Ga0068853_100007871 3300005539 Bacteria 8547
74 Ga0068853_100065731 3300005539 Bacteria 3147
75 Ga0068853_100537851 3300005539 Bacteria 1106
76 Ga0070672_100266782 3300005543 Bacteria 1445
77 Ga0070672_101243145 3300005543 Bacteria 664
78 Ga0070686_100020525 3300005544 Bacteria 3910
79 Ga0070686_100835660 3300005544 Bacteria 745
80 Ga0070696_100243025 3300005546 Bacteria 1359
81 Ga0070665_100071953 3300005548 Bacteria 3465
82 Ga0070665_100114353 3300005548 Bacteria 2701
83 Ga0068855_100169344 3300005563 Bacteria 2474
84 Ga0070664_100112569 3300005564 Bacteria 2377
85 Ga0070664_100584822 3300005564 Bacteria 1035
86 Ga0070664_100936963 3300005564 Bacteria 813
87 Ga0068857_100050008 3300005577 Bacteria 3709
88 Ga0068857_100146748 3300005577 Bacteria 2135
89 Ga0068854_100226848 3300005578 Bacteria 1481
90 Ga0068854_100328736 3300005578 Bacteria 1245
91 Ga0068856_100073356 3300005614 Bacteria 3389
92 Ga0070702_100062203 3300005615 Bacteria 2176
93 Ga0070702_100540386 3300005615 Bacteria 863
94 Ga0068852_100197678 3300005616 Bacteria 1901
95 Ga0068859_100127354 3300005617 Bacteria 2616
96 Ga0068864_100016149 3300005618 Bacteria 6213
97 Ga0068866_10119743 3300005718 Bacteria 1481
98 Ga0068866_10243187 3300005718 Bacteria 1097
99 Ga0068861_100156668 3300005719 Bacteria 1874
100 Ga0068861_100278636 3300005719 Bacteria 1439
101 Ga0068861_100384819 3300005719 Bacteria 1240
102 Ga0068851_10007969 3300005834 Bacteria 4884
103 Ga0068870_10263951 3300005840 Bacteria 1073
104 Ga0068863_100149086 3300005841 Bacteria 2238
105 Ga0068858_100292283 3300005842 Bacteria 1553
106 Ga0068858_100537171 3300005842 Bacteria 1131
107 Ga0068860_100122997 3300005843 Bacteria 2486
108 Ga0068860_100128140 3300005843 Bacteria 2433
109 Ga0068862_100032061 3300005844 Bacteria 4439
110 Ga0068862_100115773 3300005844 Bacteria 2358
111 Ga0081455_10057658 3300005937 Bacteria 3291
112 Ga0081540_1022745 3300005983 Bacteria 3694
113 Ga0081540_1165709 3300005983 Bacteria 850
114 Ga0081540_1245663 3300005983 Bacteria 626
115 Ga0081539_10061638 3300005985 Bacteria 2054
116 Ga0070717_10002657 3300006028 Bacteria 12592
117 Ga0070717_10043382 3300006028 Bacteria 3670
118 Ga0070717_10484379 3300006028 Bacteria 1117
119 Ga0075365_10150409 3300006038 Bacteria 1619
120 Ga0075368_10163800 3300006042 Bacteria 933
121 Ga0070715_10000380 3300006163 Bacteria 11113
122 Ga0070715_10238663 3300006163 Bacteria 944
123 Ga0070715_10425659 3300006163 Bacteria 744
124 Ga0070716_100029256 3300006173 Bacteria 2976
125 Ga0070716_100192396 3300006173 Bacteria 1349
126 Ga0070716_100528905 3300006173 Bacteria 875
127 Ga0070712_100054302 3300006175 Bacteria 2801
128 Ga0070712_100114198 3300006175 Bacteria 2021
129 Ga0070712_100519515 3300006175 Bacteria 1000
130 Ga0075367_10169278 3300006178 Bacteria 1360
131 Ga0075369_10084625 3300006186 Bacteria 1410
132 Ga0075366_10143850 3300006195 Bacteria 1442
133 Ga0075366_10411443 3300006195 Bacteria 833
134 Ga0097621_100081202 3300006237 Bacteria 2698
135 Ga0075370_10025361 3300006353 Bacteria 3279
136 Ga0068871_100103620 3300006358 Bacteria 2386
137 Ga0075433_10106165 3300006852 Bacteria 2489
138 Ga0075434_100033109 3300006871 Bacteria 5099
139 Ga0068865_100066409 3300006881 Bacteria 2544
140 Ga0068865_100079264 3300006881 Bacteria 2352
141 Ga0097620_100127357 3300006931 Bacteria 2616
142 Ga0075435_100171604 3300007076 Bacteria 1830
143 Ga0099795_10000591 3300007788 Bacteria 6923
144 Ga0099795_10006678 3300007788 Bacteria 3165
145 Ga0099795_10046316 3300007788 Bacteria 1567
146 Ga0099795_10131208 3300007788 Bacteria 1011
147 Ga0105240_10058977 3300009093 Bacteria 4791
148 Ga0105240_10070763 3300009093 Bacteria 4314
149 Ga0111539_10814876 3300009094 Bacteria 1086
150 Ga0105245_10120475 3300009098 Bacteria 2451
151 Ga0105245_10150816 3300009098 Bacteria 2198
152 Ga0105245_10532529 3300009098 Bacteria 1195
153 Ga0105243_10302871 3300009148 Bacteria 1449
154 Ga0105243_10331677 3300009148 Bacteria 1390
155 Ga0105241_10256325 3300009174 Bacteria 1485
156 Ga0105242_10149252 3300009176 Bacteria 2037
157 Ga0105248_10079923 3300009177 Bacteria 3675
158 Ga0105248_10123885 3300009177 Bacteria 2915
159 Ga0105248_10252967 3300009177 Bacteria 1983
160 Ga0105248_10596129 3300009177 Bacteria 1247
161 Ga0105237_10121031 3300009545 Bacteria 2612
