F457575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 513 | 296 | 504 | 697 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000846|Ga0213875_1000084617 |
| Length | 789 |
| Sequence | MPLPIAAVGAERLGLAGAAGGALDRAGAADGPAHVVRVMNFPGKDGVIGAGTGTHDGGTGSDGNEEVLPDSGVWPGDSYPLGATYDGAGTNFALFSEAAEQVELCLFGDDGTESRVSLREVDGFVWHVYLPGVRPGQRYGYRVHGPYQPAAGQRCNPAKLLLDPYAKAIEGSVDWNPAVFSYPFGDPDGRNDSDSAPYVPRCVVVNPYFDWNRDRPLRRQYHETVIYEAHVRGLTKLHPVIPDEQRGTYLGLAHPAVISHLLRLGVTAIELMPVHQFVTDAVLAERGLTNYWGYNTIGFFAPHNAYAATGARGEQVQEFKTMVRTIHEAGIEVILDVVYNHTAEGNHLGPTLSFRGIDNAAYYRLTEHDRRYYLDTTGTGNSLLVRHPHVLQMIMDSLRYWVLEMHVDGFRFDLAAALARQFHDVDRLSAFFDLVQQDPVVSQVKLIAEPWDVGDGGYQVGKFPPLWTEWNGKYRDTIRDFWRGQPATLPGFASRFTGSSDLYQQDSRRPVASVNFVTCHDGFTLADLVSYNHKHNEANGEDNRDGXXXNRSWNCGHEGPADDPAVLALRARQKRNFLATLLLSQGIPMLLSGDEIGRTQRGNNNAYCQDSEISWLDWTVHPGEDEALLDYVRYLIRLRAAHPVFRRRRFFRGATVRNGRQRVGDIAWFTPHGKVMGRRDWGVGFAKSLTVFLNGRAISEPDRRGERMQDNSFLLLFNASEKDLEFVIPARRYGERWTPLLNTASTKWAGPGIPAWEVPAWQGMDTLVPVKPGDPVPVMNRSIQLFSRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 2 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 3 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 4 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 5 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 6 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 7 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 86 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 130 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 131 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 146 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 162 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 163 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 164 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 265 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 289 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 290 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 295 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 296 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.25 |
| Metatranscriptomes | 0 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 0 |
| Rhizoplane | 6.63 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10015433 | 3300003187 | Bacteria | 3366 |
| 2 | JGI25406J46586_10013129 | 3300003203 | Bacteria | 3571 |
| 3 | rootH1_10001440 | 3300003316 | Bacteria | 15260 |
| 4 | rootH2_10000168 | 3300003320 | Bacteria | 68699 |
| 5 | rootH2_10001891 | 3300003320 | Bacteria | 464318 |
| 6 | rootH2_10028067 | 3300003320 | Bacteria | 17761 |
| 7 | rootL2_10010183 | 3300003322 | Bacteria | 3714 |
| 8 | rootL2_10043375 | 3300003322 | Bacteria | 8981 |
| 9 | rootH1_10067383 | 3300003323 | Bacteria | 16790 |
| 10 | Ga0065712_10079582 | 3300005290 | Bacteria | 3201 |
| 11 | Ga0065715_10095353 | 3300005293 | Bacteria | 4104 |
| 12 | Ga0065707_10083283 | 3300005295 | Bacteria | 9683 |
| 13 | Ga0070683_100002617 | 3300005329 | Bacteria | 14399 |
| 14 | Ga0070683_100089968 | 3300005329 | Bacteria | 2881 |
| 15 | Ga0070670_100005087 | 3300005331 | Bacteria | 11067 |
| 16 | Ga0070670_100014124 | 3300005331 | Bacteria | 6850 |
| 17 | Ga0070670_100043713 | 3300005331 | Bacteria | 3851 |
| 18 | Ga0070666_10006642 | 3300005335 | Bacteria | 7112 |
| 19 | Ga0070680_100021927 | 3300005336 | Bacteria | 5079 |
| 20 | Ga0070687_100017017 | 3300005343 | Bacteria | 3333 |
| 21 | Ga0070661_100004126 | 3300005344 | Bacteria | 10015 |
| 22 | Ga0070661_100012047 | 3300005344 | Bacteria | 6043 |
| 23 | Ga0070669_100000002 | 3300005353 | Bacteria | 506497 |
| 24 | Ga0070675_100012148 | 3300005354 | Bacteria | 6752 |
| 25 | Ga0070671_100000660 | 3300005355 | Bacteria | 24797 |
| 26 | Ga0070674_100034906 | 3300005356 | Bacteria | 3363 |
| 27 | Ga0070659_100052483 | 3300005366 | Bacteria | 3207 |
| 28 | Ga0070659_100060722 | 3300005366 | Bacteria | 2986 |
| 29 | Ga0070709_10001376 | 3300005434 | Bacteria | 13243 |
| 30 | Ga0070709_10003161 | 3300005434 | Bacteria | 8834 |
| 31 | Ga0070714_100003304 | 3300005435 | Bacteria | 12024 |
| 32 | Ga0070714_100003805 | 3300005435 | Bacteria | 11335 |
| 33 | Ga0070714_100022101 | 3300005435 | Bacteria | 5212 |
| 34 | Ga0070713_100000264 | 3300005436 | Bacteria | 34426 |
| 35 | Ga0070713_100001778 | 3300005436 | Bacteria | 13896 |
| 36 | Ga0070711_100001350 | 3300005439 | Bacteria | 13399 |
| 37 | Ga0070711_100003179 | 3300005439 | Bacteria | 9528 |
| 38 | Ga0070711_100016882 | 3300005439 | Bacteria | 4641 |
| 39 | Ga0070711_100024118 | 3300005439 | Bacteria | 3964 |
| 40 | Ga0070708_100004573 | 3300005445 | Bacteria | 10897 |
| 41 | Ga0070681_10029040 | 3300005458 | Bacteria | 5553 |
| 42 | Ga0070685_10020317 | 3300005466 | Bacteria | 3594 |
| 43 | Ga0070706_100017990 | 3300005467 | Bacteria | 6519 |
| 44 | Ga0070707_100010437 | 3300005468 | Bacteria | 8650 |
| 45 | Ga0070699_100001172 | 3300005518 | Bacteria | 24336 |
| 46 | Ga0070699_100004132 | 3300005518 | Bacteria | 12822 |
| 47 | Ga0070699_100016948 | 3300005518 | Bacteria | 6255 |
| 48 | Ga0070699_100067345 | 3300005518 | Bacteria | 3109 |
| 49 | Ga0070697_100007695 | 3300005536 | Bacteria | 8390 |
| 50 | Ga0068853_100000026 | 3300005539 | Bacteria | 129915 |
| 51 | Ga0068853_100007980 | 3300005539 | Bacteria | 8488 |
| 52 | Ga0070672_100099761 | 3300005543 | Bacteria | 2354 |
| 53 | Ga0070695_100049771 | 3300005545 | Bacteria | 2683 |
| 54 | Ga0070696_100013273 | 3300005546 | Bacteria | 5527 |
| 55 | Ga0070693_100039018 | 3300005547 | Bacteria | 2658 |
| 56 | Ga0070665_100007883 | 3300005548 | Bacteria | 10801 |
| 57 | Ga0070665_100044790 | 3300005548 | Bacteria | 4442 |
| 58 | Ga0068855_100021189 | 3300005563 | Bacteria | 7792 |
| 59 | Ga0068854_100000893 | 3300005578 | Bacteria | 17918 |
| 60 | Ga0068856_100004316 | 3300005614 | Bacteria | 14188 |
| 61 | Ga0068851_10005240 | 3300005834 | Bacteria | 5884 |
| 62 | Ga0068863_100000504 | 3300005841 | Bacteria | 39706 |
| 63 | Ga0068863_100111888 | 3300005841 | Bacteria | 2600 |
| 64 | Ga0068860_100017670 | 3300005843 | Bacteria | 6949 |
| 65 | Ga0081455_10001140 | 3300005937 | Bacteria | 33253 |
| 66 | Ga0081455_10014546 | 3300005937 | Bacteria | 7704 |
| 67 | Ga0081455_10045466 | 3300005937 | Bacteria | 3820 |
| 68 | Ga0081540_1000255 | 3300005983 | Bacteria | 56347 |
| 69 | Ga0081540_1004824 | 3300005983 | Bacteria | 10157 |
| 70 | Ga0081540_1033342 | 3300005983 | Bacteria | 2798 |
| 71 | Ga0081539_10000128 | 3300005985 | Bacteria | 179041 |
| 72 | Ga0070717_10000099 | 3300006028 | Bacteria | 66953 |
| 73 | Ga0070717_10033968 | 3300006028 | Bacteria | 4119 |
| 74 | Ga0075365_10011245 | 3300006038 | Bacteria | 5257 |
| 75 | Ga0075368_10005451 | 3300006042 | Bacteria | 4373 |
| 76 | Ga0075364_10000451 | 3300006051 | Bacteria | 20676 |
| 77 | Ga0070712_100002533 | 3300006175 | Bacteria | 11285 |
| 78 | Ga0070712_100006064 | 3300006175 | Bacteria | 7484 |
| 79 | Ga0075367_10008071 | 3300006178 | Bacteria | 5432 |
| 80 | Ga0097621_100001393 | 3300006237 | Bacteria | 16644 |
| 81 | Ga0097621_100009390 | 3300006237 | Bacteria | 7098 |
| 82 | Ga0075370_10016045 | 3300006353 | Bacteria | 4024 |
| 83 | Ga0075428_100000603 | 3300006844 | Bacteria | 36642 |
| 84 | Ga0075430_100000686 | 3300006846 | Bacteria | 25836 |
| 85 | Ga0075431_100001757 | 3300006847 | Bacteria | 20399 |
| 86 | Ga0075431_100004792 | 3300006847 | Bacteria | 13309 |
| 87 | Ga0075433_10044981 | 3300006852 | Bacteria | 3837 |
| 88 | Ga0075434_100012579 | 3300006871 | Bacteria | 8026 |
| 89 | Ga0075434_100033455 | 3300006871 | Bacteria | 5073 |
| 90 | Ga0075429_100000241 | 3300006880 | Bacteria | 37754 |
| 91 | Ga0075436_100018464 | 3300006914 | Bacteria | 4774 |
| 92 | Ga0075436_100058086 | 3300006914 | Bacteria | 2672 |
| 93 | Ga0099794_10012756 | 3300007265 | Bacteria | 3638 |
| 94 | Ga0105240_10160614 | 3300009093 | Bacteria | 2669 |
| 95 | Ga0111539_10019873 | 3300009094 | Bacteria | 8276 |
| 96 | Ga0111539_10052977 | 3300009094 | Bacteria | 4829 |
| 97 | Ga0105245_10015648 | 3300009098 | Bacteria | 6616 |
| 98 | Ga0105245_10015804 | 3300009098 | Bacteria | 6579 |
| 99 | Ga0114129_10000417 | 3300009147 | Bacteria | 50353 |
| 100 | Ga0114129_10009295 | 3300009147 | Bacteria | 14019 |
| 101 | Ga0114129_10021814 | 3300009147 | Bacteria | 9090 |
| 102 | Ga0114129_10025190 | 3300009147 | Bacteria | 8431 |
| 103 | Ga0105241_10051529 | 3300009174 | Bacteria | 3139 |
| 104 | Ga0105238_10026444 | 3300009551 | Bacteria | 5917 |
| 105 | Ga0105238_10102273 | 3300009551 | Bacteria | 2847 |
| 106 | Ga0105239_10026105 | 3300010375 | Bacteria | 6431 |
| 107 | Ga0105239_10059957 | 3300010375 | Bacteria | 4176 |
| 108 | Ga0105246_10021813 | 3300011119 | Bacteria | 4126 |
| 109 | Ga0157369_10109899 | 3300013105 | Bacteria | 2931 |
| 110 | Ga0157374_10032453 | 3300013296 | Bacteria | 4754 |
| 111 | Ga0157378_10000813 | 3300013297 | Bacteria | 29000 |
| 112 | Ga0157378_10021973 | 3300013297 | Bacteria | 5611 |
| 113 | Ga0163162_10006390 | 3300013306 | Bacteria | 11409 |
| 114 | Ga0157375_10001683 | 3300013308 | Bacteria | 19023 |
| 115 | Ga0157375_10043696 | 3300013308 | Bacteria | 4348 |
| 116 | Ga0163163_10003462 | 3300014325 | Bacteria | 13417 |
| 117 | Ga0157379_10042342 | 3300014968 | Bacteria | 4065 |
| 118 | Ga0213873_10000815 | 3300021358 | Bacteria | 5026 |
| 119 | Ga0213875_10000097 | 3300021388 | Bacteria | 101618 |
| 120 | Ga0213875_10000373 | 3300021388 | Bacteria | 41081 |
| 121 | Ga0213875_10000774 | 3300021388 | Bacteria | 23879 |
| 122 | Ga0213875_10000846 | 3300021388 | Bacteria | 22615 |
| 123 | Ga0207697_10024864 | 3300025315 | Bacteria | 2450 |
| 124 | Ga0207653_10005025 | 3300025885 | Bacteria | 4131 |
| 125 | Ga0207692_10003323 | 3300025898 | Bacteria | 6269 |
| 126 | Ga0207642_10022670 | 3300025899 | Bacteria | 2495 |
| 127 | Ga0207688_10005543 | 3300025901 | Bacteria | 6865 |
| 128 | Ga0207685_10000884 | 3300025905 | Bacteria | 5667 |
| 129 | Ga0207699_10001648 | 3300025906 | Bacteria | 10581 |
| 130 | Ga0207699_10002880 | 3300025906 | Bacteria | 8162 |
| 131 | Ga0207643_10009321 | 3300025908 | Bacteria | 5276 |
| 132 | Ga0207684_10011356 | 3300025910 | Bacteria | 7795 |
| 133 | Ga0207684_10021941 | 3300025910 | Bacteria | 5452 |
| 134 | Ga0207654_10014207 | 3300025911 | Bacteria | 4111 |
| 135 | Ga0207693_10000559 | 3300025915 | Bacteria | 33636 |
| 136 | Ga0207693_10001654 | 3300025915 | Bacteria | 19673 |
| 137 | Ga0207693_10004042 | 3300025915 | Bacteria | 12467 |
| 138 | Ga0207693_10009175 | 3300025915 | Bacteria | 8077 |
| 139 | Ga0207693_10046833 | 3300025915 | Bacteria | 3397 |
| 140 | Ga0207663_10006017 | 3300025916 | Bacteria | 6169 |
| 141 | Ga0207662_10005433 | 3300025918 | Bacteria | 6797 |
| 142 | Ga0207657_10004945 | 3300025919 | Bacteria | 14023 |
| 143 | Ga0207657_10026592 | 3300025919 | Bacteria | 5313 |
| 144 | Ga0207657_10079239 | 3300025919 | Bacteria | 2764 |
| 145 | Ga0207649_10012345 | 3300025920 | Bacteria | 4737 |
| 146 | Ga0207652_10013880 | 3300025921 | Bacteria | 6519 |
| 147 | Ga0207646_10005559 | 3300025922 | Bacteria | 13231 |
| 148 | Ga0207646_10007887 | 3300025922 | Bacteria | 10746 |
| 149 | Ga0207646_10094806 | 3300025922 | Bacteria | 2673 |
| 150 | Ga0207681_10000107 | 3300025923 | Bacteria | 71564 |
| 151 | Ga0207694_10045445 | 3300025924 | Bacteria | 3392 |
| 152 | Ga0207650_10013391 | 3300025925 | Bacteria | 5679 |
| 153 | Ga0207687_10008894 | 3300025927 | Bacteria | 6564 |
| 154 | Ga0207700_10002444 | 3300025928 | Bacteria | 10665 |
| 155 | Ga0207700_10003799 | 3300025928 | Bacteria | 8832 |
| 156 | Ga0207700_10010189 | 3300025928 | Bacteria | 5914 |
| 157 | Ga0207700_10034134 | 3300025928 | Bacteria | 3649 |
| 158 | Ga0207664_10001387 | 3300025929 | Bacteria | 15911 |
| 159 | Ga0207664_10038893 | 3300025929 | Bacteria | 3690 |
| 160 | Ga0207644_10002149 | 3300025931 | Bacteria | 12787 |
| 161 | Ga0207690_10039790 | 3300025932 | Bacteria | 3069 |
| 162 | Ga0207669_10026237 | 3300025937 | Bacteria | 3166 |
| 163 | Ga0207665_10044967 | 3300025939 | Bacteria | 2956 |
| 164 | Ga0207691_10031885 | 3300025940 | Bacteria | 4918 |
| 165 | Ga0207691_10090881 | 3300025940 | Bacteria | 2736 |
| 166 | Ga0207689_10002061 | 3300025942 | Bacteria | 18976 |
| 167 | Ga0207689_10030442 | 3300025942 | Bacteria | 4498 |
| 168 | Ga0207679_10044502 | 3300025945 | Bacteria | 3203 |
| 169 | Ga0207679_10055338 | 3300025945 | Bacteria | 2924 |
| 170 | Ga0207667_10011781 | 3300025949 | Bacteria | 10133 |
| 171 | Ga0207712_10032800 | 3300025961 | Bacteria | 3507 |
| 172 | Ga0207703_10019023 | 3300026035 | Bacteria | 5365 |
| 173 | Ga0207703_10025892 | 3300026035 | Bacteria | 4616 |
| 174 | Ga0207639_10000047 | 3300026041 | Bacteria | 129978 |
| 175 | Ga0207639_10015385 | 3300026041 | Bacteria | 5398 |
| 176 | Ga0207702_10029993 | 3300026078 | Bacteria | 4530 |
| 177 | Ga0207702_10030312 | 3300026078 | Bacteria | 4507 |
| 178 | Ga0207702_10063441 | 3300026078 | Bacteria | 3159 |
| 179 | Ga0207641_10001152 | 3300026088 | Bacteria | 26560 |
| 180 | Ga0207641_10040290 | 3300026088 | Bacteria | 3911 |
| 181 | Ga0207675_100017666 | 3300026118 | Bacteria | 6654 |
| 182 | Ga0207683_10000774 | 3300026121 | Bacteria | 29121 |
| 183 | Ga0207683_10032657 | 3300026121 | Bacteria | 4522 |
| 184 | Ga0207683_10064492 | 3300026121 | Bacteria | 3228 |
| 185 | Ga0209179_1001311 | 3300027512 | Bacteria | 3000 |
| 186 | Ga0268266_10018094 | 3300028379 | Bacteria | 6006 |
| 187 | Ga0268264_10019520 | 3300028381 | Bacteria | 5538 |
| 188 | Ga0265338_10016700 | 3300028800 | Bacteria | 7955 |
| 189 | Ga0265338_10040452 | 3300028800 | Bacteria | 4378 |
| 190 | Ga0265338_10050368 | 3300028800 | Bacteria | 3765 |
| 191 | Ga0307512_10010890 | 3300030522 | Bacteria | 8651 |
| 192 | Ga0265325_10004350 | 3300031241 | Bacteria | 8971 |
| 193 | Ga0265340_10004918 | 3300031247 | Bacteria | 7430 |
| 194 | Ga0307413_10002099 | 3300031824 | Bacteria | 7986 |
| 195 | Ga0307412_10026904 | 3300031911 | Bacteria | 3581 |
| 196 | Ga0307409_100013643 | 3300031995 | Bacteria | 5242 |
| 197 | Ga0307409_100074140 | 3300031995 | Bacteria | 2718 |
| 198 | Ga0307416_100013124 | 3300032002 | Bacteria | 5619 |
| 199 | Ga0307416_100021161 | 3300032002 | Bacteria | 4662 |
| 200 | Ga0307411_10008896 | 3300032005 | Bacteria | 5238 |
| 201 | Ga0307411_10030611 | 3300032005 | Bacteria | 3301 |
| 202 | Ga0307507_10092331 | 3300033179 | Bacteria | 2584 |
| 203 | Ga0373926_0003540 | 3300035083 | Bacteria | 5054 |
| 204 | Ga0373926_0005823 | 3300035083 | Bacteria | 4072 |
| 205 | Ga0373934_0003415 | 3300035086 | Bacteria | 5823 |
| 206 | Ga0373934_0011375 | 3300035086 | Bacteria | 3348 |
| 207 | Ga0373934_0026920 | 3300035086 | Bacteria | 2232 |
| 208 | Ga0373944_0000943 | 3300035089 | Bacteria | 7205 |
| 209 | Ga0373944_0001042 | 3300035089 | Bacteria | 6858 |
| 210 | Ga0373923_0011221 | 3300035111 | Bacteria | 3280 |
| 211 | Ga0373936_0001929 | 3300035113 | Bacteria | 7667 |
| 212 | Ga0373936_0002658 | 3300035113 | Bacteria | 6681 |
| 213 | Ga0373936_0009052 | 3300035113 | Bacteria | 3756 |
| 214 | Ga0373945_0000377 | 3300035116 | Bacteria | 12821 |
| 215 | Ga0373945_0006198 | 3300035116 | Bacteria | 3848 |
| 216 | Ga0373956_0004461 | 3300035119 | Bacteria | 5598 |
| 217 | Ga0373956_0008925 | 3300035119 | Bacteria | 4063 |
| 218 | Ga0373956_0009588 | 3300035119 | Bacteria | 3943 |
| 219 | Ga0373957_0000317 | 3300035120 | Bacteria | 12135 |
| 220 | Ga0373943_0000181 | 3300035170 | Bacteria | 25149 |
| 221 | Ga0373946_0005032 | 3300035171 | Bacteria | 4760 |
| 222 | Ga0373946_0007155 | 3300035171 | Bacteria | 4075 |
| 223 | Ga0373955_0001068 | 3300035172 | Bacteria | 11680 |
| 224 | Ga0316574_0020851 | 3300035398 | Bacteria | 3884 |
| 225 | Ga0373924_0002867 | 3300035410 | Bacteria | 5845 |
| 226 | Ga0373935_0000009 | 3300035692 | Bacteria | 94996 |
| 227 | Ga0373935_0000806 | 3300035692 | Bacteria | 16772 |
| 228 | Ga0373927_0001841 | 3300035695 | Bacteria | 15749 |
| 229 | Ga0373927_0009188 | 3300035695 | Bacteria | 6633 |
| 230 | Ga0373947_0001366 | 3300035725 | Bacteria | 15007 |
| 231 | Ga0373947_0006365 | 3300035725 | Bacteria | 6862 |
| 232 | Ga0373947_0020871 | 3300035725 | Bacteria | 3787 |
| 233 | Ga0373937_0000061 | 3300036401 | Bacteria | 97707 |
| 234 | Ga0373937_0015565 | 3300036401 | Bacteria | 6730 |
| 235 | Ga0373937_0016629 | 3300036401 | Bacteria | 6537 |
| 236 | Ga0373925_0000407 | 3300037068 | Bacteria | 43887 |
| 237 | Ga0373925_0001422 | 3300037068 | Bacteria | 20777 |
| 238 | Ga0373925_0006054 | 3300037068 | Bacteria | 8950 |
| 239 | Ga0373925_0012778 | 3300037068 | Bacteria | 6082 |
| 240 | Ga0373925_0024957 | 3300037068 | Bacteria | 4365 |
| 241 | Ga0395900_0000048 | 3300037418 | Bacteria | 227760 |
| 242 | Ga0395898_0022774 | 3300037466 | Bacteria | 6340 |
| 243 | Ga0395898_0025022 | 3300037466 | Bacteria | 6019 |
| 244 | Ga0436364_0176464 | 3300037853 | Bacteria | 17092 |
| 245 | Ga0436364_0296067 | 3300037853 | Bacteria | 138817 |
| 246 | Ga0436364_0644502 | 3300037853 | Bacteria | 3298 |
| 247 | Ga0436364_0894784 | 3300037853 | Bacteria | 39842 |
| 248 | Ga0436364_1476073 | 3300037853 | Bacteria | 87559 |
| 249 | Ga0395901_0025061 | 3300038443 | Bacteria | 6123 |
| 250 | Ga0436365_1791131 | 3300039437 | Bacteria | 4310 |
| 251 | Ga0436362_0233102 | 3300039453 | Bacteria | 74564 |
| 252 | Ga0439446_0006240 | 3300042156 | Bacteria | 3101 |
| 253 | Ga0451577_0000060 | 3300042876 | Bacteria | 268725 |
| 254 | Ga0453683_0000072 | 3300044673 | Bacteria | 154688 |
| 255 | Ga0466965_0003154 | 3300044683 | Bacteria | 7193 |
| 256 | Ga0466963_0064566 | 3300044694 | Bacteria | 2453 |
| 257 | Ga0453684_0001498 | 3300044712 | Bacteria | 65796 |
| 258 | Ga0453684_0019163 | 3300044712 | Bacteria | 10437 |
| 259 | Ga0453684_0076723 | 3300044712 | Bacteria | 4194 |
| 260 | Ga0453684_0133902 | 3300044712 | Bacteria | 2970 |
| 261 | Ga0453684_0205927 | 3300044712 | Bacteria | 2290 |
| 262 | Ga0466968_0001843 | 3300044735 | Bacteria | 7654 |
| 263 | Ga0466970_0001176 | 3300044765 | Bacteria | 12699 |
| 264 | Ga0466957_0005675 | 3300044842 | Bacteria | 7015 |