162 Ga0105237_10157017 3300009545 Bacteria 2272
163 Ga0105238_10017117 3300009551 Bacteria 7358
164 Ga0099796_10102685 3300010159 Bacteria 1078
165 Ga0105239_10011854 3300010375 Bacteria 9725
166 Ga0105239_10149126 3300010375 Bacteria 2610
167 Ga0105239_12276723 3300010375 Bacteria 630
168 Ga0105246_10185218 3300011119 Bacteria 1607
169 Ga0105246_10528039 3300011119 Bacteria 1007
170 Ga0157370_10304011 3300013104 Bacteria 1472
171 Ga0157369_10049940 3300013105 Bacteria 4532
172 Ga0157374_10154254 3300013296 Bacteria 2234
173 Ga0157378_10006063 3300013297 Bacteria 10593
174 Ga0157378_10095213 3300013297 Bacteria 2712
175 Ga0163162_10059345 3300013306 Bacteria 3857
176 Ga0163162_10552821 3300013306 Bacteria 1279
177 Ga0163162_10755463 3300013306 Bacteria 1091
178 Ga0157375_10043306 3300013308 Bacteria 4365
179 Ga0157375_10054332 3300013308 Bacteria 3944
180 Ga0157375_10863471 3300013308 Bacteria 1051
181 Ga0163163_10338651 3300014325 Bacteria 1559
182 Ga0157380_10244848 3300014326 Bacteria 1619
183 Ga0157379_10092408 3300014968 Bacteria 2714
184 Ga0157379_10176892 3300014968 Bacteria 1927
185 Ga0157376_11092991 3300014969 Bacteria 823
186 Ga0163161_10138342 3300017792 Bacteria 1842
187 Ga0163161_10372713 3300017792 Bacteria 1139
188 Ga0214542_1021461 3300021321 Bacteria 4424
189 Ga0214545_1019801 3300021324 Bacteria 5620
190 Ga0214543_1020055 3300021327 Bacteria 5530
191 Ga0209758_1001586 3300025297 Bacteria 26013
192 Ga0207697_10024285 3300025315 Bacteria 2482
193 Ga0207656_10010125 3300025321 Bacteria 3520
194 Ga0207692_10005319 3300025898 Bacteria 5150
195 Ga0207710_10153418 3300025900 Bacteria 1118
196 Ga0207688_10025578 3300025901 Bacteria 3242
197 Ga0207688_10702765 3300025901 Bacteria 639
198 Ga0207685_10015713 3300025905 Bacteria 2405
199 Ga0207685_10174660 3300025905 Bacteria 991
200 Ga0207699_10026595 3300025906 Bacteria 3192
201 Ga0207699_10276898 3300025906 Bacteria 1165
202 Ga0207654_10080565 3300025911 Bacteria 1958
203 Ga0207707_10009415 3300025912 Bacteria 8473
204 Ga0207695_10028180 3300025913 Bacteria 6235
205 Ga0207695_10842322 3300025913 Bacteria 797
206 Ga0207671_10012560 3300025914 Bacteria 6801
207 Ga0207671_10398840 3300025914 Bacteria 1094
208 Ga0207693_10000941 3300025915 Bacteria 26122
209 Ga0207693_10040524 3300025915 Bacteria 3668
210 Ga0207693_10405440 3300025915 Bacteria 1066
211 Ga0207663_10000377 3300025916 Bacteria 19464
212 Ga0207663_10016181 3300025916 Bacteria 4128
213 Ga0207662_10099120 3300025918 Bacteria 1804
214 Ga0207657_10003989 3300025919 Bacteria 15691
215 Ga0207657_10351460 3300025919 Bacteria 1162
216 Ga0207649_10085328 3300025920 Bacteria 2055
217 Ga0207649_10127954 3300025920 Bacteria 1721
218 Ga0207652_10012855 3300025921 Bacteria 6768
219 Ga0207646_10123558 3300025922 Bacteria 2327
220 Ga0207646_11077401 3300025922 Bacteria 708
221 Ga0207650_10280900 3300025925 Bacteria 1356
222 Ga0207659_10048310 3300025926 Bacteria 3014
223 Ga0207659_11194744 3300025926 Bacteria 654
224 Ga0207687_10104868 3300025927 Bacteria 2088
225 Ga0207700_10004236 3300025928 Bacteria 8428
226 Ga0207700_10014543 3300025928 Bacteria 5159
227 Ga0207700_10184406 3300025928 Bacteria 1749
228 Ga0207664_10224895 3300025929 Bacteria 1629
229 Ga0207644_10060831 3300025931 Bacteria 2734
230 Ga0207644_10126174 3300025931 Bacteria 1954
231 Ga0207644_10183345 3300025931 Bacteria 1642
232 Ga0207644_10444214 3300025931 Bacteria 1065
233 Ga0207690_10411370 3300025932 Bacteria 1080
234 Ga0207690_10521603 3300025932 Bacteria 963
235 Ga0207706_10032641 3300025933 Bacteria 4635
236 Ga0207686_10100556 3300025934 Bacteria 1930
237 Ga0207709_10095321 3300025935 Bacteria 1955
238 Ga0207670_10483387 3300025936 Bacteria 1003
239 Ga0207669_10126926 3300025937 Bacteria 1745
240 Ga0207669_10624197 3300025937 Bacteria 878
241 Ga0207665_10000175 3300025939 Bacteria 43114
242 Ga0207665_10454626 3300025939 Bacteria 983
243 Ga0207665_10818829 3300025939 Bacteria 736
244 Ga0207691_10028591 3300025940 Bacteria 5219
245 Ga0207691_11015901 3300025940 Bacteria 692
246 Ga0207711_10072526 3300025941 Bacteria 2991
247 Ga0207711_10170746 3300025941 Bacteria 1973
248 Ga0207711_10454291 3300025941 Bacteria 1193
249 Ga0207711_10476046 3300025941 Bacteria 1163
250 Ga0207689_10012457 3300025942 Bacteria 7265