| 265 | Ga0466957_0038576 | 3300044842 | Bacteria | 2878 |
| 266 | Ga0466959_0032729 | 3300045049 | Bacteria | 3849 |
| 267 | Ga0451576_0000280 | 3300045051 | Bacteria | 124909 |
| 268 | Ga0451576_0001606 | 3300045051 | Bacteria | 37960 |
| 269 | Ga0451576_0017044 | 3300045051 | Bacteria | 7996 |
| 270 | Ga0466958_0013332 | 3300045836 | Bacteria | 4677 |
| 271 | Ga0466967_0000029 | 3300045976 | Bacteria | 56648 |
| 272 | Ga0466967_0000157 | 3300045976 | Bacteria | 27186 |
| 273 | Ga0466967_0030746 | 3300045976 | Bacteria | 4509 |
| 274 | Ga0495592_0000022 | 3300046454 | Bacteria | 137550 |
| 275 | Ga0495603_0011459 | 3300046455 | Bacteria | 5367 |
| 276 | Ga0495641_0011508 | 3300046461 | Bacteria | 5034 |
| 277 | Ga0495651_0004547 | 3300046462 | Bacteria | 10603 |
| 278 | Ga0495651_0011480 | 3300046462 | Bacteria | 6802 |
| 279 | Ga0495651_0011722 | 3300046462 | Bacteria | 6736 |
| 280 | Ga0495653_0000043 | 3300046463 | Bacteria | 115966 |
| 281 | Ga0495653_0001121 | 3300046463 | Bacteria | 20617 |
| 282 | Ga0495653_0012548 | 3300046463 | Bacteria | 6919 |
| 283 | Ga0495653_0028498 | 3300046463 | Bacteria | 4464 |
| 284 | Ga0495653_0030416 | 3300046463 | Bacteria | 4302 |
| 285 | Ga0495580_0029934 | 3300046472 | Bacteria | 3947 |
| 286 | Ga0495580_0033376 | 3300046472 | Bacteria | 3709 |
| 287 | Ga0495582_0000396 | 3300046473 | Bacteria | 23768 |
| 288 | Ga0495639_0002474 | 3300046475 | Bacteria | 8063 |
| 289 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 290 | Ga0495664_0001297 | 3300046477 | Bacteria | 13091 |
| 291 | Ga0495607_0028760 | 3300046501 | Bacteria | 3425 |
| 292 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 293 | Ga0495608_0029985 | 3300046511 | Bacteria | 3685 |
| 294 | Ga0495608_0073318 | 3300046511 | Bacteria | 2232 |
| 295 | Ga0495618_0000001 | 3300046514 | Bacteria | 282202 |
| 296 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 297 | Ga0495628_0015961 | 3300046516 | Bacteria | 6266 |
| 298 | Ga0495628_0102684 | 3300046516 | Bacteria | 2205 |
| 299 | Ga0495630_0003036 | 3300046517 | Bacteria | 11651 |
| 300 | Ga0495630_0008948 | 3300046517 | Bacteria | 7187 |
| 301 | Ga0495643_0005631 | 3300046522 | Bacteria | 8402 |
| 302 | Ga0495666_0004839 | 3300046526 | Bacteria | 6804 |
| 303 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 304 | Ga0495665_0011683 | 3300046531 | Bacteria | 4757 |
| 305 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 306 | Ga0495640_0025685 | 3300046533 | Bacteria | 4267 |
| 307 | Ga0495586_0016961 | 3300046535 | Bacteria | 3873 |
| 308 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 309 | Ga0495587_0022976 | 3300046536 | Bacteria | 3835 |
| 310 | Ga0495587_0052561 | 3300046536 | Bacteria | 2403 |
| 311 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 312 | Ga0495645_0034819 | 3300046543 | Bacteria | 3671 |
| 313 | Ga0495667_0000006 | 3300046559 | Bacteria | 257523 |
| 314 | Ga0495667_0005691 | 3300046559 | Bacteria | 8437 |
| 315 | Ga0495667_0007050 | 3300046559 | Bacteria | 7628 |
| 316 | Ga0495667_0020485 | 3300046559 | Bacteria | 4462 |
| 317 | Ga0495667_0024218 | 3300046559 | Bacteria | 4088 |
| 318 | Ga0495667_0027860 | 3300046559 | Bacteria | 3804 |
| 319 | Ga0495667_0028835 | 3300046559 | Bacteria | 3738 |
| 320 | Ga0495634_0000001 | 3300046642 | Bacteria | 303746 |
| 321 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 322 | Ga0495635_0001577 | 3300046663 | Bacteria | 15318 |
| 323 | Ga0495588_0009401 | 3300046674 | Bacteria | 4518 |
| 324 | Ga0495657_0001727 | 3300046675 | Bacteria | 18708 |
| 325 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 326 | Ga0495599_0000598 | 3300046678 | Bacteria | 20586 |
| 327 | Ga0495623_0000048 | 3300046679 | Bacteria | 73714 |
| 328 | Ga0495623_0011872 | 3300046679 | Bacteria | 5644 |
| 329 | Ga0495623_0032583 | 3300046679 | Bacteria | 3349 |
| 330 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 331 | Ga0495613_0039298 | 3300046689 | Bacteria | 3508 |
| 332 | Ga0495624_0003291 | 3300046690 | Bacteria | 12039 |
| 333 | Ga0495624_0005701 | 3300046690 | Bacteria | 8933 |
| 334 | Ga0495600_0000390 | 3300046809 | Bacteria | 22682 |
| 335 | Ga0495581_0000829 | 3300047315 | Bacteria | 16482 |
| 336 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 337 | Ga0495604_0008302 | 3300047317 | Bacteria | 8213 |
| 338 | Ga0495604_0020817 | 3300047317 | Bacteria | 5236 |
| 339 | Ga0495674_0000006 | 3300047319 | Bacteria | 341772 |
| 340 | Ga0495674_0000327 | 3300047319 | Bacteria | 41880 |
| 341 | Ga0495674_0078782 | 3300047319 | Bacteria | 2830 |
| 342 | Ga0495674_0084309 | 3300047319 | Bacteria | 2724 |
| 343 | Ga0495672_0021597 | 3300047320 | Bacteria | 4197 |
| 344 | Ga0495676_0001524 | 3300047321 | Bacteria | 20072 |
| 345 | Ga0495676_0019846 | 3300047321 | Bacteria | 5906 |
| 346 | Ga0495680_0000366 | 3300047322 | Bacteria | 50665 |
| 347 | Ga0495680_0004908 | 3300047322 | Bacteria | 12671 |
| 348 | Ga0495675_0000088 | 3300047444 | Bacteria | 65283 |
| 349 | Ga0495684_0000003 | 3300047471 | Bacteria | 331335 |
| 350 | Ga0495684_0002732 | 3300047471 | Bacteria | 13959 |
| 351 | Ga0495684_0038353 | 3300047471 | Bacteria | 3674 |
| 352 | Ga0495602_0000011 | 3300048088 | Bacteria | 212024 |
| 353 | Ga0495602_0026435 | 3300048088 | Bacteria | 5597 |
| 354 | Ga0495602_0068704 | 3300048088 | Bacteria | 3041 |
| 355 | Ga0496100_0004179 | 3300048903 | Bacteria | 7613 |
| 356 | Ga0496101_0008392 | 3300048904 | Bacteria | 6750 |
| 357 | Ga0496102_0000030 | 3300048905 | Bacteria | 221326 |
| 358 | Ga0496102_0014672 | 3300048905 | Bacteria | 6811 |
| 359 | Ga0496103_0000068 | 3300048906 | Bacteria | 121996 |
| 360 | Ga0496103_0019527 | 3300048906 | Bacteria | 4069 |
| 361 | Ga0496104_0004383 | 3300048907 | Bacteria | 12294 |
| 362 | Ga0496104_0061581 | 3300048907 | Bacteria | 3558 |
| 363 | Ga0496105_0007585 | 3300048908 | Bacteria | 8408 |
| 364 | Ga0496105_0053253 | 3300048908 | Bacteria | 3342 |
| 365 | Ga0496105_0062844 | 3300048908 | Bacteria | 3064 |
| 366 | Ga0496106_0053323 | 3300048909 | Bacteria | 3054 |
| 367 | Ga0496108_0001111 | 3300048911 | Bacteria | 21045 |
| 368 | Ga0496108_0007888 | 3300048911 | Bacteria | 8631 |
| 369 | Ga0496108_0039146 | 3300048911 | Bacteria | 3952 |
| 370 | Ga0496109_0015434 | 3300048912 | Bacteria | 6658 |
| 371 | Ga0496109_0024976 | 3300048912 | Bacteria | 5319 |
| 372 | Ga0496109_0054603 | 3300048912 | Bacteria | 3644 |
| 373 | Ga0496109_0104549 | 3300048912 | Bacteria | 2629 |
| 374 | Ga0496110_0021477 | 3300048913 | Bacteria | 5466 |
| 375 | Ga0496110_0027530 | 3300048913 | Bacteria | 4874 |
| 376 | Ga0496110_0096551 | 3300048913 | Bacteria | 2648 |
| 377 | Ga0496110_0132514 | 3300048913 | Bacteria | 2251 |
| 378 | Ga0496111_0007944 | 3300048914 | Bacteria | 6994 |
| 379 | Ga0496111_0011183 | 3300048914 | Bacteria | 6040 |
| 380 | Ga0496111_0039778 | 3300048914 | Bacteria | 3373 |
| 381 | Ga0496111_0043855 | 3300048914 | Bacteria | 3216 |
| 382 | Ga0496112_0004272 | 3300048915 | Bacteria | 12061 |
| 383 | Ga0496112_0034643 | 3300048915 | Bacteria | 4914 |
| 384 | Ga0496112_0053092 | 3300048915 | Bacteria | 3979 |
| 385 | Ga0496113_0029022 | 3300048916 | Bacteria | 3988 |
| 386 | Ga0496114_0000542 | 3300048917 | Bacteria | 27880 |
| 387 | Ga0496114_0026038 | 3300048917 | Bacteria | 4785 |
| 388 | Ga0496114_0057594 | 3300048917 | Bacteria | 3244 |
| 389 | Ga0496116_0000152 | 3300048919 | Bacteria | 141311 |
| 390 | Ga0496117_0000059 | 3300048920 | Bacteria | 260163 |
| 391 | Ga0496118_0000061 | 3300048921 | Bacteria | 220889 |
| 392 | Ga0496119_0001310 | 3300048922 | Bacteria | 30642 |
| 393 | Ga0496120_0005452 | 3300048923 | Bacteria | 10146 |
| 394 | Ga0496121_0010190 | 3300048924 | Bacteria | 10643 |
| 395 | Ga0496122_0012692 | 3300048925 | Bacteria | 8345 |
| 396 | Ga0496124_0007754 | 3300048927 | Bacteria | 11341 |
| 397 | Ga0496126_0000213 | 3300048929 | Bacteria | 128366 |
| 398 | Ga0501031_0046443 | 3300049568 | Bacteria | 2831 |
| 399 | Ga0501032_0034952 | 3300049569 | Bacteria | 3437 |
| 400 | Ga0501032_0045904 | 3300049569 | Bacteria | 2953 |
| 401 | Ga0501033_0000152 | 3300049570 | Bacteria | 66824 |
| 402 | Ga0501034_0000086 | 3300049571 | Bacteria | 166816 |
| 403 | Ga0501034_0000089 | 3300049571 | Bacteria | 165644 |
| 404 | Ga0501034_0000295 | 3300049571 | Bacteria | 88435 |
| 405 | Ga0501034_0016416 | 3300049571 | Bacteria | 7601 |
| 406 | Ga0501034_0029042 | 3300049571 | Bacteria | 5622 |
| 407 | Ga0501034_0067575 | 3300049571 | Bacteria | 3586 |
| 408 | Ga0501034_0085128 | 3300049571 | Bacteria | 3163 |
| 409 | Ga0501036_0005325 | 3300049572 | Bacteria | 10409 |
| 410 | Ga0501036_0013538 | 3300049572 | Bacteria | 6781 |
| 411 | Ga0501037_0017947 | 3300049573 | Bacteria | 5208 |
| 412 | Ga0501037_0039080 | 3300049573 | Bacteria | 3494 |
| 413 | Ga0501037_0039556 | 3300049573 | Bacteria | 3472 |
| 414 | Ga0501038_0002136 | 3300049574 | Bacteria | 18359 |
| 415 | Ga0501038_0005191 | 3300049574 | Bacteria | 12112 |
| 416 | Ga0501038_0018610 | 3300049574 | Bacteria | 6274 |
| 417 | Ga0501040_0002676 | 3300049576 | Bacteria | 11481 |
| 418 | Ga0501041_0005885 | 3300049577 | Bacteria | 7166 |
| 419 | Ga0501042_0000150 | 3300049578 | Bacteria | 31243 |
| 420 | Ga0501043_0001183 | 3300049579 | Bacteria | 22974 |
| 421 | Ga0501043_0034916 | 3300049579 | Bacteria | 3955 |
| 422 | Ga0501043_0040217 | 3300049579 | Bacteria | 3675 |
| 423 | Ga0501046_0008857 | 3300049580 | Bacteria | 8743 |
| 424 | Ga0501046_0015046 | 3300049580 | Bacteria | 6507 |
| 425 | Ga0501047_0000363 | 3300049581 | Bacteria | 51477 |
| 426 | Ga0501047_0000693 | 3300049581 | Bacteria | 35200 |
| 427 | Ga0501047_0005935 | 3300049581 | Bacteria | 11486 |
| 428 | Ga0501047_0013293 | 3300049581 | Bacteria | 7797 |
| 429 | Ga0501047_0071779 | 3300049581 | Bacteria | 3333 |
| 430 | Ga0501047_0073657 | 3300049581 | Bacteria | 3288 |
| 431 | Ga0501048_0000031 | 3300049582 | Bacteria | 65561 |
| 432 | Ga0501048_0000264 | 3300049582 | Bacteria | 35134 |
| 433 | Ga0501048_0007538 | 3300049582 | Bacteria | 8247 |
| 434 | Ga0501068_0015356 | 3300049584 | Bacteria | 4395 |
| 435 | Ga0501068_0046863 | 3300049584 | Bacteria | 2606 |
| 436 | Ga0501070_0002178 | 3300049586 | Bacteria | 17230 |
| 437 | Ga0501070_0015077 | 3300049586 | Bacteria | 6505 |
| 438 | Ga0501070_0016560 | 3300049586 | Bacteria | 6191 |
| 439 | Ga0501070_0063400 | 3300049586 | Bacteria | 3062 |
| 440 | Ga0501071_0001253 | 3300049587 | Bacteria | 14382 |
| 441 | Ga0501072_0001256 | 3300049588 | Bacteria | 18932 |
| 442 | Ga0501073_0021757 | 3300049589 | Bacteria | 4620 |
| 443 | Ga0501074_0000776 | 3300049590 | Bacteria | 20159 |
| 444 | Ga0501074_0005851 | 3300049590 | Bacteria | 8871 |
| 445 | Ga0501074_0007450 | 3300049590 | Bacteria | 7915 |
| 446 | Ga0501074_0008663 | 3300049590 | Bacteria | 7368 |
| 447 | Ga0501074_0011185 | 3300049590 | Bacteria | 6518 |
| 448 | Ga0501074_0031046 | 3300049590 | Bacteria | 3871 |
| 449 | Ga0501074_0042084 | 3300049590 | Bacteria | 3306 |
| 450 | Ga0501075_0000125 | 3300049591 | Bacteria | 37605 |
| 451 | Ga0501075_0000991 | 3300049591 | Bacteria | 18116 |
| 452 | Ga0501076_0008204 | 3300049592 | Bacteria | 7650 |
| 453 | Ga0501077_0000266 | 3300049593 | Bacteria | 30847 |
| 454 | Ga0501077_0003036 | 3300049593 | Bacteria | 10068 |
| 455 | Ga0501077_0056809 | 3300049593 | Bacteria | 2485 |
| 456 | Ga0501250_000409 | 3300049680 | Bacteria | 2830 |
| 457 | Ga0501257_000775 | 3300049686 | Bacteria | 6368 |
| 458 | Ga0501259_001692 | 3300049688 | Bacteria | 3665 |
| 459 | Ga0501225_0005740 | 3300049705 | Bacteria | 3635 |
| 460 | Ga0501079_0002210 | 3300049741 | Bacteria | 14033 |
| 461 | Ga0501079_0006181 | 3300049741 | Bacteria | 8983 |
| 462 | Ga0501080_0000279 | 3300049742 | Bacteria | 38549 |
| 463 | Ga0501080_0009457 | 3300049742 | Bacteria | 8891 |
| 464 | Ga0501080_0036960 | 3300049742 | Bacteria | 4559 |
| 465 | Ga0501080_0075757 | 3300049742 | Bacteria | 3129 |
| 466 | Ga0501083_0000567 | 3300049744 | Bacteria | 23671 |
| 467 | Ga0501083_0001232 | 3300049744 | Bacteria | 17344 |
| 468 | Ga0501083_0006386 | 3300049744 | Bacteria | 8356 |
| 469 | Ga0501035_0001002 | 3300049822 | Bacteria | 29849 |
| 470 | Ga0501035_0010193 | 3300049822 | Bacteria | 8723 |
| 471 | Ga0501044_0001167 | 3300049823 | Bacteria | 31129 |
| 472 | Ga0501044_0001849 | 3300049823 | Bacteria | 24605 |
| 473 | Ga0501044_0030976 | 3300049823 | Bacteria | 5633 |
| 474 | Ga0501045_0001266 | 3300049824 | Bacteria | 16757 |
| 475 | nmdc:mga03683_3152_c1 | 3300050489 | Bacteria | 5258 |
| 476 | nmdc:mga00v17_4256_c1 | 3300050491 | Bacteria | 7431 |
| 477 | nmdc:mga00v17_7225_c1 | 3300050491 | Bacteria | 5918 |
| 478 | nmdc:mga0yw44_43426_c1 | 3300050492 | Bacteria | 2684 |
| 479 | nmdc:mga06z11_19798_c1 | 3300050494 | Bacteria | 3102 |
| 480 | nmdc:mga07m45_33560_c1 | 3300050496 | Bacteria | 2851 |
| 481 | nmdc:mga06r32_14849_c1 | 3300050510 | Bacteria | 7065 |
| 482 | nmdc:mga06r32_30_c3 | 3300050510 | Bacteria | 20656 |
| 483 | nmdc:mga08y16_29492_c1 | 3300050511 | Bacteria | 5781 |
| 484 | nmdc:mga0n895_94349_c1 | 3300050512 | Bacteria | 2996 |
| 485 | nmdc:mga0rr50_5260_c1 | 3300050513 | Bacteria | 7700 |
| 486 | nmdc:mga08x19_4028_c1 | 3300050514 | Bacteria | 8735 |
| 487 | nmdc:mga0a205_18705_c1 | 3300050515 | Bacteria | 6520 |
| 488 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 489 | Ga0495612_0000008 | 3300053078 | Bacteria | 232633 |
| 490 | Ga0495612_0007728 | 3300053078 | Bacteria | 4388 |
| 491 | Ga0495595_0000025 | 3300053084 | Bacteria | 102009 |
| 492 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 493 | Ga0495619_0006421 | 3300053085 | Bacteria | 7449 |
| 494 | Ga0500568_0000094 | 3300053139 | Bacteria | 83123 |
| 495 | Ga0500616_0001253 | 3300053153 | Bacteria | 25441 |
| 496 | Ga0500616_0003786 | 3300053153 | Bacteria | 11242 |
| 497 | Ga0500622_0001148 | 3300053156 | Bacteria | 22028 |
| 498 | Ga0501084_0001887 | 3300054114 | Bacteria | 16711 |
| 499 | Ga0501084_0001893 | 3300054114 | Bacteria | 16699 |
| 500 | Ga0501082_0000017 | 3300060353 | Bacteria | 114702 |
| 501 | Ga0501082_0001736 | 3300060353 | Bacteria | 19234 |
| 502 | Ga0501082_0009158 | 3300060353 | Bacteria | 8537 |
| 503 | Ga0466962_0009560 | 3300061719 | Bacteria | 4650 |
| 504 | Ga0530510_0058305 | 3300061734 | Bacteria | 2792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005543 | Ga0070672_100099761 | Ga0070672_1000997612 | 549 |
| 2 | 3300044694 | Ga0466963_0064566 | Ga0466963_0064566_675_2417 | 550 |
| 3 | 3300035113 | Ga0373936_0009052 | Ga0373936_0009052_1965_3725 | 560 |
| 4 | 3300046463 | Ga0495653_0028498 | Ga0495653_0028498_33_1793 | 560 |
| 5 | 3300013105 | Ga0157369_10109899 | Ga0157369_101098992 | 562 |
| 6 | 3300046472 | Ga0495580_0029934 | Ga0495580_0029934_44_1975 | 600 |
| 7 | 3300049579 | Ga0501043_0040217 | Ga0501043_0040217_116_2047 | 610 |
| 8 | 3300049571 | Ga0501034_0085128 | Ga0501034_0085128_1276_3147 | 611 |
| 9 | 3300049593 | Ga0501077_0056809 | Ga0501077_0056809_532_2418 | 614 |
| 10 | 3300046516 | Ga0495628_0102684 | Ga0495628_0102684_188_2188 | 620 |
| 11 | 3300049573 | Ga0501037_0017947 | Ga0501037_0017947_267_2261 | 627 |
| 12 | 3300044842 | Ga0466957_0038576 | Ga0466957_0038576_749_2755 | 640 |
| 13 | 3300045049 | Ga0466959_0032729 | Ga0466959_0032729_296_2308 | 642 |
| 14 | 3300045836 | Ga0466958_0013332 | Ga0466958_0013332_154_2166 | 642 |
| 15 | 3300021388 | Ga0213875_10000097 | Ga0213875_1000009718 | 643 |
| 16 | 3300037853 | Ga0436364_0296067 | Ga0436364_0296067_50835_52844 | 643 |
| 17 | 3300003322 | rootL2_10043375 | rootL2_100433754 | 645 |
| 18 | iso_pu_bacteria | 2870782633 | 2870784750 | 645 |
| 19 | 3300049573 | Ga0501037_0039556 | Ga0501037_0039556_1008_3107 | 646 |
| 20 | 3300049572 | Ga0501036_0013538 | Ga0501036_0013538_4254_6353 | 647 |
| 21 | 3300005548 | Ga0070665_100007883 | Ga0070665_10000788311 | 648 |
| 22 | 3300005843 | Ga0068860_100017670 | Ga0068860_1000176703 | 648 |
| 23 | 3300025931 | Ga0207644_10002149 | Ga0207644_100021497 | 648 |
| 24 | 3300026088 | Ga0207641_10040290 | Ga0207641_100402904 | 648 |
| 25 | 3300028381 | Ga0268264_10019520 | Ga0268264_100195205 | 648 |
| 26 | 3300046472 | Ga0495580_0033376 | Ga0495580_0033376_762_2852 | 648 |
| 27 | 3300005353 | Ga0070669_100000002 | Ga0070669_100000002380 | 649 |
| 28 | 3300025923 | Ga0207681_10000107 | Ga0207681_1000010726 | 649 |
| 29 | 3300044842 | Ga0466957_0005675 | Ga0466957_0005675_3923_5998 | 649 |
| 30 | 3300061719 | Ga0466962_0009560 | Ga0466962_0009560_1981_4056 | 649 |
| 31 | 3300049571 | Ga0501034_0029042 | Ga0501034_0029042_2624_4720 | 652 |
| 32 | iso_pu_bacteria | 2915358134 | 2915361486 | 654 |
| 33 | iso_pu_bacteria | 8054472261 | 8054475005 | 654 |
| 34 | 3300005366 | Ga0070659_100052483 | Ga0070659_1000524831 | 655 |
| 35 | 3300010375 | Ga0105239_10059957 | Ga0105239_100599574 | 655 |
| 36 | 3300025919 | Ga0207657_10079239 | Ga0207657_100792392 | 655 |
| 37 | 3300025942 | Ga0207689_10030442 | Ga0207689_100304422 | 655 |
| 38 | 3300028379 | Ga0268266_10018094 | Ga0268266_100180942 | 655 |
| 39 | 3300048913 | Ga0496110_0132514 | Ga0496110_0132514_25_2031 | 655 |
| 40 | 3300048914 | Ga0496111_0043855 | Ga0496111_0043855_16_2022 | 655 |
| 41 | 3300005539 | Ga0068853_100000026 | Ga0068853_10000002627 | 656 |
| 42 | 3300025939 | Ga0207665_10044967 | Ga0207665_100449671 | 656 |
| 43 | 3300026041 | Ga0207639_10000047 | Ga0207639_1000004758 | 656 |
| 44 | 3300049571 | Ga0501034_0067575 | Ga0501034_0067575_360_2498 | 656 |
| 45 | 3300049823 | Ga0501044_0030976 | Ga0501044_0030976_888_3026 | 656 |
| 46 | 3300005548 | Ga0070665_100044790 | Ga0070665_1000447903 | 657 |
| 47 | 3300005841 | Ga0068863_100000504 | Ga0068863_10000050429 | 657 |
| 48 | 3300006852 | Ga0075433_10044981 | Ga0075433_100449812 | 657 |
| 49 | 3300006871 | Ga0075434_100012579 | Ga0075434_1000125796 | 657 |
| 50 | 3300026088 | Ga0207641_10001152 | Ga0207641_1000115213 | 657 |
| 51 | 3300031824 | Ga0307413_10002099 | Ga0307413_100020997 | 657 |
| 52 | 3300045976 | Ga0466967_0000157 | Ga0466967_0000157_17480_19492 | 657 |