251 Ga0207679_10840256 3300025945 Bacteria 838
252 Ga0207667_10114900 3300025949 Bacteria 2774
253 Ga0207712_10198021 3300025961 Bacteria 1591
254 Ga0207712_10688645 3300025961 Bacteria 891
255 Ga0207668_10486108 3300025972 Bacteria 1060
256 Ga0207640_10290225 3300025981 Bacteria 1289
257 Ga0207640_10686242 3300025981 Bacteria 876
258 Ga0207677_10134339 3300026023 Bacteria 1884
259 Ga0207677_10190041 3300026023 Bacteria 1623
260 Ga0207677_10704958 3300026023 Bacteria 896
261 Ga0207703_10400480 3300026035 Bacteria 1273
262 Ga0207639_10049830 3300026041 Bacteria 3178
263 Ga0207639_10058157 3300026041 Bacteria 2972
264 Ga0207678_10066634 3300026067 Bacteria 3092
265 Ga0207678_10103971 3300026067 Bacteria 2424
266 Ga0207708_10011091 3300026075 Bacteria 6702
267 Ga0207702_10246000 3300026078 Bacteria 1677
268 Ga0207648_10062237 3300026089 Bacteria 3254
269 Ga0207676_10744817 3300026095 Bacteria 952
270 Ga0207674_10064072 3300026116 Bacteria 3708
271 Ga0207674_10137497 3300026116 Bacteria 2404
272 Ga0207674_10409355 3300026116 Bacteria 1311
273 Ga0207675_100035208 3300026118 Bacteria 4670
274 Ga0207683_10028034 3300026121 Bacteria 4868
275 Ga0207698_10261936 3300026142 Bacteria 1589
276 Ga0209179_1005955 3300027512 Bacteria 1938
277 Ga0209588_1006491 3300027671 Bacteria 3401
278 Ga0268266_10049456 3300028379 Bacteria 3606
279 Ga0268266_11322387 3300028379 Bacteria 696
280 Ga0268265_10095492 3300028380 Bacteria 2387
281 Ga0268265_10919217 3300028380 Bacteria 860
282 Ga0268264_10182025 3300028381 Bacteria 1909
283 Ga0268264_10562045 3300028381 Bacteria 1120
284 Ga0265338_10751623 3300028800 Bacteria 670
285 Ga0265330_10020021 3300031235 Bacteria 3059
286 Ga0265332_10036256 3300031238 Bacteria 2141
287 Ga0265328_10081725 3300031239 Bacteria 1191
288 Ga0265325_10012511 3300031241 Bacteria 4851
289 Ga0307513_10358469 3300031456 Bacteria 1204
290 Ga0307408_100184024 3300031548 Bacteria 1678
291 Ga0265314_10139629 3300031711 Bacteria 1500
292 Ga0265342_10034628 3300031712 Bacteria 3097
293 Ga0307516_10016663 3300031730 Bacteria 7675
294 Ga0307516_10062333 3300031730 Bacteria 3614
295 Ga0307516_10518567 3300031730 Bacteria 846
296 Ga0307405_10367725 3300031731 Bacteria 1115
297 Ga0307416_100385730 3300032002 Bacteria 1433
298 Ga0307414_11155954 3300032004 Bacteria 716
299 Ga0307415_100020454 3300032126 Bacteria 4042
300 Ga0373930_0002355 3300034816 Bacteria 2916
301 Ga0373938_0039619 3300034957 Bacteria 1042
302 Ga0373934_0002896 3300035086 Bacteria 6277
303 Ga0373952_0131818 3300035092 Bacteria 687
304 Ga0373923_0001863 3300035111 Bacteria 6271
305 Ga0373923_0226274 3300035111 Bacteria 870
306 Ga0373932_0033948 3300035112 Bacteria 1435
307 Ga0373953_0000355 3300035117 Bacteria 12338
308 Ga0373954_0000035 3300035118 Bacteria 51266
309 Ga0373954_0045921 3300035118 Bacteria 2041
310 Ga0373956_0000207 3300035119 Bacteria 22860
311 Ga0373956_0588249 3300035119 Bacteria 531
312 Ga0373957_0001128 3300035120 Bacteria 7068
313 Ga0373946_0027894 3300035171 Bacteria 2236
314 Ga0373946_0110437 3300035171 Bacteria 1244
315 Ga0373955_0001046 3300035172 Bacteria 11763
316 Ga0373955_0048115 3300035172 Bacteria 2311
317 Ga0373924_0036727 3300035410 Bacteria 1992
318 Ga0373924_0094333 3300035410 Bacteria 1282
319 Ga0373924_0206850 3300035410 Bacteria 866
320 Ga0373931_0009173 3300035691 Bacteria 4724
321 Ga0373931_0076213 3300035691 Bacteria 1842
322 Ga0373935_0000256 3300035692 Bacteria 26305
323 Ga0373935_0794947 3300035692 Bacteria 698
324 Ga0373927_0000720 3300035695 Bacteria 25321
325 Ga0373927_0006772 3300035695 Bacteria 7798
326 Ga0373927_0049614 3300035695 Bacteria 2714
327 Ga0373933_0000037 3300035724 Bacteria 81092
328 Ga0373933_0110854 3300035724 Bacteria 1712
329 Ga0373947_0001480 3300035725 Bacteria 14434
330 Ga0373937_0000118 3300036401 Bacteria 75902
331 Ga0373925_0006533 3300037068 Bacteria 8575
332 Ga0373925_0203706 3300037068 Bacteria 1574
333 Ga0373925_1003709 3300037068 Bacteria 687
334 Ga0395900_0481634 3300037418 Bacteria 1193
335 Ga0395898_0125801 3300037466 Bacteria 2456
336 Ga0395905_0008572 3300037471 Bacteria 10078
337 Ga0451837_1166160 3300041494 Bacteria 1220
338 Ga0495592_0000649 3300046454 Bacteria 24123
339 Ga0495603_0000027 3300046455 Bacteria 61238