| 53 | 3300049568 | Ga0501031_0046443 | Ga0501031_0046443_531_2630 | 657 |
| 54 | 3300049590 | Ga0501074_0000776 | Ga0501074_0000776_18026_20134 | 657 |
| 55 | 3300049742 | Ga0501080_0009457 | Ga0501080_0009457_3518_5626 | 657 |
| 56 | 3300050514 | nmdc:mga08x19_4028_c1 | nmdc:mga08x19_4028_c1_845_3013 | 657 |
| 57 | 3300049571 | Ga0501034_0000295 | Ga0501034_0000295_17647_19743 | 659 |
| 58 | 3300049572 | Ga0501036_0005325 | Ga0501036_0005325_7578_9674 | 659 |
| 59 | 3300049579 | Ga0501043_0001183 | Ga0501043_0001183_4337_6433 | 659 |
| 60 | 3300049581 | Ga0501047_0000363 | Ga0501047_0000363_15150_17246 | 659 |
| 61 | 3300049582 | Ga0501048_0000031 | Ga0501048_0000031_8530_10626 | 659 |
| 62 | 3300049590 | Ga0501074_0007450 | Ga0501074_0007450_352_2448 | 659 |
| 63 | 3300049742 | Ga0501080_0000279 | Ga0501080_0000279_16989_19085 | 659 |
| 64 | 3300049744 | Ga0501083_0000567 | Ga0501083_0000567_632_2728 | 659 |
| 65 | 3300049823 | Ga0501044_0001849 | Ga0501044_0001849_4885_6981 | 659 |
| 66 | 3300049574 | Ga0501038_0018610 | Ga0501038_0018610_889_2955 | 660 |
| 67 | 3300003320 | rootH2_10028067 | rootH2_100280672 | 661 |
| 68 | 3300048903 | Ga0496100_0004179 | Ga0496100_0004179_4508_6565 | 661 |
| 69 | 3300048904 | Ga0496101_0008392 | Ga0496101_0008392_1879_3936 | 661 |
| 70 | 3300048905 | Ga0496102_0000030 | Ga0496102_0000030_201987_204044 | 661 |
| 71 | 3300048906 | Ga0496103_0000068 | Ga0496103_0000068_30066_32123 | 661 |
| 72 | 3300048907 | Ga0496104_0061581 | Ga0496104_0061581_529_2586 | 661 |
| 73 | 3300048908 | Ga0496105_0053253 | Ga0496105_0053253_634_2691 | 661 |
| 74 | 3300048919 | Ga0496116_0000152 | Ga0496116_0000152_23119_25176 | 661 |
| 75 | 3300048920 | Ga0496117_0000059 | Ga0496117_0000059_240890_242947 | 661 |
| 76 | 3300048921 | Ga0496118_0000061 | Ga0496118_0000061_201605_203662 | 661 |
| 77 | 3300048922 | Ga0496119_0001310 | Ga0496119_0001310_17051_19108 | 661 |
| 78 | 3300048923 | Ga0496120_0005452 | Ga0496120_0005452_7160_9217 | 661 |
| 79 | 3300048924 | Ga0496121_0010190 | Ga0496121_0010190_8178_10235 | 661 |
| 80 | 3300048927 | Ga0496124_0007754 | Ga0496124_0007754_4410_6467 | 661 |
| 81 | 3300048929 | Ga0496126_0000213 | Ga0496126_0000213_109015_111072 | 661 |
| 82 | 3300049574 | Ga0501038_0002136 | Ga0501038_0002136_4037_6145 | 661 |
| 83 | 3300005355 | Ga0070671_100000660 | Ga0070671_1000006608 | 662 |
| 84 | 3300006914 | Ga0075436_100018464 | Ga0075436_1000184642 | 662 |
| 85 | 3300050513 | nmdc:mga0rr50_5260_c1 | nmdc:mga0rr50_5260_c1_2044_4212 | 662 |
| 86 | 3300009551 | Ga0105238_10102273 | Ga0105238_101022732 | 663 |
| 87 | 3300025937 | Ga0207669_10026237 | Ga0207669_100262372 | 663 |
| 88 | 3300045976 | Ga0466967_0000029 | Ga0466967_0000029_20540_22642 | 663 |
| 89 | 3300048912 | Ga0496109_0054603 | Ga0496109_0054603_279_2414 | 663 |
| 90 | 3300049571 | Ga0501034_0000089 | Ga0501034_0000089_23720_25813 | 663 |
| 91 | 3300049584 | Ga0501068_0015356 | Ga0501068_0015356_2078_4219 | 663 |
| 92 | 3300046462 | Ga0495651_0011480 | Ga0495651_0011480_1403_3583 | 664 |
| 93 | 3300046559 | Ga0495667_0024218 | Ga0495667_0024218_1403_3583 | 664 |
| 94 | 3300046678 | Ga0495599_0000598 | Ga0495599_0000598_2452_4632 | 664 |
| 95 | 3300049569 | Ga0501032_0034952 | Ga0501032_0034952_376_2481 | 665 |
| 96 | 3300049574 | Ga0501038_0005191 | Ga0501038_0005191_8319_10424 | 665 |
| 97 | 3300049579 | Ga0501043_0034916 | Ga0501043_0034916_246_2351 | 665 |
| 98 | 3300049581 | Ga0501047_0005935 | Ga0501047_0005935_1074_3179 | 665 |
| 99 | 3300049582 | Ga0501048_0000264 | Ga0501048_0000264_6068_8173 | 665 |
| 100 | 3300049586 | Ga0501070_0002178 | Ga0501070_0002178_4043_6148 | 665 |
| 101 | 3300013308 | Ga0157375_10043696 | Ga0157375_100436962 | 666 |
| 102 | 3300014968 | Ga0157379_10042342 | Ga0157379_100423423 | 666 |
| 103 | 3300026035 | Ga0207703_10019023 | Ga0207703_100190232 | 666 |
| 104 | 3300048911 | Ga0496108_0039146 | Ga0496108_0039146_518_2698 | 666 |
| 105 | 3300009147 | Ga0114129_10025190 | Ga0114129_100251905 | 667 |
| 106 | 3300049742 | Ga0501080_0036960 | Ga0501080_0036960_1756_3864 | 667 |
| 107 | 3300005435 | Ga0070714_100003304 | Ga0070714_1000033044 | 668 |
| 108 | 3300006028 | Ga0070717_10033968 | Ga0070717_100339682 | 668 |
| 109 | 3300025929 | Ga0207664_10001387 | Ga0207664_100013874 | 668 |
| 110 | 3300053153 | Ga0500616_0003786 | Ga0500616_0003786_8663_10777 | 668 |
| 111 | 3300006028 | Ga0070717_10000099 | Ga0070717_1000009930 | 669 |
| 112 | 3300021388 | Ga0213875_10000373 | Ga0213875_1000037324 | 669 |
| 113 | 3300037853 | Ga0436364_0894784 | Ga0436364_0894784_7531_9651 | 669 |
| 114 | 3300045976 | Ga0466967_0030746 | Ga0466967_0030746_1050_3158 | 669 |
| 115 | 3300037418 | Ga0395900_0000048 | Ga0395900_0000048_78496_80634 | 670 |
| 116 | 3300045051 | Ga0451576_0001606 | Ga0451576_0001606_9508_11568 | 670 |
| 117 | 3300048912 | Ga0496109_0024976 | Ga0496109_0024976_10_2106 | 670 |
| 118 | 3300049688 | Ga0501259_001692 | Ga0501259_001692_1158_3281 | 670 |
| 119 | 3300005983 | Ga0081540_1004824 | Ga0081540_10048244 | 671 |
| 120 | 3300009093 | Ga0105240_10160614 | Ga0105240_101606142 | 671 |
| 121 | 3300009174 | Ga0105241_10051529 | Ga0105241_100515292 | 671 |
| 122 | 3300025928 | Ga0207700_10010189 | Ga0207700_100101894 | 671 |
| 123 | 3300032005 | Ga0307411_10030611 | Ga0307411_100306112 | 671 |
| 124 | 3300044683 | Ga0466965_0003154 | Ga0466965_0003154_4202_6301 | 671 |
| 125 | 3300060353 | Ga0501082_0000017 | Ga0501082_0000017_39571_41679 | 671 |
| 126 | 3300003316 | rootH1_10001440 | rootH1_100014408 | 672 |
| 127 | 3300003320 | rootH2_10000168 | rootH2_1000016849 | 672 |
| 128 | 3300003323 | rootH1_10067383 | rootH1_100673836 | 672 |
| 129 | 3300005983 | Ga0081540_1033342 | Ga0081540_10333422 | 672 |
| 130 | 3300006844 | Ga0075428_100000603 | Ga0075428_10000060325 | 672 |
| 131 | 3300006846 | Ga0075430_100000686 | Ga0075430_1000006864 | 672 |
| 132 | 3300006847 | Ga0075431_100001757 | Ga0075431_1000017574 | 672 |
| 133 | 3300006880 | Ga0075429_100000241 | Ga0075429_10000024137 | 672 |
| 134 | 3300009147 | Ga0114129_10000417 | Ga0114129_1000041739 | 672 |
| 135 | 3300035398 | Ga0316574_0020851 | Ga0316574_0020851_1164_3257 | 672 |
| 136 | 3300047320 | Ga0495672_0021597 | Ga0495672_0021597_1064_3295 | 672 |
| 137 | 3300053139 | Ga0500568_0000094 | Ga0500568_0000094_43477_45588 | 672 |
| 138 | 3300005439 | Ga0070711_100016882 | Ga0070711_1000168822 | 673 |
| 139 | 3300006175 | Ga0070712_100006064 | Ga0070712_1000060644 | 673 |
| 140 | 3300025915 | Ga0207693_10004042 | Ga0207693_100040423 | 673 |
| 141 | 3300044673 | Ga0453683_0000072 | Ga0453683_0000072_113439_115598 | 673 |
| 142 | 3300045051 | Ga0451576_0000280 | Ga0451576_0000280_84214_86373 | 673 |
| 143 | 3300048912 | Ga0496109_0104549 | Ga0496109_0104549_13_2151 | 673 |
| 144 | 3300048917 | Ga0496114_0057594 | Ga0496114_0057594_720_2918 | 673 |
| 145 | 3300049573 | Ga0501037_0039080 | Ga0501037_0039080_1185_3293 | 673 |
| 146 | 3300049580 | Ga0501046_0015046 | Ga0501046_0015046_2399_4507 | 673 |
| 147 | 3300049586 | Ga0501070_0016560 | Ga0501070_0016560_3980_6088 | 673 |
| 148 | 3300028800 | Ga0265338_10050368 | Ga0265338_100503682 | 674 |
| 149 | 3300037068 | Ga0373925_0012778 | Ga0373925_0012778_1252_3378 | 674 |
| 150 | 3300046559 | Ga0495667_0007050 | Ga0495667_0007050_4735_6843 | 674 |
| 151 | 3300048913 | Ga0496110_0021477 | Ga0496110_0021477_1852_3990 | 674 |
| 152 | 3300048916 | Ga0496113_0029022 | Ga0496113_0029022_1088_3226 | 674 |
| 153 | 3300048917 | Ga0496114_0026038 | Ga0496114_0026038_1545_3683 | 674 |
| 154 | 3300025929 | Ga0207664_10038893 | Ga0207664_100388932 | 675 |
| 155 | 3300049569 | Ga0501032_0045904 | Ga0501032_0045904_503_2596 | 675 |
| 156 | 3300009098 | Ga0105245_10015804 | Ga0105245_100158042 | 676 |
| 157 | 3300025927 | Ga0207687_10008894 | Ga0207687_100088942 | 676 |
| 158 | 3300031911 | Ga0307412_10026904 | Ga0307412_100269042 | 676 |
| 159 | 3300031995 | Ga0307409_100013643 | Ga0307409_1000136432 | 676 |
| 160 | 3300032002 | Ga0307416_100013124 | Ga0307416_1000131244 | 676 |
| 161 | 3300032005 | Ga0307411_10008896 | Ga0307411_100088962 | 676 |
| 162 | 3300003320 | rootH2_10001891 | rootH2_10001891103 | 677 |
| 163 | 3300005937 | Ga0081455_10014546 | Ga0081455_100145462 | 677 |
| 164 | 3300021358 | Ga0213873_10000815 | Ga0213873_100008153 | 677 |
| 165 | 3300025915 | Ga0207693_10001654 | Ga0207693_100016542 | 677 |
| 166 | 3300025928 | Ga0207700_10034134 | Ga0207700_100341342 | 677 |
| 167 | 3300028800 | Ga0265338_10016700 | Ga0265338_100167002 | 677 |
| 168 | 3300031241 | Ga0265325_10004350 | Ga0265325_100043507 | 677 |
| 169 | 3300031247 | Ga0265340_10004918 | Ga0265340_100049185 | 677 |
| 170 | 3300039453 | Ga0436362_0233102 | Ga0436362_0233102_3519_5591 | 677 |
| 171 | 3300049680 | Ga0501250_000409 | Ga0501250_000409_133_2277 | 677 |
| 172 | 3300050510 | nmdc:mga06r32_14849_c1 | nmdc:mga06r32_14849_c1_798_2903 | 677 |
| 173 | 3300005518 | Ga0070699_100016948 | Ga0070699_1000169482 | 678 |
| 174 | 3300028800 | Ga0265338_10040452 | Ga0265338_100404521 | 678 |