340 Ga0495603_0008387 3300046455 Bacteria 6243
341 Ga0495603_0033441 3300046455 Bacteria 3094
342 Ga0495629_0000290 3300046459 Bacteria 43459
343 Ga0495629_0018856 3300046459 Bacteria 4932
344 Ga0495629_0547934 3300046459 Bacteria 777
345 Ga0495641_0002984 3300046461 Bacteria 12989
346 Ga0495651_0000412 3300046462 Bacteria 33198
347 Ga0495653_0000161 3300046463 Bacteria 55322
348 Ga0495580_0000610 3300046472 Bacteria 30234
349 Ga0495582_0000425 3300046473 Bacteria 23064
350 Ga0495605_0149123 3300046474 Bacteria 1045
351 Ga0495639_0000048 3300046475 Bacteria 53257
352 Ga0495662_0000505 3300046476 Bacteria 17752
353 Ga0495662_0233289 3300046476 Bacteria 907
354 Ga0495664_0028412 3300046477 Bacteria 3266
355 Ga0495584_0246447 3300046491 Bacteria 908
356 Ga0495594_0000279 3300046499 Bacteria 25038
357 Ga0495608_0000403 3300046511 Bacteria 30220
358 Ga0495618_0635917 3300046514 Bacteria 632
359 Ga0495628_0002406 3300046516 Bacteria 16872
360 Ga0495630_0009542 3300046517 Bacteria 6979
361 Ga0495663_0301229 3300046525 Bacteria 577
362 Ga0495652_0000604 3300046529 Bacteria 42071
363 Ga0495665_0000165 3300046531 Bacteria 33325
364 Ga0495640_0007108 3300046533 Bacteria 8807
365 Ga0495640_0014844 3300046533 Bacteria 5878
366 Ga0495587_0001226 3300046536 Bacteria 16984
367 Ga0495645_0049167 3300046543 Bacteria 3071
368 Ga0495645_0355765 3300046543 Bacteria 942
369 Ga0495622_0005916 3300046557 Bacteria 5681
370 Ga0495667_0000147 3300046559 Bacteria 47993
371 Ga0495667_0018087 3300046559 Bacteria 4761
372 Ga0495656_0003251 3300046615 Bacteria 5480
373 Ga0495634_0001502 3300046642 Bacteria 20642
374 Ga0495634_0002287 3300046642 Bacteria 16031
375 Ga0495625_0330042 3300046660 Bacteria 969
376 Ga0495625_0603397 3300046660 Bacteria 659
377 Ga0495635_0000517 3300046663 Bacteria 24463
378 Ga0495635_0088466 3300046663 Bacteria 2119
379 Ga0495657_0000995 3300046675 Bacteria 24963
380 Ga0495599_0000685 3300046678 Bacteria 19241
381 Ga0495599_0232196 3300046678 Bacteria 1126
382 Ga0495623_0000549 3300046679 Bacteria 25012
383 Ga0495646_0013363 3300046680 Bacteria 5218
384 Ga0495646_0033391 3300046680 Bacteria 3198
385 Ga0495647_0013066 3300046681 Bacteria 2870
386 Ga0495658_0001036 3300046683 Bacteria 14692
387 Ga0495669_0012938 3300046684 Bacteria 3553
388 Ga0495613_0006844 3300046689 Bacteria 8516
389 Ga0495613_0020900 3300046689 Bacteria 4880
390 Ga0495624_0014366 3300046690 Bacteria 5375
391 Ga0495649_0366074 3300046694 Bacteria 727
392 Ga0495600_0000771 3300046809 Bacteria 16878
393 Ga0495581_0003661 3300047315 Bacteria 8848
394 Ga0495604_0000253 3300047317 Bacteria 47392
395 Ga0495674_0098844 3300047319 Bacteria 2485
396 Ga0495672_0039757 3300047320 Bacteria 2858
397 Ga0495672_0306437 3300047320 Bacteria 750
398 Ga0495676_0104292 3300047321 Bacteria 2092
399 Ga0495676_0445040 3300047321 Bacteria 855
400 Ga0495680_0000406 3300047322 Bacteria 48300
401 Ga0495675_0001164 3300047444 Bacteria 15960
402 Ga0495673_0039139 3300047469 Bacteria 2152
403 Ga0495684_0000184 3300047471 Bacteria 47730
404 Ga0495684_0018644 3300047471 Bacteria 5347
405 Ga0495593_0000160 3300047673 Bacteria 34170
406 Ga0495593_0002781 3300047673 Bacteria 10535
407 Ga0495602_0002194 3300048088 Bacteria 19718
408 Ga0495602_0443121 3300048088 Bacteria 918
409 Ga0495614_0046488 3300048089 Bacteria 1861
410 Ga0496100_0016640 3300048903 Bacteria 4324
411 Ga0496100_0206397 3300048903 Bacteria 1435
412 Ga0496100_0286691 3300048903 Bacteria 1229
413 Ga0496100_0350906 3300048903 Bacteria 1114
414 Ga0496101_0055478 3300048904 Bacteria 2862
415 Ga0496101_0121957 3300048904 Bacteria 1971
416 Ga0496101_0244876 3300048904 Bacteria 1396
417 Ga0496102_0034726 3300048905 Bacteria 4537
418 Ga0496102_0176228 3300048905 Bacteria 2013
419 Ga0496102_0553342 3300048905 Bacteria 1073
420 Ga0496103_0186895 3300048906 Bacteria 1332
421 Ga0496104_0453257 3300048907 Bacteria 1194
422 Ga0496104_0473133 3300048907 Bacteria 1164
423 Ga0496105_0013417 3300048908 Bacteria 6503
424 Ga0496105_0346493 3300048908 Bacteria 1187
425 Ga0496106_0018584 3300048909 Bacteria 5144
426 Ga0496106_0020169 3300048909 Bacteria 4945
427 Ga0496106_0060242 3300048909 Bacteria 2877
428 Ga0496106_0152950 3300048909 Bacteria 1820
429 Ga0496106_0879558 3300048909 Bacteria 708
430 Ga0496107_0018119 3300048910 Bacteria 4954
431 Ga0496107_0191778 3300048910 Bacteria 1518
432 Ga0496107_0691647 3300048910 Bacteria 750
433 Ga0496108_0025680 3300048911 Bacteria 4857
434 Ga0496108_0193929 3300048911 Bacteria 1761
435 Ga0496108_0773520 3300048911 Bacteria 829
436 Ga0496109_0121063 3300048912 Bacteria 2438
437 Ga0496109_0217615 3300048912 Bacteria 1796
438 Ga0496109_0223155 3300048912 Bacteria 1772
439 Ga0496109_0454019 3300048912 Bacteria 1210
440 Ga0496110_0022169 3300048913 Bacteria 5388
441 Ga0496110_0719663 3300048913 Bacteria 900
442 Ga0496111_0022030 3300048914 Bacteria 4456
443 Ga0496111_0063155 3300048914 Bacteria 2686
444 Ga0496112_0023082 3300048915 Bacteria 5938
445 Ga0496112_0030050 3300048915 Bacteria 5257
446 Ga0496112_0540645 3300048915 Bacteria 1099
447 Ga0496112_0823496 3300048915 Bacteria 852
448 Ga0496113_0004920 3300048916 Bacteria 8276
449 Ga0496113_0072692 3300048916 Bacteria 2618
450 Ga0496113_0450762 3300048916 Bacteria 1034
451 Ga0496114_0016576 3300048917 Bacteria 5939
452 Ga0496114_0245648 3300048917 Bacteria 1575
453 Ga0496115_0056465 3300048918 Bacteria 3156
454 Ga0496115_0062742 3300048918 Bacteria 2998
455 Ga0496115_0073781 3300048918 Bacteria 2770
456 Ga0496115_0107356 3300048918 Bacteria 2292
457 Ga0496115_0255105 3300048918 Bacteria 1443
458 Ga0496115_0424052 3300048918 Bacteria 1077
459 Ga0496117_0161989 3300048920 Bacteria 1309
460 Ga0496118_0230083 3300048921 Bacteria 1071
461 Ga0496119_0187047 3300048922 Bacteria 1082
462 Ga0496121_0001658 3300048924 Bacteria 36741
463 Ga0496121_0120792 3300048924 Bacteria 1979
464 Ga0496121_0181463 3300048924 Bacteria 1519
465 Ga0496126_0132985 3300048929 Bacteria 2148
466 Ga0501041_0427737 3300049577 Bacteria 840
467 Ga0501042_0488515 3300049578 Bacteria 894
468 Ga0501067_0159053 3300049583 Bacteria 1258
469 Ga0501069_0215804 3300049585 Bacteria 1114
470 Ga0501076_1134156 3300049592 Bacteria 644
471 nmdc:mga03683_302074_c1 3300050489 Bacteria 751
472 nmdc:mga00v17_585465_c1 3300050491 Bacteria 720
473 nmdc:mga0k408_291697_c1 3300050493 Bacteria 974
474 nmdc:mga06z11_179670_c1 3300050494 Bacteria 1219
475 nmdc:mga06z11_307169_c1 3300050494 Bacteria 944
476 nmdc:mga06z11_69476_c1 3300050494 Bacteria 1860
477 nmdc:mga04h51_110792_c1 3300050495 Bacteria 1012
478 nmdc:mga04h51_207832_c1 3300050495 Bacteria 771
479 nmdc:mga07m45_76843_c1 3300050496 Bacteria 1904
480 nmdc:mga0rr50_1251832_c1 3300050513 Bacteria 630
481 nmdc:mga0a205_462170_c1 3300050515 Bacteria 1128
482 Ga0495601_0017217 3300053077 Bacteria 4387
483 Ga0495601_0176376 3300053077 Bacteria 1397
484 Ga0500635_0019090 3300053080 Bacteria 2079
485 Ga0495595_0000318 3300053084 Bacteria 18768
486 Ga0495595_0035246 3300053084 Bacteria 2267
487 Ga0495619_0000209 3300053085 Bacteria 42507
488 Ga0495619_0284482 3300053085 Bacteria 1146
489 Ga0495619_0306713 3300053085 Bacteria 1099
490 Ga0495619_0440603 3300053085 Bacteria 898
491 Ga0500566_0002846 3300053094 Bacteria 10302
492 Ga0500554_011963 3300053102 Bacteria 2168
493 Ga0500554_081442 3300053102 Bacteria 1066
494 Ga0500595_001033 3300053119 Bacteria 15530
495 Ga0500658_0332610 3300053134 Bacteria 698
496 Ga0500638_001518 3300053162 Bacteria 7375
497 Ga0500636_0180911 3300053177 Bacteria 1132
498 Ga0500637_0000171 3300053178 Bacteria 24172
499 Ga0500637_0054380 3300053178 Bacteria 2285
500 Ga0500611_018453 3300053727 Bacteria 1287
501 Ga0500661_005019 3300055283 Bacteria 2479
502 2513656724 2513237096 Bacteria 8722461
503 2513672228 2513237098 Bacteria 9902361
504 2513917909 2513237145 Bacteria 8979722
505 2793077300
506 2849079981 2849076700 Bacteria 7039503
507 2903772579 2903768456 Bacteria 9749579
508 2906642691 2906635258 Bacteria 8601019
509 2906661446 2906660503 Bacteria 8595048
510 2908779457 2908775508 Bacteria 8092255
511 8006930206 8006926726 Bacteria 6749210
512 8016592720 8016583857 Bacteria 10421953
513 8056690141 8056689827 Bacteria 6712655
514 Ga0157372_10715812
515 JGI25153J46596_10001608
516 rootL2_10046849
517 JGI25404J52841_10018728
518 Ga0070658_10519192
519 Ga0070683_100022065
520 Ga0070690_100135182
521 Ga0070670_100401096
522 Ga0068869_100043742
523 Ga0068869_100058481
524 Ga0070680_100009263
525 Ga0070680_100523904
526 Ga0070682_100124134
527 Ga0068868_100211000
528 Ga0068868_100244512
529 Ga0070660_100121369