| 175 | 3300044712 | Ga0453684_0076723 | Ga0453684_0076723_748_2865 | 678 |
| 176 | 3300049581 | Ga0501047_0000693 | Ga0501047_0000693_6951_9056 | 678 |
| 177 | 3300049822 | Ga0501035_0001002 | Ga0501035_0001002_20423_22528 | 678 |
| 178 | 3300049823 | Ga0501044_0001167 | Ga0501044_0001167_21304_23409 | 678 |
| 179 | 3300061734 | Ga0530510_0058305 | Ga0530510_0058305_702_2774 | 678 |
| 180 | 3300005335 | Ga0070666_10006642 | Ga0070666_100066423 | 679 |
| 181 | 3300005937 | Ga0081455_10045466 | Ga0081455_100454662 | 679 |
| 182 | 3300006871 | Ga0075434_100033455 | Ga0075434_1000334553 | 679 |
| 183 | 3300009094 | Ga0111539_10052977 | Ga0111539_100529772 | 679 |
| 184 | 3300044765 | Ga0466970_0001176 | Ga0466970_0001176_4847_6925 | 679 |
| 185 | 3300049577 | Ga0501041_0005885 | Ga0501041_0005885_2883_5066 | 679 |
| 186 | 3300049578 | Ga0501042_0000150 | Ga0501042_0000150_24739_26922 | 679 |
| 187 | 3300049580 | Ga0501046_0008857 | Ga0501046_0008857_1555_3738 | 679 |
| 188 | 3300049582 | Ga0501048_0007538 | Ga0501048_0007538_722_2905 | 679 |
| 189 | 3300049584 | Ga0501068_0046863 | Ga0501068_0046863_391_2574 | 679 |
| 190 | 3300049586 | Ga0501070_0063400 | Ga0501070_0063400_792_2975 | 679 |
| 191 | 3300049587 | Ga0501071_0001253 | Ga0501071_0001253_9830_12013 | 679 |
| 192 | 3300049588 | Ga0501072_0001256 | Ga0501072_0001256_9158_11341 | 679 |
| 193 | 3300049590 | Ga0501074_0042084 | Ga0501074_0042084_821_3004 | 679 |
| 194 | 3300049591 | Ga0501075_0000125 | Ga0501075_0000125_4960_7143 | 679 |
| 195 | 3300049592 | Ga0501076_0008204 | Ga0501076_0008204_5085_7268 | 679 |
| 196 | 3300049593 | Ga0501077_0000266 | Ga0501077_0000266_3950_6133 | 679 |
| 197 | 3300049741 | Ga0501079_0002210 | Ga0501079_0002210_3489_5672 | 679 |
| 198 | 3300049822 | Ga0501035_0010193 | Ga0501035_0010193_4420_6603 | 679 |
| 199 | 3300049824 | Ga0501045_0001266 | Ga0501045_0001266_3859_6042 | 679 |
| 200 | 3300050512 | nmdc:mga0n895_94349_c1 | nmdc:mga0n895_94349_c1_310_2457 | 679 |
| 201 | 3300054114 | Ga0501084_0001887 | Ga0501084_0001887_9047_11230 | 679 |
| 202 | 3300060353 | Ga0501082_0001736 | Ga0501082_0001736_5001_7184 | 679 |
| 203 | 3300005329 | Ga0070683_100089968 | Ga0070683_1000899682 | 680 |
| 204 | 3300005336 | Ga0070680_100021927 | Ga0070680_1000219274 | 680 |
| 205 | 3300005343 | Ga0070687_100017017 | Ga0070687_1000170172 | 680 |
| 206 | 3300005344 | Ga0070661_100012047 | Ga0070661_1000120473 | 680 |
| 207 | 3300005354 | Ga0070675_100012148 | Ga0070675_1000121483 | 680 |
| 208 | 3300005366 | Ga0070659_100060722 | Ga0070659_1000607222 | 680 |
| 209 | 3300005466 | Ga0070685_10020317 | Ga0070685_100203172 | 680 |
| 210 | 3300005518 | Ga0070699_100001172 | Ga0070699_10000117211 | 680 |
| 211 | 3300005545 | Ga0070695_100049771 | Ga0070695_1000497712 | 680 |
| 212 | 3300005547 | Ga0070693_100039018 | Ga0070693_1000390182 | 680 |
| 213 | 3300005841 | Ga0068863_100111888 | Ga0068863_1001118882 | 680 |
| 214 | 3300005983 | Ga0081540_1000255 | Ga0081540_100025551 | 680 |
| 215 | 3300006237 | Ga0097621_100009390 | Ga0097621_1000093903 | 680 |
| 216 | 3300013306 | Ga0163162_10006390 | Ga0163162_1000639010 | 680 |
| 217 | 3300013308 | Ga0157375_10001683 | Ga0157375_100016838 | 680 |
| 218 | 3300021388 | Ga0213875_10000774 | Ga0213875_100007749 | 680 |
| 219 | 3300025885 | Ga0207653_10005025 | Ga0207653_100050252 | 680 |
| 220 | 3300025899 | Ga0207642_10022670 | Ga0207642_100226701 | 680 |
| 221 | 3300025901 | Ga0207688_10005543 | Ga0207688_100055433 | 680 |
| 222 | 3300025908 | Ga0207643_10009321 | Ga0207643_100093213 | 680 |
| 223 | 3300025918 | Ga0207662_10005433 | Ga0207662_100054332 | 680 |
| 224 | 3300025919 | Ga0207657_10026592 | Ga0207657_100265922 | 680 |
| 225 | 3300025921 | Ga0207652_10013880 | Ga0207652_100138803 | 680 |
| 226 | 3300025922 | Ga0207646_10005559 | Ga0207646_100055593 | 680 |
| 227 | 3300025925 | Ga0207650_10013391 | Ga0207650_100133912 | 680 |
| 228 | 3300025940 | Ga0207691_10031885 | Ga0207691_100318853 | 680 |
| 229 | 3300025942 | Ga0207689_10002061 | Ga0207689_1000206111 | 680 |
| 230 | 3300025961 | Ga0207712_10032800 | Ga0207712_100328002 | 680 |
| 231 | 3300026078 | Ga0207702_10030312 | Ga0207702_100303122 | 680 |
| 232 | 3300026121 | Ga0207683_10000774 | Ga0207683_100007749 | 680 |
| 233 | 3300035083 | Ga0373926_0005823 | Ga0373926_0005823_1401_3527 | 680 |
| 234 | 3300035089 | Ga0373944_0000943 | Ga0373944_0000943_2764_4890 | 680 |
| 235 | 3300035111 | Ga0373923_0011221 | Ga0373923_0011221_353_2479 | 680 |
| 236 | 3300035113 | Ga0373936_0002658 | Ga0373936_0002658_4261_6387 | 680 |
| 237 | 3300035116 | Ga0373945_0006198 | Ga0373945_0006198_1568_3694 | 680 |
| 238 | 3300035119 | Ga0373956_0009588 | Ga0373956_0009588_401_2527 | 680 |
| 239 | 3300035120 | Ga0373957_0000317 | Ga0373957_0000317_674_2800 | 680 |
| 240 | 3300035171 | Ga0373946_0007155 | Ga0373946_0007155_1800_3926 | 680 |
| 241 | 3300035410 | Ga0373924_0002867 | Ga0373924_0002867_674_2800 | 680 |
| 242 | 3300035695 | Ga0373927_0009188 | Ga0373927_0009188_2481_4607 | 680 |
| 243 | 3300037068 | Ga0373925_0024957 | Ga0373925_0024957_1678_3804 | 680 |
| 244 | 3300037853 | Ga0436364_0176464 | Ga0436364_0176464_3490_5616 | 680 |
| 245 | 3300044712 | Ga0453684_0019163 | Ga0453684_0019163_6937_9069 | 680 |
| 246 | 3300046455 | Ga0495603_0011459 | Ga0495603_0011459_2291_4417 | 680 |
| 247 | 3300046461 | Ga0495641_0011508 | Ga0495641_0011508_2074_4200 | 680 |
| 248 | 3300046463 | Ga0495653_0012548 | Ga0495653_0012548_1009_3135 | 680 |
| 249 | 3300046473 | Ga0495582_0000396 | Ga0495582_0000396_11110_13236 | 680 |
| 250 | 3300046475 | Ga0495639_0002474 | Ga0495639_0002474_452_2578 | 680 |
| 251 | 3300046501 | Ga0495607_0028760 | Ga0495607_0028760_675_2786 | 680 |
| 252 | 3300046511 | Ga0495608_0073318 | Ga0495608_0073318_70_2196 | 680 |
| 253 | 3300046516 | Ga0495628_0015961 | Ga0495628_0015961_70_2196 | 680 |
| 254 | 3300046517 | Ga0495630_0008948 | Ga0495630_0008948_4500_6626 | 680 |
| 255 | 3300046522 | Ga0495643_0005631 | Ga0495643_0005631_1939_4050 | 680 |
| 256 | 3300046526 | Ga0495666_0004839 | Ga0495666_0004839_4198_6324 | 680 |
| 257 | 3300046531 | Ga0495665_0011683 | Ga0495665_0011683_150_2276 | 680 |
| 258 | 3300046533 | Ga0495640_0025685 | Ga0495640_0025685_191_2317 | 680 |
| 259 | 3300046535 | Ga0495586_0016961 | Ga0495586_0016961_842_2968 | 680 |
| 260 | 3300046536 | Ga0495587_0052561 | Ga0495587_0052561_208_2334 | 680 |
| 261 | 3300046543 | Ga0495645_0034819 | Ga0495645_0034819_1240_3366 | 680 |
| 262 | 3300046674 | Ga0495588_0009401 | Ga0495588_0009401_2025_4151 | 680 |
| 263 | 3300046690 | Ga0495624_0005701 | Ga0495624_0005701_4780_6906 | 680 |
| 264 | 3300047315 | Ga0495581_0000829 | Ga0495581_0000829_2164_4290 | 680 |
| 265 | 3300047317 | Ga0495604_0008302 | Ga0495604_0008302_3794_5920 | 680 |
| 266 | 3300047319 | Ga0495674_0078782 | Ga0495674_0078782_520_2646 | 680 |
| 267 | 3300047321 | Ga0495676_0019846 | Ga0495676_0019846_1541_3667 | 680 |
| 268 | 3300047471 | Ga0495684_0038353 | Ga0495684_0038353_965_3091 | 680 |
| 269 | 3300048088 | Ga0495602_0068704 | Ga0495602_0068704_836_2962 | 680 |
| 270 | 3300048906 | Ga0496103_0019527 | Ga0496103_0019527_1370_3496 | 680 |
| 271 | 3300048908 | Ga0496105_0007585 | Ga0496105_0007585_738_2864 | 680 |
| 272 | 3300048914 | Ga0496111_0007944 | Ga0496111_0007944_691_2817 | 680 |
| 273 | 3300049571 | Ga0501034_0016416 | Ga0501034_0016416_3434_5551 | 680 |
| 274 | 3300053078 | Ga0495612_0007728 | Ga0495612_0007728_312_2438 | 680 |
| 275 | 3300053085 | Ga0495619_0006421 | Ga0495619_0006421_4332_6458 | 680 |
| 276 | 3300025940 | Ga0207691_10090881 | Ga0207691_100908812 | 681 |
| 277 | 3300030522 | Ga0307512_10010890 | Ga0307512_100108907 | 681 |
| 278 | 3300035083 | Ga0373926_0003540 | Ga0373926_0003540_2019_4151 | 681 |
| 279 | 3300035086 | Ga0373934_0003415 | Ga0373934_0003415_2488_4644 | 681 |
| 280 | 3300035116 | Ga0373945_0000377 | Ga0373945_0000377_7369_9501 | 681 |
| 281 | 3300035119 | Ga0373956_0004461 | Ga0373956_0004461_1929_4085 | 681 |
| 282 | 3300035170 | Ga0373943_0000181 | Ga0373943_0000181_12555_14687 | 681 |
| 283 | 3300035692 | Ga0373935_0000806 | Ga0373935_0000806_3099_5231 | 681 |
| 284 | 3300035695 | Ga0373927_0001841 | Ga0373927_0001841_3000_5132 | 681 |
| 285 | 3300035725 | Ga0373947_0006365 | Ga0373947_0006365_919_3051 | 681 |
| 286 | 3300044712 | Ga0453684_0133902 | Ga0453684_0133902_542_2701 | 681 |
| 287 | 3300045051 | Ga0451576_0017044 | Ga0451576_0017044_2155_4314 | 681 |
| 288 | 3300046463 | Ga0495653_0001121 | Ga0495653_0001121_7804_9936 | 681 |
| 289 | 3300046477 | Ga0495664_0001297 | Ga0495664_0001297_1644_3776 | 681 |
| 290 | 3300046517 | Ga0495630_0003036 | Ga0495630_0003036_3241_5373 | 681 |
| 291 | 3300046559 | Ga0495667_0005691 | Ga0495667_0005691_2960_5092 | 681 |
| 292 | 3300046559 | Ga0495667_0027860 | Ga0495667_0027860_1319_3475 | 681 |
| 293 | 3300046663 | Ga0495635_0001577 | Ga0495635_0001577_10296_12428 | 681 |
| 294 | 3300046690 | Ga0495624_0003291 | Ga0495624_0003291_6316_8448 | 681 |