530 Ga0070660_100412604
531 Ga0070689_100328141
532 Ga0070689_100623459
533 Ga0070691_10081734
534 Ga0070691_10117597
535 Ga0070687_100149609
536 Ga0070661_100300986
537 Ga0070668_100063024
538 Ga0070668_100275165
539 Ga0070675_100382737
540 Ga0070675_100639854
541 Ga0070671_100090345
542 Ga0070671_100198218
543 Ga0070671_100436148
544 Ga0070674_100173621
545 Ga0070674_100200782
546 Ga0070659_100124003
547 Ga0070659_100282984
548 Ga0070667_101031346
549 Ga0070709_10006973
550 Ga0070709_10330190
551 Ga0070714_100005674
552 Ga0070714_100566105
553 Ga0070713_100003086
554 Ga0070713_100022619
555 Ga0070713_100174649
556 Ga0070710_10001162
557 Ga0070710_10021741
558 Ga0070701_10051251
559 Ga0070711_100009117
560 Ga0070711_100229881
561 Ga0070705_100139865
562 Ga0070700_100005487
563 Ga0070700_100413978
564 Ga0070700_101386164
565 Ga0070694_100714779
566 Ga0070694_100750809
567 Ga0070663_100067561
568 Ga0070663_100164603
569 Ga0070663_100186844
570 Ga0070678_100205468
571 Ga0070662_100134055
572 Ga0070662_100150235
573 Ga0070681_10229357
574 Ga0068867_100153662
575 Ga0070706_101226588
576 Ga0070706_101273399
577 Ga0070698_100019028
578 Ga0070698_100227028
579 Ga0070698_100685996
580 Ga0070699_100216515
581 Ga0070699_101590451
582 Ga0070679_100182988
583 Ga0070684_100182433
584 Ga0070697_100146013
585 Ga0070697_101455483
586 Ga0068853_100007871
587 Ga0068853_100065731
588 Ga0068853_100537851
589 Ga0070672_100266782
590 Ga0070672_101243145
591 Ga0070686_100020525
592 Ga0070686_100835660
593 Ga0070696_100243025
594 Ga0070665_100071953
595 Ga0070665_100114353
596 Ga0068855_100169344
597 Ga0070664_100112569
598 Ga0070664_100584822
599 Ga0070664_100936963
600 Ga0068857_100050008
601 Ga0068857_100146748
602 Ga0068854_100226848
603 Ga0068854_100328736
604 Ga0068856_100073356
605 Ga0070702_100062203
606 Ga0070702_100540386
607 Ga0068852_100197678
608 Ga0068859_100127354
609 Ga0068864_100016149
610 Ga0068866_10119743
611 Ga0068866_10243187
612 Ga0068861_100156668
613 Ga0068861_100278636
614 Ga0068861_100384819
615 Ga0068851_10007969
616 Ga0068870_10263951
617 Ga0068863_100149086
618 Ga0068858_100292283
619 Ga0068858_100537171
620 Ga0068860_100122997
621 Ga0068860_100128140
622 Ga0068862_100032061
623 Ga0068862_100115773
624 Ga0081455_10057658
625 Ga0081540_1022745
626 Ga0081540_1165709
627 Ga0081540_1245663
628 Ga0081539_10061638
629 Ga0070717_10002657
630 Ga0070717_10043382
631 Ga0070717_10484379
632 Ga0075365_10150409
633 Ga0075368_10163800
634 Ga0070715_10000380
635 Ga0070715_10238663
636 Ga0070715_10425659
637 Ga0070716_100029256
638 Ga0070716_100192396
639 Ga0070716_100528905
640 Ga0070712_100054302
641 Ga0070712_100114198
642 Ga0070712_100519515
643 Ga0075367_10169278
644 Ga0075369_10084625
645 Ga0075366_10143850
646 Ga0075366_10411443
647 Ga0097621_100081202
648 Ga0075370_10025361
649 Ga0068871_100103620
650 Ga0075433_10106165
651 Ga0075434_100033109
652 Ga0068865_100066409
653 Ga0068865_100079264
654 Ga0097620_100127357
655 Ga0075435_100171604
656 Ga0099795_10000591
657 Ga0099795_10006678
658 Ga0099795_10046316
659 Ga0099795_10131208
660 Ga0105240_10058977
661 Ga0105240_10070763
662 Ga0111539_10814876
663 Ga0105245_10120475
664 Ga0105245_10150816
665 Ga0105245_10532529
666 Ga0105243_10302871
667 Ga0105243_10331677
668 Ga0105241_10256325
669 Ga0105242_10149252
670 Ga0105248_10079923
671 Ga0105248_10123885
672 Ga0105248_10252967
673 Ga0105248_10596129
674 Ga0105237_10121031
675 Ga0105237_10157017
676 Ga0105238_10017117
677 Ga0099796_10102685
678 Ga0105239_10011854
679 Ga0105239_10149126
680 Ga0105239_12276723
681 Ga0105246_10185218
682 Ga0105246_10528039
683 Ga0157370_10304011
684 Ga0157369_10049940
685 Ga0157374_10154254
686 Ga0157378_10006063
687 Ga0157378_10095213
688 Ga0163162_10059345
689 Ga0163162_10552821
690 Ga0163162_10755463
691 Ga0157375_10043306
692 Ga0157375_10054332
693 Ga0157375_10863471
694 Ga0163163_10338651
695 Ga0157380_10244848
696 Ga0157379_10092408
697 Ga0157379_10176892
698 Ga0157376_11092991
699 Ga0163161_10138342
700 Ga0163161_10372713
701 Ga0214542_1021461
702 Ga0214545_1019801
703 Ga0214543_1020055
704 Ga0209758_1001586
705 Ga0207697_10024285
706 Ga0207656_10010125
707 Ga0207692_10005319
708 Ga0207710_10153418
709 Ga0207688_10025578
710 Ga0207688_10702765
711 Ga0207685_10015713
712 Ga0207685_10174660
713 Ga0207699_10026595
714 Ga0207699_10276898
715 Ga0207654_10080565
716 Ga0207707_10009415
717 Ga0207695_10028180
718 Ga0207695_10842322
719 Ga0207671_10012560
720 Ga0207671_10398840
721 Ga0207693_10000941
722 Ga0207693_10040524
723 Ga0207693_10405440
724 Ga0207663_10000377
725 Ga0207663_10016181
726 Ga0207662_10099120
727 Ga0207657_10003989
728 Ga0207657_10351460
729 Ga0207649_10085328
730 Ga0207649_10127954
731 Ga0207652_10012855
732 Ga0207646_10123558
733 Ga0207646_11077401
734 Ga0207650_10280900
735 Ga0207659_10048310
736 Ga0207659_11194744
737 Ga0207687_10104868
738 Ga0207700_10004236
739 Ga0207700_10014543
740 Ga0207700_10184406
741 Ga0207664_10224895
742 Ga0207644_10060831
743 Ga0207644_10126174
744 Ga0207644_10183345
745 Ga0207644_10444214
746 Ga0207690_10411370
747 Ga0207690_10521603
748 Ga0207706_10032641
749 Ga0207686_10100556
750 Ga0207709_10095321
751 Ga0207670_10483387
752 Ga0207669_10126926
753 Ga0207669_10624197
754 Ga0207665_10000175
755 Ga0207665_10454626
756 Ga0207665_10818829
757 Ga0207691_10028591
758 Ga0207691_11015901
759 Ga0207711_10072526
760 Ga0207711_10170746
761 Ga0207711_10454291
762 Ga0207711_10476046
763 Ga0207689_10012457
764 Ga0207679_10840256
765 Ga0207667_10114900
766 Ga0207712_10198021
767 Ga0207712_10688645
768 Ga0207668_10486108
769 Ga0207640_10290225
770 Ga0207640_10686242
771 Ga0207677_10134339
772 Ga0207677_10190041
773 Ga0207677_10704958
774 Ga0207703_10400480
775 Ga0207639_10049830
776 Ga0207639_10058157
777 Ga0207678_10066634
778 Ga0207678_10103971
779 Ga0207708_10011091
780 Ga0207702_10246000
781 Ga0207648_10062237
782 Ga0207676_10744817
783 Ga0207674_10064072
784 Ga0207674_10137497
785 Ga0207674_10409355
786 Ga0207675_100035208
787 Ga0207683_10028034
788 Ga0207698_10261936
789 Ga0209179_1005955
790 Ga0209588_1006491
791 Ga0268266_10049456
792 Ga0268266_11322387
793 Ga0268265_10095492
794 Ga0268265_10919217
795 Ga0268264_10182025
796 Ga0268264_10562045
797 Ga0265338_10751623
798 Ga0265330_10020021
799 Ga0265332_10036256
800 Ga0265328_10081725
801 Ga0265325_10012511
802 Ga0307513_10358469
803 Ga0307408_100184024
804 Ga0265314_10139629
805 Ga0265342_10034628
806 Ga0307516_10016663
807 Ga0307516_10062333
808 Ga0307516_10518567
809 Ga0307405_10367725
810 Ga0307416_100385730
811 Ga0307414_11155954
812 Ga0307415_100020454
813 Ga0373930_0002355
814 Ga0373938_0039619
815 Ga0373934_0002896
816 Ga0373952_0131818
817 Ga0373923_0001863
818 Ga0373923_0226274
819 Ga0373932_0033948
820 Ga0373953_0000355
821 Ga0373954_0000035
822 Ga0373954_0045921
823 Ga0373956_0000207
824 Ga0373956_0588249
825 Ga0373957_0001128
826 Ga0373946_0027894
827 Ga0373946_0110437
828 Ga0373955_0001046
829 Ga0373955_0048115
830 Ga0373924_0036727
831 Ga0373924_0094333
832 Ga0373924_0206850
833 Ga0373931_0009173
834 Ga0373931_0076213
835 Ga0373935_0000256
836 Ga0373935_0794947
837 Ga0373927_0000720
838 Ga0373927_0006772
839 Ga0373927_0049614
840 Ga0373933_0000037
841 Ga0373933_0110854
842 Ga0373947_0001480
843 Ga0373937_0000118
844 Ga0373925_0006533
845 Ga0373925_0203706
846 Ga0373925_1003709
847 Ga0395900_0481634
848 Ga0395898_0125801
849 Ga0395905_0008572
850 Ga0451837_1166160
851 Ga0495592_0000649
852 Ga0495603_0000027
853 Ga0495603_0008387
854 Ga0495603_0033441
855 Ga0495629_0000290
856 Ga0495629_0018856
857 Ga0495629_0547934
858 Ga0495641_0002984
859 Ga0495651_0000412
860 Ga0495653_0000161
861 Ga0495580_0000610
862 Ga0495582_0000425
863 Ga0495605_0149123
864 Ga0495639_0000048
865 Ga0495662_0000505
866 Ga0495662_0233289
867 Ga0495664_0028412
868 Ga0495584_0246447
869 Ga0495594_0000279
870 Ga0495608_0000403
871 Ga0495618_0635917
872 Ga0495628_0002406
873 Ga0495630_0009542
874 Ga0495663_0301229
875 Ga0495652_0000604
876 Ga0495665_0000165
877 Ga0495640_0007108
878 Ga0495640_0014844
879 Ga0495587_0001226
880 Ga0495645_0049167
881 Ga0495645_0355765
882 Ga0495622_0005916
883 Ga0495667_0000147
884 Ga0495667_0018087
885 Ga0495656_0003251
886 Ga0495634_0001502
887 Ga0495634_0002287
888 Ga0495625_0330042
889 Ga0495625_0603397
890 Ga0495635_0000517
891 Ga0495635_0088466
892 Ga0495657_0000995
893 Ga0495599_0000685
894 Ga0495599_0232196
895 Ga0495623_0000549
896 Ga0495646_0013363
897 Ga0495646_0033391
898 Ga0495647_0013066
899 Ga0495658_0001036