| 295 | 3300047317 | Ga0495604_0020817 | Ga0495604_0020817_502_2619 | 681 |
| 296 | 3300047319 | Ga0495674_0000327 | Ga0495674_0000327_15135_17267 | 681 |
| 297 | 3300047321 | Ga0495676_0001524 | Ga0495676_0001524_2940_5072 | 681 |
| 298 | 3300047322 | Ga0495680_0004908 | Ga0495680_0004908_2872_5004 | 681 |
| 299 | 3300049586 | Ga0501070_0015077 | Ga0501070_0015077_3353_5446 | 681 |
| 300 | 3300049590 | Ga0501074_0008663 | Ga0501074_0008663_1537_3630 | 681 |
| 301 | 3300049741 | Ga0501079_0006181 | Ga0501079_0006181_4256_6349 | 681 |
| 302 | 3300005290 | Ga0065712_10079582 | Ga0065712_100795822 | 682 |
| 303 | 3300005445 | Ga0070708_100004573 | Ga0070708_1000045731 | 682 |
| 304 | 3300025915 | Ga0207693_10046833 | Ga0207693_100468333 | 682 |
| 305 | 3300046511 | Ga0495608_0029985 | Ga0495608_0029985_573_2690 | 682 |
| 306 | 3300046536 | Ga0495587_0022976 | Ga0495587_0022976_1029_3146 | 682 |
| 307 | 3300046559 | Ga0495667_0028835 | Ga0495667_0028835_366_2483 | 682 |
| 308 | 3300046679 | Ga0495623_0011872 | Ga0495623_0011872_225_2342 | 682 |
| 309 | 3300048088 | Ga0495602_0026435 | Ga0495602_0026435_963_3080 | 682 |
| 310 | 3300049576 | Ga0501040_0002676 | Ga0501040_0002676_8156_10288 | 682 |
| 311 | 3300049581 | Ga0501047_0073657 | Ga0501047_0073657_1138_3234 | 682 |
| 312 | 3300049589 | Ga0501073_0021757 | Ga0501073_0021757_2039_4222 | 682 |
| 313 | 3300049590 | Ga0501074_0005851 | Ga0501074_0005851_1407_3503 | 682 |
| 314 | 3300049590 | Ga0501074_0011185 | Ga0501074_0011185_1727_3859 | 682 |
| 315 | 3300054114 | Ga0501084_0001893 | Ga0501084_0001893_12814_14946 | 682 |
| 316 | 3300060353 | Ga0501082_0009158 | Ga0501082_0009158_5722_7854 | 682 |
| 317 | 3300005331 | Ga0070670_100005087 | Ga0070670_1000050877 | 683 |
| 318 | 3300007265 | Ga0099794_10012756 | Ga0099794_100127564 | 683 |
| 319 | 3300026118 | Ga0207675_100017666 | Ga0207675_1000176661 | 683 |
| 320 | 3300003322 | rootL2_10010183 | rootL2_100101833 | 684 |
| 321 | 3300048912 | Ga0496109_0015434 | Ga0496109_0015434_4004_6109 | 684 |
| 322 | 3300049570 | Ga0501033_0000152 | Ga0501033_0000152_48252_50360 | 684 |
| 323 | 3300049581 | Ga0501047_0071779 | Ga0501047_0071779_355_2463 | 684 |
| 324 | 3300005329 | Ga0070683_100002617 | Ga0070683_1000026178 | 685 |
| 325 | 3300006237 | Ga0097621_100001393 | Ga0097621_10000139310 | 685 |
| 326 | 3300006914 | Ga0075436_100058086 | Ga0075436_1000580861 | 685 |
| 327 | 3300009094 | Ga0111539_10019873 | Ga0111539_100198735 | 685 |
| 328 | 3300009098 | Ga0105245_10015648 | Ga0105245_100156482 | 685 |
| 329 | 3300013297 | Ga0157378_10000813 | Ga0157378_1000081329 | 685 |
| 330 | 3300026035 | Ga0207703_10025892 | Ga0207703_100258922 | 685 |
| 331 | 3300031995 | Ga0307409_100074140 | Ga0307409_1000741402 | 685 |
| 332 | 3300032002 | Ga0307416_100021161 | Ga0307416_1000211614 | 685 |
| 333 | 3300037466 | Ga0395898_0022774 | Ga0395898_0022774_1624_3738 | 685 |
| 334 | 3300038443 | Ga0395901_0025061 | Ga0395901_0025061_1642_3756 | 685 |
| 335 | 3300049686 | Ga0501257_000775 | Ga0501257_000775_1342_3483 | 685 |
| 336 | 3300049705 | Ga0501225_0005740 | Ga0501225_0005740_604_2745 | 685 |
| 337 | 3300050511 | nmdc:mga08y16_29492_c1 | nmdc:mga08y16_29492_c1_2590_4686 | 685 |
| 338 | 3300005331 | Ga0070670_100014124 | Ga0070670_1000141242 | 686 |
| 339 | 3300005344 | Ga0070661_100004126 | Ga0070661_1000041264 | 686 |
| 340 | 3300005356 | Ga0070674_100034906 | Ga0070674_1000349062 | 686 |
| 341 | 3300009147 | Ga0114129_10021814 | Ga0114129_100218143 | 686 |
| 342 | 3300014325 | Ga0163163_10003462 | Ga0163163_1000346211 | 686 |
| 343 | 3300025920 | Ga0207649_10012345 | Ga0207649_100123452 | 686 |
| 344 | 3300026121 | Ga0207683_10064492 | Ga0207683_100644922 | 686 |
| 345 | 3300027512 | Ga0209179_1001311 | Ga0209179_10013112 | 686 |
| 346 | 3300035086 | Ga0373934_0026920 | Ga0373934_0026920_89_2209 | 686 |
| 347 | 3300035113 | Ga0373936_0001929 | Ga0373936_0001929_57_2177 | 686 |
| 348 | 3300035119 | Ga0373956_0008925 | Ga0373956_0008925_21_2141 | 686 |
| 349 | 3300035171 | Ga0373946_0005032 | Ga0373946_0005032_2436_4556 | 686 |
| 350 | 3300035172 | Ga0373955_0001068 | Ga0373955_0001068_2080_4200 | 686 |
| 351 | 3300035692 | Ga0373935_0000009 | Ga0373935_0000009_89068_91188 | 686 |
| 352 | 3300035725 | Ga0373947_0001366 | Ga0373947_0001366_12278_14398 | 686 |
| 353 | 3300036401 | Ga0373937_0000061 | Ga0373937_0000061_54153_56273 | 686 |
| 354 | 3300037068 | Ga0373925_0001422 | Ga0373925_0001422_10744_12864 | 686 |
| 355 | 3300046454 | Ga0495592_0000022 | Ga0495592_0000022_71189_73309 | 686 |
| 356 | 3300046463 | Ga0495653_0000043 | Ga0495653_0000043_104189_106309 | 686 |
| 357 | 3300046477 | Ga0495664_0000006 | Ga0495664_0000006_306218_308338 | 686 |
| 358 | 3300046511 | Ga0495608_0000002 | Ga0495608_0000002_306166_308286 | 686 |
| 359 | 3300046514 | Ga0495618_0000001 | Ga0495618_0000001_163108_165228 | 686 |
| 360 | 3300046516 | Ga0495628_0000004 | Ga0495628_0000004_120073_122193 | 686 |
| 361 | 3300046529 | Ga0495652_0000007 | Ga0495652_0000007_109655_111775 | 686 |
| 362 | 3300046533 | Ga0495640_0000004 | Ga0495640_0000004_328283_330403 | 686 |
| 363 | 3300046536 | Ga0495587_0000002 | Ga0495587_0000002_117009_119129 | 686 |
| 364 | 3300046543 | Ga0495645_0000008 | Ga0495645_0000008_23123_25243 | 686 |
| 365 | 3300046559 | Ga0495667_0000006 | Ga0495667_0000006_116996_119116 | 686 |
| 366 | 3300046642 | Ga0495634_0000001 | Ga0495634_0000001_95095_97215 | 686 |
| 367 | 3300046663 | Ga0495635_0000004 | Ga0495635_0000004_328239_330359 | 686 |
| 368 | 3300046675 | Ga0495657_0001727 | Ga0495657_0001727_10763_12883 | 686 |
| 369 | 3300046678 | Ga0495599_0000003 | Ga0495599_0000003_10734_12854 | 686 |
| 370 | 3300046679 | Ga0495623_0000048 | Ga0495623_0000048_64913_67033 | 686 |
| 371 | 3300046680 | Ga0495646_0000001 | Ga0495646_0000001_306275_308395 | 686 |
| 372 | 3300046689 | Ga0495613_0039298 | Ga0495613_0039298_856_2976 | 686 |
| 373 | 3300046809 | Ga0495600_0000390 | Ga0495600_0000390_9824_11944 | 686 |
| 374 | 3300047317 | Ga0495604_0000003 | Ga0495604_0000003_306140_308260 | 686 |
| 375 | 3300047319 | Ga0495674_0000006 | Ga0495674_0000006_159579_161699 | 686 |
| 376 | 3300047322 | Ga0495680_0000366 | Ga0495680_0000366_23161_25281 | 686 |
| 377 | 3300047444 | Ga0495675_0000088 | Ga0495675_0000088_18201_20321 | 686 |
| 378 | 3300047471 | Ga0495684_0000003 | Ga0495684_0000003_219594_221714 | 686 |
| 379 | 3300048088 | Ga0495602_0000011 | Ga0495602_0000011_105603_107723 | 686 |
| 380 | 3300048907 | Ga0496104_0004383 | Ga0496104_0004383_9359_11491 | 686 |
| 381 | 3300048908 | Ga0496105_0062844 | Ga0496105_0062844_465_2663 | 686 |
| 382 | 3300048911 | Ga0496108_0001111 | Ga0496108_0001111_12877_15009 | 686 |
| 383 | 3300048913 | Ga0496110_0027530 | Ga0496110_0027530_744_2876 | 686 |
| 384 | 3300048914 | Ga0496111_0039778 | Ga0496111_0039778_377_2509 | 686 |
| 385 | 3300049581 | Ga0501047_0013293 | Ga0501047_0013293_4419_6587 | 686 |
| 386 | 3300049744 | Ga0501083_0001232 | Ga0501083_0001232_6183_8291 | 686 |
| 387 | 3300053077 | Ga0495601_0000004 | Ga0495601_0000004_140692_142812 | 686 |
| 388 | 3300053078 | Ga0495612_0000008 | Ga0495612_0000008_70450_72570 | 686 |
| 389 | 3300053084 | Ga0495595_0000025 | Ga0495595_0000025_31973_34093 | 686 |
| 390 | 3300053085 | Ga0495619_0000005 | Ga0495619_0000005_306281_308401 | 686 |
| 391 | 3300053153 | Ga0500616_0001253 | Ga0500616_0001253_573_2702 | 686 |
| 392 | 3300005293 | Ga0065715_10095353 | Ga0065715_100953531 | 687 |
| 393 | 3300006038 | Ga0075365_10011245 | Ga0075365_100112455 | 687 |
| 394 | 3300011119 | Ga0105246_10021813 | Ga0105246_100218132 | 687 |
| 395 | 3300025315 | Ga0207697_10024864 | Ga0207697_100248642 | 687 |
| 396 | 3300035725 | Ga0373947_0020871 | Ga0373947_0020871_1323_3455 | 687 |
| 397 | 3300036401 | Ga0373937_0016629 | Ga0373937_0016629_3460_5583 | 687 |
| 398 | 3300037068 | Ga0373925_0000407 | Ga0373925_0000407_33884_36007 | 687 |
| 399 | 3300042156 | Ga0439446_0006240 | Ga0439446_0006240_552_2675 | 687 |
| 400 | 3300047319 | Ga0495674_0084309 | Ga0495674_0084309_378_2501 | 687 |
| 401 | 3300048915 | Ga0496112_0034643 | Ga0496112_0034643_1473_3599 | 687 |
| 402 | 3300049591 | Ga0501075_0000991 | Ga0501075_0000991_5910_8018 | 687 |
| 403 | 3300049593 | Ga0501077_0003036 | Ga0501077_0003036_4191_6299 | 687 |
| 404 | 3300050492 | nmdc:mga0yw44_43426_c1 | nmdc:mga0yw44_43426_c1_205_2388 | 687 |
| 405 | iso_pu_bacteria | 2919679072 | 2919682474 | 687 |
| 406 | 3300005331 | Ga0070670_100043713 | Ga0070670_1000437132 | 688 |
| 407 | 3300005937 | Ga0081455_10001140 | Ga0081455_1000114019 | 688 |
| 408 | 3300009551 | Ga0105238_10026444 | Ga0105238_100264442 | 688 |
| 409 | 3300025924 | Ga0207694_10045445 | Ga0207694_100454452 | 688 |
| 410 | 3300025949 | Ga0207667_10011781 | Ga0207667_100117812 | 688 |
| 411 | 3300048917 | Ga0496114_0000542 | Ga0496114_0000542_15387_17501 | 688 |
| 412 | 3300050491 | nmdc:mga00v17_7225_c1 | nmdc:mga00v17_7225_c1_3410_5575 | 688 |
| 413 | 3300050515 | nmdc:mga0a205_18705_c1 | nmdc:mga0a205_18705_c1_271_2379 | 688 |