900 Ga0495669_0012938
901 Ga0495613_0006844
902 Ga0495613_0020900
903 Ga0495624_0014366
904 Ga0495649_0366074
905 Ga0495600_0000771
906 Ga0495581_0003661
907 Ga0495604_0000253
908 Ga0495674_0098844
909 Ga0495672_0039757
910 Ga0495672_0306437
911 Ga0495676_0104292
912 Ga0495676_0445040
913 Ga0495680_0000406
914 Ga0495675_0001164
915 Ga0495673_0039139
916 Ga0495684_0000184
917 Ga0495684_0018644
918 Ga0495593_0000160
919 Ga0495593_0002781
920 Ga0495602_0002194
921 Ga0495602_0443121
922 Ga0495614_0046488
923 Ga0496100_0016640
924 Ga0496100_0206397
925 Ga0496100_0286691
926 Ga0496100_0350906
927 Ga0496101_0055478
928 Ga0496101_0121957
929 Ga0496101_0244876
930 Ga0496102_0034726
931 Ga0496102_0176228
932 Ga0496102_0553342
933 Ga0496103_0186895
934 Ga0496104_0453257
935 Ga0496104_0473133
936 Ga0496105_0013417
937 Ga0496105_0346493
938 Ga0496106_0018584
939 Ga0496106_0020169
940 Ga0496106_0060242
941 Ga0496106_0152950
942 Ga0496106_0879558
943 Ga0496107_0018119
944 Ga0496107_0191778
945 Ga0496107_0691647
946 Ga0496108_0025680
947 Ga0496108_0193929
948 Ga0496108_0773520
949 Ga0496109_0121063
950 Ga0496109_0217615
951 Ga0496109_0223155
952 Ga0496109_0454019
953 Ga0496110_0022169
954 Ga0496110_0719663
955 Ga0496111_0022030
956 Ga0496111_0063155
957 Ga0496112_0023082
958 Ga0496112_0030050
959 Ga0496112_0540645
960 Ga0496112_0823496
961 Ga0496113_0004920
962 Ga0496113_0072692
963 Ga0496113_0450762
964 Ga0496114_0016576
965 Ga0496114_0245648
966 Ga0496115_0056465
967 Ga0496115_0062742
968 Ga0496115_0073781
969 Ga0496115_0107356
970 Ga0496115_0255105
971 Ga0496115_0424052
972 Ga0496117_0161989
973 Ga0496118_0230083
974 Ga0496119_0187047
975 Ga0496121_0001658
976 Ga0496121_0120792
977 Ga0496121_0181463
978 Ga0496126_0132985
979 Ga0501041_0427737
980 Ga0501042_0488515
981 Ga0501067_0159053
982 Ga0501069_0215804
983 Ga0501076_1134156
984 nmdc:mga03683_302074_c1
985 nmdc:mga00v17_585465_c1
986 nmdc:mga0k408_291697_c1
987 nmdc:mga06z11_179670_c1
988 nmdc:mga06z11_307169_c1
989 nmdc:mga06z11_69476_c1
990 nmdc:mga04h51_110792_c1
991 nmdc:mga04h51_207832_c1
992 nmdc:mga07m45_76843_c1
993 nmdc:mga0rr50_1251832_c1
994 nmdc:mga0a205_462170_c1
995 Ga0495601_0017217
996 Ga0495601_0176376
997 Ga0500635_0019090
998 Ga0495595_0000318
999 Ga0495595_0035246
1000 Ga0495619_0000209
1001 Ga0495619_0284482
1002 Ga0495619_0306713
1003 Ga0495619_0440603
1004 Ga0500566_0002846
1005 Ga0500554_011963
1006 Ga0500554_081442
1007 Ga0500595_001033
1008 Ga0500658_0332610
1009 Ga0500638_001518
1010 Ga0500636_0180911
1011 Ga0500637_0000171
1012 Ga0500637_0054380
1013 Ga0500611_018453
1014 Ga0500661_005019
1015 2513656724
1016 2513672228
1017 2513917909
1018 2793077300
1019 2849079981
1020 2903772579
1021 2906642691
1022 2906661446
1023 2908779457
1024 8006930206
1025 8016592720
1026 8056690141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04314

PCuAC

Copper chaperone PCu(A)C

58

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p1g-assembly2.cif.gz_B copper-bound pcuac domain from pmof2 0.9348 24 148
3zja-assembly1.cif.gz_A the crystal structure of a cu(i) metallochaperone from streptomyces lividans 0.919 30 148
6p1g-assembly2.cif.gz_B copper-bound pcuac domain from pmof2 0.9119 24 148
3zja-assembly1.cif.gz_A the crystal structure of a cu(i) metallochaperone from streptomyces lividans 0.8963 30 148
6p17-assembly1.cif.gz_B apo pcuac domain from pmof1 0.8884 24 148
ID Description Score Start End Superfamily
3zk0A01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.911 36 147 2.60.40.1890
3zk0A01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.895 36 147 2.60.40.1890
2k6zA01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.8135 37 147 2.60.40.1890
2k6zA01 Mainly Beta;Sandwich;Immunoglobulin-like;PCu(A)C copper chaperone 0.7883 37 147 2.60.40.1890
af_P9WK63_54_178_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7305 31 151 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2E8S3P2-F1-model_v4 Cytochrome c domain-containing protein 0.9597 31 151 GO:0009055
GO:0020037
GO:0046872
AF-A0A849G549-F1-model_v4 Copper chaperone PCu(A)C 0.9455 60 147
AF-A0A259E1J6-F1-model_v4 deleted 0.9438 33 148
AF-A0A7Y2JJR2-F1-model_v4 Copper chaperone PCu(A)C 0.9403 45 147
AF-A0A511UPM7-F1-model_v4 Transporter 0.9379 23 148

Map