| 414 | iso_pu_bacteria | 8055172936 | 8055180353 | 688 |
| 415 | 3300005518 | Ga0070699_100004132 | Ga0070699_1000041327 | 689 |
| 416 | 3300005536 | Ga0070697_100007695 | Ga0070697_1000076951 | 689 |
| 417 | 3300006847 | Ga0075431_100004792 | Ga0075431_1000047929 | 689 |
| 418 | 3300025922 | Ga0207646_10007887 | Ga0207646_100078874 | 689 |
| 419 | 3300035086 | Ga0373934_0011375 | Ga0373934_0011375_110_2227 | 689 |
| 420 | 3300036401 | Ga0373937_0015565 | Ga0373937_0015565_272_2389 | 689 |
| 421 | 3300046462 | Ga0495651_0011722 | Ga0495651_0011722_1350_3467 | 689 |
| 422 | 3300046463 | Ga0495653_0030416 | Ga0495653_0030416_1824_3941 | 689 |
| 423 | 3300050510 | nmdc:mga06r32_30_c3 | nmdc:mga06r32_30_c3_4318_6432 | 689 |
| 424 | 3300053156 | Ga0500622_0001148 | Ga0500622_0001148_18823_20991 | 689 |
| 425 | iso_pu_bacteria | 2643221681 | 2644458118 | 689 |
| 426 | iso_pu_bacteria | 2891326441 | 2891326747 | 689 |
| 427 | 3300003203 | JGI25406J46586_10013129 | JGI25406J46586_100131293 | 690 |
| 428 | 3300005434 | Ga0070709_10001376 | Ga0070709_100013763 | 690 |
| 429 | 3300005439 | Ga0070711_100003179 | Ga0070711_1000031793 | 690 |
| 430 | 3300005467 | Ga0070706_100017990 | Ga0070706_1000179904 | 690 |
| 431 | 3300005985 | Ga0081539_10000128 | Ga0081539_10000128126 | 690 |
| 432 | 3300025898 | Ga0207692_10003323 | Ga0207692_100033234 | 690 |
| 433 | 3300025906 | Ga0207699_10001648 | Ga0207699_100016483 | 690 |
| 434 | 3300025916 | Ga0207663_10006017 | Ga0207663_100060172 | 690 |
| 435 | 3300037853 | Ga0436364_0644502 | Ga0436364_0644502_600_2726 | 690 |
| 436 | 3300042876 | Ga0451577_0000060 | Ga0451577_0000060_40921_43041 | 690 |
| 437 | 3300044712 | Ga0453684_0001498 | Ga0453684_0001498_30210_32330 | 690 |
| 438 | 3300044712 | Ga0453684_0205927 | Ga0453684_0205927_45_2159 | 690 |
| 439 | 3300044735 | Ga0466968_0001843 | Ga0466968_0001843_1941_4118 | 690 |
| 440 | 3300049571 | Ga0501034_0000086 | Ga0501034_0000086_125173_127290 | 690 |
| 441 | iso_pu_bacteria | 2984592036 | 2984592862 | 690 |
| 442 | 3300005546 | Ga0070696_100013273 | Ga0070696_1000132733 | 691 |
| 443 | 3300025905 | Ga0207685_10000884 | Ga0207685_100008842 | 691 |
| 444 | 3300025906 | Ga0207699_10002880 | Ga0207699_100028807 | 691 |
| 445 | 3300025910 | Ga0207684_10021941 | Ga0207684_100219412 | 691 |
| 446 | 3300025928 | Ga0207700_10003799 | Ga0207700_100037998 | 691 |
| 447 | 3300033179 | Ga0307507_10092331 | Ga0307507_100923311 | 691 |
| 448 | 3300047471 | Ga0495684_0002732 | Ga0495684_0002732_2996_5128 | 691 |
| 449 | 3300048915 | Ga0496112_0004272 | Ga0496112_0004272_9770_11929 | 691 |
| 450 | iso_pu_bacteria | 2643221697 | 2644537612 | 691 |
| 451 | 3300009147 | Ga0114129_10009295 | Ga0114129_100092955 | 692 |
| 452 | 3300046462 | Ga0495651_0004547 | Ga0495651_0004547_177_2297 | 692 |
| 453 | 3300046559 | Ga0495667_0020485 | Ga0495667_0020485_106_2226 | 692 |
| 454 | 3300046679 | Ga0495623_0032583 | Ga0495623_0032583_568_2688 | 692 |
| 455 | 3300048925 | Ga0496122_0012692 | Ga0496122_0012692_2047_4170 | 693 |
| 456 | 3300006042 | Ga0075368_10005451 | Ga0075368_100054512 | 694 |
| 457 | 3300006051 | Ga0075364_10000451 | Ga0075364_100004512 | 694 |
| 458 | 3300006178 | Ga0075367_10008071 | Ga0075367_100080712 | 694 |
| 459 | 3300006353 | Ga0075370_10016045 | Ga0075370_100160452 | 694 |
| 460 | 3300026121 | Ga0207683_10032657 | Ga0207683_100326573 | 694 |
| 461 | 3300050489 | nmdc:mga03683_3152_c1 | nmdc:mga03683_3152_c1_409_2553 | 694 |
| 462 | 3300050491 | nmdc:mga00v17_4256_c1 | nmdc:mga00v17_4256_c1_5152_7305 | 694 |
| 463 | 3300050494 | nmdc:mga06z11_19798_c1 | nmdc:mga06z11_19798_c1_831_2975 | 694 |
| 464 | 3300050496 | nmdc:mga07m45_33560_c1 | nmdc:mga07m45_33560_c1_112_2256 | 694 |
| 465 | 3300013297 | Ga0157378_10021973 | Ga0157378_100219733 | 698 |
| 466 | 3300005518 | Ga0070699_100067345 | Ga0070699_1000673452 | 699 |
| 467 | 3300025910 | Ga0207684_10011356 | Ga0207684_100113562 | 699 |
| 468 | 3300039437 | Ga0436365_1791131 | Ga0436365_1791131_928_3144 | 699 |
| 469 | 3300005434 | Ga0070709_10003161 | Ga0070709_100031613 | 700 |
| 470 | 3300005435 | Ga0070714_100022101 | Ga0070714_1000221012 | 700 |
| 471 | 3300005436 | Ga0070713_100001778 | Ga0070713_1000017783 | 700 |
| 472 | 3300005439 | Ga0070711_100001350 | Ga0070711_1000013504 | 700 |
| 473 | 3300005468 | Ga0070707_100010437 | Ga0070707_1000104372 | 700 |
| 474 | 3300006175 | Ga0070712_100002533 | Ga0070712_1000025332 | 700 |
| 475 | 3300025915 | Ga0207693_10000559 | Ga0207693_1000055915 | 700 |
| 476 | 3300025922 | Ga0207646_10094806 | Ga0207646_100948062 | 700 |
| 477 | 3300021388 | Ga0213875_10000846 | Ga0213875_1000084617 | 702 |
| 478 | 3300037853 | Ga0436364_1476073 | Ga0436364_1476073_30496_32910 | 702 |
| 479 | 3300037466 | Ga0395898_0025022 | Ga0395898_0025022_1673_3799 | 703 |
| 480 | 3300005436 | Ga0070713_100000264 | Ga0070713_10000026424 | 704 |
| 481 | 3300025928 | Ga0207700_10002444 | Ga0207700_100024443 | 704 |
| 482 | 3300005458 | Ga0070681_10029040 | Ga0070681_100290403 | 705 |
| 483 | 3300005539 | Ga0068853_100007980 | Ga0068853_1000079802 | 705 |
| 484 | 3300005563 | Ga0068855_100021189 | Ga0068855_1000211892 | 705 |
| 485 | 3300005578 | Ga0068854_100000893 | Ga0068854_1000008937 | 705 |
| 486 | 3300005614 | Ga0068856_100004316 | Ga0068856_1000043166 | 705 |
| 487 | 3300005834 | Ga0068851_10005240 | Ga0068851_100052402 | 705 |
| 488 | 3300010375 | Ga0105239_10026105 | Ga0105239_100261053 | 705 |
| 489 | 3300013296 | Ga0157374_10032453 | Ga0157374_100324532 | 705 |
| 490 | 3300025911 | Ga0207654_10014207 | Ga0207654_100142072 | 705 |
| 491 | 3300025919 | Ga0207657_10004945 | Ga0207657_1000494510 | 705 |
| 492 | 3300025932 | Ga0207690_10039790 | Ga0207690_100397902 | 705 |
| 493 | 3300025945 | Ga0207679_10044502 | Ga0207679_100445022 | 705 |
| 494 | 3300026041 | Ga0207639_10015385 | Ga0207639_100153853 | 705 |
| 495 | 3300026078 | Ga0207702_10063441 | Ga0207702_100634411 | 705 |
| 496 | 3300048905 | Ga0496102_0014672 | Ga0496102_0014672_3162_5306 | 705 |
| 497 | 3300048909 | Ga0496106_0053323 | Ga0496106_0053323_495_2639 | 705 |
| 498 | 3300048911 | Ga0496108_0007888 | Ga0496108_0007888_3363_5507 | 705 |
| 499 | 3300048913 | Ga0496110_0096551 | Ga0496110_0096551_395_2539 | 705 |
| 500 | 3300048914 | Ga0496111_0011183 | Ga0496111_0011183_1561_3705 | 705 |
| 501 | 3300048915 | Ga0496112_0053092 | Ga0496112_0053092_959_3103 | 705 |
| 502 | 3300005435 | Ga0070714_100003805 | Ga0070714_1000038054 | 706 |
| 503 | 3300005439 | Ga0070711_100024118 | Ga0070711_1000241182 | 706 |
| 504 | 3300025915 | Ga0207693_10009175 | Ga0207693_100091752 | 706 |
| 505 | 3300025945 | Ga0207679_10055338 | Ga0207679_100553382 | 706 |
| 506 | 3300026078 | Ga0207702_10029993 | Ga0207702_100299933 | 706 |
| 507 | 3300005295 | Ga0065707_10083283 | Ga0065707_100832833 | 708 |
| 508 | 3300035089 | Ga0373944_0001042 | Ga0373944_0001042_480_2624 | 708 |
| 509 | 3300037068 | Ga0373925_0006054 | Ga0373925_0006054_539_2683 | 708 |
| 510 | 3300049744 | Ga0501083_0006386 | Ga0501083_0006386_5779_7923 | 709 |
| 511 | 3300049590 | Ga0501074_0031046 | Ga0501074_0031046_753_2972 | 710 |
| 512 | 3300049742 | Ga0501080_0075757 | Ga0501080_0075757_624_2843 | 710 |
| 513 | 3300003187 | JGI25151J46595_10015433 | JGI25151J46595_100154332 | 714 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7u3b-assembly4.cif.gz_G | structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) | 0.9782 | 11 | 708 |
| 7u3a-assembly1.cif.gz_A | structure of the streptomyces venezuelae glgx-c-di-gmp complex | 0.9776 | 10 | 708 |
| 7u3b-assembly4.cif.gz_G | structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) | 0.9768 | 11 | 708 |
| 7u3a-assembly2.cif.gz_D | structure of the streptomyces venezuelae glgx-c-di-gmp complex | 0.9767 | 11 | 708 |
| 7eav-assembly1.cif.gz_A | the x-ray crystallographic structure of glycogen debranching enzyme from sulfolobus solfataricus stb09 | 0.9762 | 11 | 710 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vuyA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9847 | 152 | 587 | 3.20.20.80 |
| af_P9WQ25_15_155_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.9762 | 11 | 150 | 2.60.40.10 |
| 2wskA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9705 | 153 | 591 | 3.20.20.80 |
| 2vuyA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9628 | 152 | 587 | 3.20.20.80 |
| 2wskA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9618 | 153 | 591 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6A6K3-F1-model_v4 | Glycogen debranching enzyme | 1.002 | 259 | 362 |
GO:0005975
|
| AF-A0A060BX92-F1-model_v4 | CAZy families CBM48|GH13 protein | 1.001 | 411 | 546 |
|
| AF-A0A7K2FPN3-F1-model_v4 | Glycogen debranching enzyme | 0.9991 | 435 | 551 |
|
| AF-A0A3R9V3A0-F1-model_v4 | deleted | 0.9991 | 422 | 547 |
|
| AF-A0A350T3I0-F1-model_v4 | Glycogen debranching enzyme GlgX | 0.9981 | 6 | 548 |
GO:0004133
GO:0004553 GO:0005980 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar