F457575

General Info

Members Datasets Scaffolds Average Seq Length
513 296 504 697

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000846|Ga0213875_1000084617
Length 789
Sequence MPLPIAAVGAERLGLAGAAGGALDRAGAADGPAHVVRVMNFPGKDGVIGAGTGTHDGGTGSDGNEEVLPDSGVWPGDSYPLGATYDGAGTNFALFSEAAEQVELCLFGDDGTESRVSLREVDGFVWHVYLPGVRPGQRYGYRVHGPYQPAAGQRCNPAKLLLDPYAKAIEGSVDWNPAVFSYPFGDPDGRNDSDSAPYVPRCVVVNPYFDWNRDRPLRRQYHETVIYEAHVRGLTKLHPVIPDEQRGTYLGLAHPAVISHLLRLGVTAIELMPVHQFVTDAVLAERGLTNYWGYNTIGFFAPHNAYAATGARGEQVQEFKTMVRTIHEAGIEVILDVVYNHTAEGNHLGPTLSFRGIDNAAYYRLTEHDRRYYLDTTGTGNSLLVRHPHVLQMIMDSLRYWVLEMHVDGFRFDLAAALARQFHDVDRLSAFFDLVQQDPVVSQVKLIAEPWDVGDGGYQVGKFPPLWTEWNGKYRDTIRDFWRGQPATLPGFASRFTGSSDLYQQDSRRPVASVNFVTCHDGFTLADLVSYNHKHNEANGEDNRDGXXXNRSWNCGHEGPADDPAVLALRARQKRNFLATLLLSQGIPMLLSGDEIGRTQRGNNNAYCQDSEISWLDWTVHPGEDEALLDYVRYLIRLRAAHPVFRRRRFFRGATVRNGRQRVGDIAWFTPHGKVMGRRDWGVGFAKSLTVFLNGRAISEPDRRGERMQDNSFLLLFNASEKDLEFVIPARRYGERWTPLLNTASTKWAGPGIPAWEVPAWQGMDTLVPVKPGDPVPVMNRSIQLFSRP

Samples

Sample ID Description Type Environment
1 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
2 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
3 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
4 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
5 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
6 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
7 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
264 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
265 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
266 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
296 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 6.63
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10015433 3300003187 Bacteria 3366
2 JGI25406J46586_10013129 3300003203 Bacteria 3571
3 rootH1_10001440 3300003316 Bacteria 15260
4 rootH2_10000168 3300003320 Bacteria 68699
5 rootH2_10001891 3300003320 Bacteria 464318
6 rootH2_10028067 3300003320 Bacteria 17761
7 rootL2_10010183 3300003322 Bacteria 3714
8 rootL2_10043375 3300003322 Bacteria 8981
9 rootH1_10067383 3300003323 Bacteria 16790
10 Ga0065712_10079582 3300005290 Bacteria 3201
11 Ga0065715_10095353 3300005293 Bacteria 4104
12 Ga0065707_10083283 3300005295 Bacteria 9683
13 Ga0070683_100002617 3300005329 Bacteria 14399
14 Ga0070683_100089968 3300005329 Bacteria 2881
15 Ga0070670_100005087 3300005331 Bacteria 11067
16 Ga0070670_100014124 3300005331 Bacteria 6850
17 Ga0070670_100043713 3300005331 Bacteria 3851
18 Ga0070666_10006642 3300005335 Bacteria 7112
19 Ga0070680_100021927 3300005336 Bacteria 5079
20 Ga0070687_100017017 3300005343 Bacteria 3333
21 Ga0070661_100004126 3300005344 Bacteria 10015
22 Ga0070661_100012047 3300005344 Bacteria 6043
23 Ga0070669_100000002 3300005353 Bacteria 506497
24 Ga0070675_100012148 3300005354 Bacteria 6752
25 Ga0070671_100000660 3300005355 Bacteria 24797
26 Ga0070674_100034906 3300005356 Bacteria 3363
27 Ga0070659_100052483 3300005366 Bacteria 3207
28 Ga0070659_100060722 3300005366 Bacteria 2986
29 Ga0070709_10001376 3300005434 Bacteria 13243
30 Ga0070709_10003161 3300005434 Bacteria 8834
31 Ga0070714_100003304 3300005435 Bacteria 12024
32 Ga0070714_100003805 3300005435 Bacteria 11335
33 Ga0070714_100022101 3300005435 Bacteria 5212
34 Ga0070713_100000264 3300005436 Bacteria 34426
35 Ga0070713_100001778 3300005436 Bacteria 13896
36 Ga0070711_100001350 3300005439 Bacteria 13399
37 Ga0070711_100003179 3300005439 Bacteria 9528
38 Ga0070711_100016882 3300005439 Bacteria 4641
39 Ga0070711_100024118 3300005439 Bacteria 3964
40 Ga0070708_100004573 3300005445 Bacteria 10897
41 Ga0070681_10029040 3300005458 Bacteria 5553
42 Ga0070685_10020317 3300005466 Bacteria 3594
43 Ga0070706_100017990 3300005467 Bacteria 6519
44 Ga0070707_100010437 3300005468 Bacteria 8650
45 Ga0070699_100001172 3300005518 Bacteria 24336
46 Ga0070699_100004132 3300005518 Bacteria 12822
47 Ga0070699_100016948 3300005518 Bacteria 6255
48 Ga0070699_100067345 3300005518 Bacteria 3109
49 Ga0070697_100007695 3300005536 Bacteria 8390
50 Ga0068853_100000026 3300005539 Bacteria 129915
51 Ga0068853_100007980 3300005539 Bacteria 8488
52 Ga0070672_100099761 3300005543 Bacteria 2354
53 Ga0070695_100049771 3300005545 Bacteria 2683
54 Ga0070696_100013273 3300005546 Bacteria 5527
55 Ga0070693_100039018 3300005547 Bacteria 2658
56 Ga0070665_100007883 3300005548 Bacteria 10801
57 Ga0070665_100044790 3300005548 Bacteria 4442
58 Ga0068855_100021189 3300005563 Bacteria 7792
59 Ga0068854_100000893 3300005578 Bacteria 17918
60 Ga0068856_100004316 3300005614 Bacteria 14188
61 Ga0068851_10005240 3300005834 Bacteria 5884
62 Ga0068863_100000504 3300005841 Bacteria 39706
63 Ga0068863_100111888 3300005841 Bacteria 2600
64 Ga0068860_100017670 3300005843 Bacteria 6949
65 Ga0081455_10001140 3300005937 Bacteria 33253
66 Ga0081455_10014546 3300005937 Bacteria 7704
67 Ga0081455_10045466 3300005937 Bacteria 3820
68 Ga0081540_1000255 3300005983 Bacteria 56347
69 Ga0081540_1004824 3300005983 Bacteria 10157
70 Ga0081540_1033342 3300005983 Bacteria 2798
71 Ga0081539_10000128 3300005985 Bacteria 179041
72 Ga0070717_10000099 3300006028 Bacteria 66953
73 Ga0070717_10033968 3300006028 Bacteria 4119
74 Ga0075365_10011245 3300006038 Bacteria 5257
75 Ga0075368_10005451 3300006042 Bacteria 4373
76 Ga0075364_10000451 3300006051 Bacteria 20676
77 Ga0070712_100002533 3300006175 Bacteria 11285
78 Ga0070712_100006064 3300006175 Bacteria 7484
79 Ga0075367_10008071 3300006178 Bacteria 5432
80 Ga0097621_100001393 3300006237 Bacteria 16644
81 Ga0097621_100009390 3300006237 Bacteria 7098
82 Ga0075370_10016045 3300006353 Bacteria 4024
83 Ga0075428_100000603 3300006844 Bacteria 36642
84 Ga0075430_100000686 3300006846 Bacteria 25836
85 Ga0075431_100001757 3300006847 Bacteria 20399
86 Ga0075431_100004792 3300006847 Bacteria 13309
87 Ga0075433_10044981 3300006852 Bacteria 3837
88 Ga0075434_100012579 3300006871 Bacteria 8026
89 Ga0075434_100033455 3300006871 Bacteria 5073
90 Ga0075429_100000241 3300006880 Bacteria 37754
91 Ga0075436_100018464 3300006914 Bacteria 4774
92 Ga0075436_100058086 3300006914 Bacteria 2672
93 Ga0099794_10012756 3300007265 Bacteria 3638
94 Ga0105240_10160614 3300009093 Bacteria 2669
95 Ga0111539_10019873 3300009094 Bacteria 8276
96 Ga0111539_10052977 3300009094 Bacteria 4829
97 Ga0105245_10015648 3300009098 Bacteria 6616
98 Ga0105245_10015804 3300009098 Bacteria 6579
99 Ga0114129_10000417 3300009147 Bacteria 50353
100 Ga0114129_10009295 3300009147 Bacteria 14019
101 Ga0114129_10021814 3300009147 Bacteria 9090
102 Ga0114129_10025190 3300009147 Bacteria 8431
103 Ga0105241_10051529 3300009174 Bacteria 3139
104 Ga0105238_10026444 3300009551 Bacteria 5917
105 Ga0105238_10102273 3300009551 Bacteria 2847
106 Ga0105239_10026105 3300010375 Bacteria 6431
107 Ga0105239_10059957 3300010375 Bacteria 4176
108 Ga0105246_10021813 3300011119 Bacteria 4126
109 Ga0157369_10109899 3300013105 Bacteria 2931
110 Ga0157374_10032453 3300013296 Bacteria 4754
111 Ga0157378_10000813 3300013297 Bacteria 29000
112 Ga0157378_10021973 3300013297 Bacteria 5611
113 Ga0163162_10006390 3300013306 Bacteria 11409
114 Ga0157375_10001683 3300013308 Bacteria 19023
115 Ga0157375_10043696 3300013308 Bacteria 4348
116 Ga0163163_10003462 3300014325 Bacteria 13417
117 Ga0157379_10042342 3300014968 Bacteria 4065
118 Ga0213873_10000815 3300021358 Bacteria 5026
119 Ga0213875_10000097 3300021388 Bacteria 101618
120 Ga0213875_10000373 3300021388 Bacteria 41081
121 Ga0213875_10000774 3300021388 Bacteria 23879
122 Ga0213875_10000846 3300021388 Bacteria 22615
123 Ga0207697_10024864 3300025315 Bacteria 2450
124 Ga0207653_10005025 3300025885 Bacteria 4131
125 Ga0207692_10003323 3300025898 Bacteria 6269
126 Ga0207642_10022670 3300025899 Bacteria 2495
127 Ga0207688_10005543 3300025901 Bacteria 6865
128 Ga0207685_10000884 3300025905 Bacteria 5667
129 Ga0207699_10001648 3300025906 Bacteria 10581
130 Ga0207699_10002880 3300025906 Bacteria 8162
131 Ga0207643_10009321 3300025908 Bacteria 5276
132 Ga0207684_10011356 3300025910 Bacteria 7795
133 Ga0207684_10021941 3300025910 Bacteria 5452
134 Ga0207654_10014207 3300025911 Bacteria 4111
135 Ga0207693_10000559 3300025915 Bacteria 33636
136 Ga0207693_10001654 3300025915 Bacteria 19673
137 Ga0207693_10004042 3300025915 Bacteria 12467
138 Ga0207693_10009175 3300025915 Bacteria 8077
139 Ga0207693_10046833 3300025915 Bacteria 3397
140 Ga0207663_10006017 3300025916 Bacteria 6169
141 Ga0207662_10005433 3300025918 Bacteria 6797
142 Ga0207657_10004945 3300025919 Bacteria 14023
143 Ga0207657_10026592 3300025919 Bacteria 5313
144 Ga0207657_10079239 3300025919 Bacteria 2764
145 Ga0207649_10012345 3300025920 Bacteria 4737
146 Ga0207652_10013880 3300025921 Bacteria 6519
147 Ga0207646_10005559 3300025922 Bacteria 13231
148 Ga0207646_10007887 3300025922 Bacteria 10746
149 Ga0207646_10094806 3300025922 Bacteria 2673
150 Ga0207681_10000107 3300025923 Bacteria 71564
151 Ga0207694_10045445 3300025924 Bacteria 3392
152 Ga0207650_10013391 3300025925 Bacteria 5679
153 Ga0207687_10008894 3300025927 Bacteria 6564
154 Ga0207700_10002444 3300025928 Bacteria 10665
155 Ga0207700_10003799 3300025928 Bacteria 8832
156 Ga0207700_10010189 3300025928 Bacteria 5914
157 Ga0207700_10034134 3300025928 Bacteria 3649
158 Ga0207664_10001387 3300025929 Bacteria 15911
159 Ga0207664_10038893 3300025929 Bacteria 3690
160 Ga0207644_10002149 3300025931 Bacteria 12787
161 Ga0207690_10039790 3300025932 Bacteria 3069
162 Ga0207669_10026237 3300025937 Bacteria 3166
163 Ga0207665_10044967 3300025939 Bacteria 2956
164 Ga0207691_10031885 3300025940 Bacteria 4918
165 Ga0207691_10090881 3300025940 Bacteria 2736
166 Ga0207689_10002061 3300025942 Bacteria 18976
167 Ga0207689_10030442 3300025942 Bacteria 4498
168 Ga0207679_10044502 3300025945 Bacteria 3203
169 Ga0207679_10055338 3300025945 Bacteria 2924
170 Ga0207667_10011781 3300025949 Bacteria 10133
171 Ga0207712_10032800 3300025961 Bacteria 3507
172 Ga0207703_10019023 3300026035 Bacteria 5365
173 Ga0207703_10025892 3300026035 Bacteria 4616
174 Ga0207639_10000047 3300026041 Bacteria 129978
175 Ga0207639_10015385 3300026041 Bacteria 5398
176 Ga0207702_10029993 3300026078 Bacteria 4530
177 Ga0207702_10030312 3300026078 Bacteria 4507
178 Ga0207702_10063441 3300026078 Bacteria 3159
179 Ga0207641_10001152 3300026088 Bacteria 26560
180 Ga0207641_10040290 3300026088 Bacteria 3911
181 Ga0207675_100017666 3300026118 Bacteria 6654
182 Ga0207683_10000774 3300026121 Bacteria 29121
183 Ga0207683_10032657 3300026121 Bacteria 4522
184 Ga0207683_10064492 3300026121 Bacteria 3228
185 Ga0209179_1001311 3300027512 Bacteria 3000
186 Ga0268266_10018094 3300028379 Bacteria 6006
187 Ga0268264_10019520 3300028381 Bacteria 5538
188 Ga0265338_10016700 3300028800 Bacteria 7955
189 Ga0265338_10040452 3300028800 Bacteria 4378
190 Ga0265338_10050368 3300028800 Bacteria 3765
191 Ga0307512_10010890 3300030522 Bacteria 8651
192 Ga0265325_10004350 3300031241 Bacteria 8971
193 Ga0265340_10004918 3300031247 Bacteria 7430
194 Ga0307413_10002099 3300031824 Bacteria 7986
195 Ga0307412_10026904 3300031911 Bacteria 3581
196 Ga0307409_100013643 3300031995 Bacteria 5242
197 Ga0307409_100074140 3300031995 Bacteria 2718
198 Ga0307416_100013124 3300032002 Bacteria 5619
199 Ga0307416_100021161 3300032002 Bacteria 4662
200 Ga0307411_10008896 3300032005 Bacteria 5238
201 Ga0307411_10030611 3300032005 Bacteria 3301
202 Ga0307507_10092331 3300033179 Bacteria 2584
203 Ga0373926_0003540 3300035083 Bacteria 5054
204 Ga0373926_0005823 3300035083 Bacteria 4072
205 Ga0373934_0003415 3300035086 Bacteria 5823
206 Ga0373934_0011375 3300035086 Bacteria 3348
207 Ga0373934_0026920 3300035086 Bacteria 2232
208 Ga0373944_0000943 3300035089 Bacteria 7205
209 Ga0373944_0001042 3300035089 Bacteria 6858
210 Ga0373923_0011221 3300035111 Bacteria 3280
211 Ga0373936_0001929 3300035113 Bacteria 7667
212 Ga0373936_0002658 3300035113 Bacteria 6681
213 Ga0373936_0009052 3300035113 Bacteria 3756
214 Ga0373945_0000377 3300035116 Bacteria 12821
215 Ga0373945_0006198 3300035116 Bacteria 3848
216 Ga0373956_0004461 3300035119 Bacteria 5598
217 Ga0373956_0008925 3300035119 Bacteria 4063
218 Ga0373956_0009588 3300035119 Bacteria 3943
219 Ga0373957_0000317 3300035120 Bacteria 12135
220 Ga0373943_0000181 3300035170 Bacteria 25149
221 Ga0373946_0005032 3300035171 Bacteria 4760
222 Ga0373946_0007155 3300035171 Bacteria 4075
223 Ga0373955_0001068 3300035172 Bacteria 11680
224 Ga0316574_0020851 3300035398 Bacteria 3884
225 Ga0373924_0002867 3300035410 Bacteria 5845
226 Ga0373935_0000009 3300035692 Bacteria 94996
227 Ga0373935_0000806 3300035692 Bacteria 16772
228 Ga0373927_0001841 3300035695 Bacteria 15749
229 Ga0373927_0009188 3300035695 Bacteria 6633
230 Ga0373947_0001366 3300035725 Bacteria 15007
231 Ga0373947_0006365 3300035725 Bacteria 6862
232 Ga0373947_0020871 3300035725 Bacteria 3787
233 Ga0373937_0000061 3300036401 Bacteria 97707
234 Ga0373937_0015565 3300036401 Bacteria 6730
235 Ga0373937_0016629 3300036401 Bacteria 6537
236 Ga0373925_0000407 3300037068 Bacteria 43887
237 Ga0373925_0001422 3300037068 Bacteria 20777
238 Ga0373925_0006054 3300037068 Bacteria 8950
239 Ga0373925_0012778 3300037068 Bacteria 6082
240 Ga0373925_0024957 3300037068 Bacteria 4365
241 Ga0395900_0000048 3300037418 Bacteria 227760
242 Ga0395898_0022774 3300037466 Bacteria 6340
243 Ga0395898_0025022 3300037466 Bacteria 6019
244 Ga0436364_0176464 3300037853 Bacteria 17092
245 Ga0436364_0296067 3300037853 Bacteria 138817
246 Ga0436364_0644502 3300037853 Bacteria 3298
247 Ga0436364_0894784 3300037853 Bacteria 39842
248 Ga0436364_1476073 3300037853 Bacteria 87559
249 Ga0395901_0025061 3300038443 Bacteria 6123
250 Ga0436365_1791131 3300039437 Bacteria 4310
251 Ga0436362_0233102 3300039453 Bacteria 74564
252 Ga0439446_0006240 3300042156 Bacteria 3101
253 Ga0451577_0000060 3300042876 Bacteria 268725
254 Ga0453683_0000072 3300044673 Bacteria 154688
255 Ga0466965_0003154 3300044683 Bacteria 7193
256 Ga0466963_0064566 3300044694 Bacteria 2453
257 Ga0453684_0001498 3300044712 Bacteria 65796
258 Ga0453684_0019163 3300044712 Bacteria 10437
259 Ga0453684_0076723 3300044712 Bacteria 4194
260 Ga0453684_0133902 3300044712 Bacteria 2970
261 Ga0453684_0205927 3300044712 Bacteria 2290
262 Ga0466968_0001843 3300044735 Bacteria 7654
263 Ga0466970_0001176 3300044765 Bacteria 12699
264 Ga0466957_0005675 3300044842 Bacteria 7015
265 Ga0466957_0038576 3300044842 Bacteria 2878
266 Ga0466959_0032729 3300045049 Bacteria 3849
267 Ga0451576_0000280 3300045051 Bacteria 124909
268 Ga0451576_0001606 3300045051 Bacteria 37960
269 Ga0451576_0017044 3300045051 Bacteria 7996
270 Ga0466958_0013332 3300045836 Bacteria 4677
271 Ga0466967_0000029 3300045976 Bacteria 56648
272 Ga0466967_0000157 3300045976 Bacteria 27186
273 Ga0466967_0030746 3300045976 Bacteria 4509
274 Ga0495592_0000022 3300046454 Bacteria 137550
275 Ga0495603_0011459 3300046455 Bacteria 5367
276 Ga0495641_0011508 3300046461 Bacteria 5034
277 Ga0495651_0004547 3300046462 Bacteria 10603
278 Ga0495651_0011480 3300046462 Bacteria 6802
279 Ga0495651_0011722 3300046462 Bacteria 6736
280 Ga0495653_0000043 3300046463 Bacteria 115966
281 Ga0495653_0001121 3300046463 Bacteria 20617
282 Ga0495653_0012548 3300046463 Bacteria 6919
283 Ga0495653_0028498 3300046463 Bacteria 4464
284 Ga0495653_0030416 3300046463 Bacteria 4302
285 Ga0495580_0029934 3300046472 Bacteria 3947
286 Ga0495580_0033376 3300046472 Bacteria 3709
287 Ga0495582_0000396 3300046473 Bacteria 23768
288 Ga0495639_0002474 3300046475 Bacteria 8063
289 Ga0495664_0000006 3300046477 Bacteria 407031
290 Ga0495664_0001297 3300046477 Bacteria 13091
291 Ga0495607_0028760 3300046501 Bacteria 3425
292 Ga0495608_0000002 3300046511 Bacteria 376403
293 Ga0495608_0029985 3300046511 Bacteria 3685
294 Ga0495608_0073318 3300046511 Bacteria 2232
295 Ga0495618_0000001 3300046514 Bacteria 282202
296 Ga0495628_0000004 3300046516 Bacteria 462184
297 Ga0495628_0015961 3300046516 Bacteria 6266
298 Ga0495628_0102684 3300046516 Bacteria 2205
299 Ga0495630_0003036 3300046517 Bacteria 11651
300 Ga0495630_0008948 3300046517 Bacteria 7187
301 Ga0495643_0005631 3300046522 Bacteria 8402
302 Ga0495666_0004839 3300046526 Bacteria 6804
303 Ga0495652_0000007 3300046529 Bacteria 418163
304 Ga0495665_0011683 3300046531 Bacteria 4757
305 Ga0495640_0000004 3300046533 Bacteria 357515
306 Ga0495640_0025685 3300046533 Bacteria 4267
307 Ga0495586_0016961 3300046535 Bacteria 3873
308 Ga0495587_0000002 3300046536 Bacteria 425485
309 Ga0495587_0022976 3300046536 Bacteria 3835
310 Ga0495587_0052561 3300046536 Bacteria 2403
311 Ga0495645_0000008 3300046543 Bacteria 331530
312 Ga0495645_0034819 3300046543 Bacteria 3671
313 Ga0495667_0000006 3300046559 Bacteria 257523
314 Ga0495667_0005691 3300046559 Bacteria 8437
315 Ga0495667_0007050 3300046559 Bacteria 7628
316 Ga0495667_0020485 3300046559 Bacteria 4462
317 Ga0495667_0024218 3300046559 Bacteria 4088
318 Ga0495667_0027860 3300046559 Bacteria 3804
319 Ga0495667_0028835 3300046559 Bacteria 3738
320 Ga0495634_0000001 3300046642 Bacteria 303746
321 Ga0495635_0000004 3300046663 Bacteria 388068
322 Ga0495635_0001577 3300046663 Bacteria 15318
323 Ga0495588_0009401 3300046674 Bacteria 4518
324 Ga0495657_0001727 3300046675 Bacteria 18708
325 Ga0495599_0000003 3300046678 Bacteria 319085
326 Ga0495599_0000598 3300046678 Bacteria 20586
327 Ga0495623_0000048 3300046679 Bacteria 73714
328 Ga0495623_0011872 3300046679 Bacteria 5644
329 Ga0495623_0032583 3300046679 Bacteria 3349
330 Ga0495646_0000001 3300046680 Bacteria 403396
331 Ga0495613_0039298 3300046689 Bacteria 3508
332 Ga0495624_0003291 3300046690 Bacteria 12039
333 Ga0495624_0005701 3300046690 Bacteria 8933
334 Ga0495600_0000390 3300046809 Bacteria 22682
335 Ga0495581_0000829 3300047315 Bacteria 16482
336 Ga0495604_0000003 3300047317 Bacteria 464246
337 Ga0495604_0008302 3300047317 Bacteria 8213
338 Ga0495604_0020817 3300047317 Bacteria 5236
339 Ga0495674_0000006 3300047319 Bacteria 341772
340 Ga0495674_0000327 3300047319 Bacteria 41880
341 Ga0495674_0078782 3300047319 Bacteria 2830
342 Ga0495674_0084309 3300047319 Bacteria 2724
343 Ga0495672_0021597 3300047320 Bacteria 4197
344 Ga0495676_0001524 3300047321 Bacteria 20072
345 Ga0495676_0019846 3300047321 Bacteria 5906
346 Ga0495680_0000366 3300047322 Bacteria 50665
347 Ga0495680_0004908 3300047322 Bacteria 12671
348 Ga0495675_0000088 3300047444 Bacteria 65283
349 Ga0495684_0000003 3300047471 Bacteria 331335
350 Ga0495684_0002732 3300047471 Bacteria 13959
351 Ga0495684_0038353 3300047471 Bacteria 3674
352 Ga0495602_0000011 3300048088 Bacteria 212024
353 Ga0495602_0026435 3300048088 Bacteria 5597
354 Ga0495602_0068704 3300048088 Bacteria 3041
355 Ga0496100_0004179 3300048903 Bacteria 7613
356 Ga0496101_0008392 3300048904 Bacteria 6750
357 Ga0496102_0000030 3300048905 Bacteria 221326
358 Ga0496102_0014672 3300048905 Bacteria 6811
359 Ga0496103_0000068 3300048906 Bacteria 121996
360 Ga0496103_0019527 3300048906 Bacteria 4069
361 Ga0496104_0004383 3300048907 Bacteria 12294
362 Ga0496104_0061581 3300048907 Bacteria 3558
363 Ga0496105_0007585 3300048908 Bacteria 8408
364 Ga0496105_0053253 3300048908 Bacteria 3342
365 Ga0496105_0062844 3300048908 Bacteria 3064
366 Ga0496106_0053323 3300048909 Bacteria 3054
367 Ga0496108_0001111 3300048911 Bacteria 21045
368 Ga0496108_0007888 3300048911 Bacteria 8631
369 Ga0496108_0039146 3300048911 Bacteria 3952
370 Ga0496109_0015434 3300048912 Bacteria 6658
371 Ga0496109_0024976 3300048912 Bacteria 5319
372 Ga0496109_0054603 3300048912 Bacteria 3644
373 Ga0496109_0104549 3300048912 Bacteria 2629
374 Ga0496110_0021477 3300048913 Bacteria 5466
375 Ga0496110_0027530 3300048913 Bacteria 4874
376 Ga0496110_0096551 3300048913 Bacteria 2648
377 Ga0496110_0132514 3300048913 Bacteria 2251
378 Ga0496111_0007944 3300048914 Bacteria 6994
379 Ga0496111_0011183 3300048914 Bacteria 6040
380 Ga0496111_0039778 3300048914 Bacteria 3373
381 Ga0496111_0043855 3300048914 Bacteria 3216
382 Ga0496112_0004272 3300048915 Bacteria 12061
383 Ga0496112_0034643 3300048915 Bacteria 4914
384 Ga0496112_0053092 3300048915 Bacteria 3979
385 Ga0496113_0029022 3300048916 Bacteria 3988
386 Ga0496114_0000542 3300048917 Bacteria 27880
387 Ga0496114_0026038 3300048917 Bacteria 4785
388 Ga0496114_0057594 3300048917 Bacteria 3244
389 Ga0496116_0000152 3300048919 Bacteria 141311
390 Ga0496117_0000059 3300048920 Bacteria 260163
391 Ga0496118_0000061 3300048921 Bacteria 220889
392 Ga0496119_0001310 3300048922 Bacteria 30642
393 Ga0496120_0005452 3300048923 Bacteria 10146
394 Ga0496121_0010190 3300048924 Bacteria 10643
395 Ga0496122_0012692 3300048925 Bacteria 8345
396 Ga0496124_0007754 3300048927 Bacteria 11341
397 Ga0496126_0000213 3300048929 Bacteria 128366
398 Ga0501031_0046443 3300049568 Bacteria 2831
399 Ga0501032_0034952 3300049569 Bacteria 3437
400 Ga0501032_0045904 3300049569 Bacteria 2953
401 Ga0501033_0000152 3300049570 Bacteria 66824
402 Ga0501034_0000086 3300049571 Bacteria 166816
403 Ga0501034_0000089 3300049571 Bacteria 165644
404 Ga0501034_0000295 3300049571 Bacteria 88435
405 Ga0501034_0016416 3300049571 Bacteria 7601
406 Ga0501034_0029042 3300049571 Bacteria 5622
407 Ga0501034_0067575 3300049571 Bacteria 3586
408 Ga0501034_0085128 3300049571 Bacteria 3163
409 Ga0501036_0005325 3300049572 Bacteria 10409
410 Ga0501036_0013538 3300049572 Bacteria 6781
411 Ga0501037_0017947 3300049573 Bacteria 5208
412 Ga0501037_0039080 3300049573 Bacteria 3494
413 Ga0501037_0039556 3300049573 Bacteria 3472
414 Ga0501038_0002136 3300049574 Bacteria 18359
415 Ga0501038_0005191 3300049574 Bacteria 12112
416 Ga0501038_0018610 3300049574 Bacteria 6274
417 Ga0501040_0002676 3300049576 Bacteria 11481
418 Ga0501041_0005885 3300049577 Bacteria 7166
419 Ga0501042_0000150 3300049578 Bacteria 31243
420 Ga0501043_0001183 3300049579 Bacteria 22974
421 Ga0501043_0034916 3300049579 Bacteria 3955
422 Ga0501043_0040217 3300049579 Bacteria 3675
423 Ga0501046_0008857 3300049580 Bacteria 8743
424 Ga0501046_0015046 3300049580 Bacteria 6507
425 Ga0501047_0000363 3300049581 Bacteria 51477
426 Ga0501047_0000693 3300049581 Bacteria 35200
427 Ga0501047_0005935 3300049581 Bacteria 11486
428 Ga0501047_0013293 3300049581 Bacteria 7797
429 Ga0501047_0071779 3300049581 Bacteria 3333
430 Ga0501047_0073657 3300049581 Bacteria 3288
431 Ga0501048_0000031 3300049582 Bacteria 65561
432 Ga0501048_0000264 3300049582 Bacteria 35134
433 Ga0501048_0007538 3300049582 Bacteria 8247
434 Ga0501068_0015356 3300049584 Bacteria 4395
435 Ga0501068_0046863 3300049584 Bacteria 2606
436 Ga0501070_0002178 3300049586 Bacteria 17230
437 Ga0501070_0015077 3300049586 Bacteria 6505
438 Ga0501070_0016560 3300049586 Bacteria 6191
439 Ga0501070_0063400 3300049586 Bacteria 3062
440 Ga0501071_0001253 3300049587 Bacteria 14382
441 Ga0501072_0001256 3300049588 Bacteria 18932
442 Ga0501073_0021757 3300049589 Bacteria 4620
443 Ga0501074_0000776 3300049590 Bacteria 20159
444 Ga0501074_0005851 3300049590 Bacteria 8871
445 Ga0501074_0007450 3300049590 Bacteria 7915
446 Ga0501074_0008663 3300049590 Bacteria 7368
447 Ga0501074_0011185 3300049590 Bacteria 6518
448 Ga0501074_0031046 3300049590 Bacteria 3871
449 Ga0501074_0042084 3300049590 Bacteria 3306
450 Ga0501075_0000125 3300049591 Bacteria 37605
451 Ga0501075_0000991 3300049591 Bacteria 18116
452 Ga0501076_0008204 3300049592 Bacteria 7650
453 Ga0501077_0000266 3300049593 Bacteria 30847
454 Ga0501077_0003036 3300049593 Bacteria 10068
455 Ga0501077_0056809 3300049593 Bacteria 2485
456 Ga0501250_000409 3300049680 Bacteria 2830
457 Ga0501257_000775 3300049686 Bacteria 6368
458 Ga0501259_001692 3300049688 Bacteria 3665
459 Ga0501225_0005740 3300049705 Bacteria 3635
460 Ga0501079_0002210 3300049741 Bacteria 14033
461 Ga0501079_0006181 3300049741 Bacteria 8983
462 Ga0501080_0000279 3300049742 Bacteria 38549
463 Ga0501080_0009457 3300049742 Bacteria 8891
464 Ga0501080_0036960 3300049742 Bacteria 4559
465 Ga0501080_0075757 3300049742 Bacteria 3129
466 Ga0501083_0000567 3300049744 Bacteria 23671
467 Ga0501083_0001232 3300049744 Bacteria 17344
468 Ga0501083_0006386 3300049744 Bacteria 8356
469 Ga0501035_0001002 3300049822 Bacteria 29849
470 Ga0501035_0010193 3300049822 Bacteria 8723
471 Ga0501044_0001167 3300049823 Bacteria 31129
472 Ga0501044_0001849 3300049823 Bacteria 24605
473 Ga0501044_0030976 3300049823 Bacteria 5633
474 Ga0501045_0001266 3300049824 Bacteria 16757
475 nmdc:mga03683_3152_c1 3300050489 Bacteria 5258
476 nmdc:mga00v17_4256_c1 3300050491 Bacteria 7431
477 nmdc:mga00v17_7225_c1 3300050491 Bacteria 5918
478 nmdc:mga0yw44_43426_c1 3300050492 Bacteria 2684
479 nmdc:mga06z11_19798_c1 3300050494 Bacteria 3102
480 nmdc:mga07m45_33560_c1 3300050496 Bacteria 2851
481 nmdc:mga06r32_14849_c1 3300050510 Bacteria 7065
482 nmdc:mga06r32_30_c3 3300050510 Bacteria 20656
483 nmdc:mga08y16_29492_c1 3300050511 Bacteria 5781
484 nmdc:mga0n895_94349_c1 3300050512 Bacteria 2996
485 nmdc:mga0rr50_5260_c1 3300050513 Bacteria 7700
486 nmdc:mga08x19_4028_c1 3300050514 Bacteria 8735
487 nmdc:mga0a205_18705_c1 3300050515 Bacteria 6520
488 Ga0495601_0000004 3300053077 Bacteria 449178
489 Ga0495612_0000008 3300053078 Bacteria 232633
490 Ga0495612_0007728 3300053078 Bacteria 4388
491 Ga0495595_0000025 3300053084 Bacteria 102009
492 Ga0495619_0000005 3300053085 Bacteria 418061
493 Ga0495619_0006421 3300053085 Bacteria 7449
494 Ga0500568_0000094 3300053139 Bacteria 83123
495 Ga0500616_0001253 3300053153 Bacteria 25441
496 Ga0500616_0003786 3300053153 Bacteria 11242
497 Ga0500622_0001148 3300053156 Bacteria 22028
498 Ga0501084_0001887 3300054114 Bacteria 16711
499 Ga0501084_0001893 3300054114 Bacteria 16699
500 Ga0501082_0000017 3300060353 Bacteria 114702
501 Ga0501082_0001736 3300060353 Bacteria 19234
502 Ga0501082_0009158 3300060353 Bacteria 8537
503 Ga0466962_0009560 3300061719 Bacteria 4650
504 Ga0530510_0058305 3300061734 Bacteria 2792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005543 Ga0070672_100099761 Ga0070672_1000997612 549
2 3300044694 Ga0466963_0064566 Ga0466963_0064566_675_2417 550
3 3300035113 Ga0373936_0009052 Ga0373936_0009052_1965_3725 560
4 3300046463 Ga0495653_0028498 Ga0495653_0028498_33_1793 560
5 3300013105 Ga0157369_10109899 Ga0157369_101098992 562
6 3300046472 Ga0495580_0029934 Ga0495580_0029934_44_1975 600
7 3300049579 Ga0501043_0040217 Ga0501043_0040217_116_2047 610
8 3300049571 Ga0501034_0085128 Ga0501034_0085128_1276_3147 611
9 3300049593 Ga0501077_0056809 Ga0501077_0056809_532_2418 614
10 3300046516 Ga0495628_0102684 Ga0495628_0102684_188_2188 620
11 3300049573 Ga0501037_0017947 Ga0501037_0017947_267_2261 627
12 3300044842 Ga0466957_0038576 Ga0466957_0038576_749_2755 640
13 3300045049 Ga0466959_0032729 Ga0466959_0032729_296_2308 642
14 3300045836 Ga0466958_0013332 Ga0466958_0013332_154_2166 642
15 3300021388 Ga0213875_10000097 Ga0213875_1000009718 643
16 3300037853 Ga0436364_0296067 Ga0436364_0296067_50835_52844 643
17 3300003322 rootL2_10043375 rootL2_100433754 645
18 iso_pu_bacteria 2870782633 2870784750 645
19 3300049573 Ga0501037_0039556 Ga0501037_0039556_1008_3107 646
20 3300049572 Ga0501036_0013538 Ga0501036_0013538_4254_6353 647
21 3300005548 Ga0070665_100007883 Ga0070665_10000788311 648
22 3300005843 Ga0068860_100017670 Ga0068860_1000176703 648
23 3300025931 Ga0207644_10002149 Ga0207644_100021497 648
24 3300026088 Ga0207641_10040290 Ga0207641_100402904 648
25 3300028381 Ga0268264_10019520 Ga0268264_100195205 648
26 3300046472 Ga0495580_0033376 Ga0495580_0033376_762_2852 648
27 3300005353 Ga0070669_100000002 Ga0070669_100000002380 649
28 3300025923 Ga0207681_10000107 Ga0207681_1000010726 649
29 3300044842 Ga0466957_0005675 Ga0466957_0005675_3923_5998 649
30 3300061719 Ga0466962_0009560 Ga0466962_0009560_1981_4056 649
31 3300049571 Ga0501034_0029042 Ga0501034_0029042_2624_4720 652
32 iso_pu_bacteria 2915358134 2915361486 654
33 iso_pu_bacteria 8054472261 8054475005 654
34 3300005366 Ga0070659_100052483 Ga0070659_1000524831 655
35 3300010375 Ga0105239_10059957 Ga0105239_100599574 655
36 3300025919 Ga0207657_10079239 Ga0207657_100792392 655
37 3300025942 Ga0207689_10030442 Ga0207689_100304422 655
38 3300028379 Ga0268266_10018094 Ga0268266_100180942 655
39 3300048913 Ga0496110_0132514 Ga0496110_0132514_25_2031 655
40 3300048914 Ga0496111_0043855 Ga0496111_0043855_16_2022 655
41 3300005539 Ga0068853_100000026 Ga0068853_10000002627 656
42 3300025939 Ga0207665_10044967 Ga0207665_100449671 656
43 3300026041 Ga0207639_10000047 Ga0207639_1000004758 656
44 3300049571 Ga0501034_0067575 Ga0501034_0067575_360_2498 656
45 3300049823 Ga0501044_0030976 Ga0501044_0030976_888_3026 656
46 3300005548 Ga0070665_100044790 Ga0070665_1000447903 657
47 3300005841 Ga0068863_100000504 Ga0068863_10000050429 657
48 3300006852 Ga0075433_10044981 Ga0075433_100449812 657
49 3300006871 Ga0075434_100012579 Ga0075434_1000125796 657
50 3300026088 Ga0207641_10001152 Ga0207641_1000115213 657
51 3300031824 Ga0307413_10002099 Ga0307413_100020997 657
52 3300045976 Ga0466967_0000157 Ga0466967_0000157_17480_19492 657
53 3300049568 Ga0501031_0046443 Ga0501031_0046443_531_2630 657
54 3300049590 Ga0501074_0000776 Ga0501074_0000776_18026_20134 657
55 3300049742 Ga0501080_0009457 Ga0501080_0009457_3518_5626 657
56 3300050514 nmdc:mga08x19_4028_c1 nmdc:mga08x19_4028_c1_845_3013 657
57 3300049571 Ga0501034_0000295 Ga0501034_0000295_17647_19743 659
58 3300049572 Ga0501036_0005325 Ga0501036_0005325_7578_9674 659
59 3300049579 Ga0501043_0001183 Ga0501043_0001183_4337_6433 659
60 3300049581 Ga0501047_0000363 Ga0501047_0000363_15150_17246 659
61 3300049582 Ga0501048_0000031 Ga0501048_0000031_8530_10626 659
62 3300049590 Ga0501074_0007450 Ga0501074_0007450_352_2448 659
63 3300049742 Ga0501080_0000279 Ga0501080_0000279_16989_19085 659
64 3300049744 Ga0501083_0000567 Ga0501083_0000567_632_2728 659
65 3300049823 Ga0501044_0001849 Ga0501044_0001849_4885_6981 659
66 3300049574 Ga0501038_0018610 Ga0501038_0018610_889_2955 660
67 3300003320 rootH2_10028067 rootH2_100280672 661
68 3300048903 Ga0496100_0004179 Ga0496100_0004179_4508_6565 661
69 3300048904 Ga0496101_0008392 Ga0496101_0008392_1879_3936 661
70 3300048905 Ga0496102_0000030 Ga0496102_0000030_201987_204044 661
71 3300048906 Ga0496103_0000068 Ga0496103_0000068_30066_32123 661
72 3300048907 Ga0496104_0061581 Ga0496104_0061581_529_2586 661
73 3300048908 Ga0496105_0053253 Ga0496105_0053253_634_2691 661
74 3300048919 Ga0496116_0000152 Ga0496116_0000152_23119_25176 661
75 3300048920 Ga0496117_0000059 Ga0496117_0000059_240890_242947 661
76 3300048921 Ga0496118_0000061 Ga0496118_0000061_201605_203662 661
77 3300048922 Ga0496119_0001310 Ga0496119_0001310_17051_19108 661
78 3300048923 Ga0496120_0005452 Ga0496120_0005452_7160_9217 661
79 3300048924 Ga0496121_0010190 Ga0496121_0010190_8178_10235 661
80 3300048927 Ga0496124_0007754 Ga0496124_0007754_4410_6467 661
81 3300048929 Ga0496126_0000213 Ga0496126_0000213_109015_111072 661
82 3300049574 Ga0501038_0002136 Ga0501038_0002136_4037_6145 661
83 3300005355 Ga0070671_100000660 Ga0070671_1000006608 662
84 3300006914 Ga0075436_100018464 Ga0075436_1000184642 662
85 3300050513 nmdc:mga0rr50_5260_c1 nmdc:mga0rr50_5260_c1_2044_4212 662
86 3300009551 Ga0105238_10102273 Ga0105238_101022732 663
87 3300025937 Ga0207669_10026237 Ga0207669_100262372 663
88 3300045976 Ga0466967_0000029 Ga0466967_0000029_20540_22642 663
89 3300048912 Ga0496109_0054603 Ga0496109_0054603_279_2414 663
90 3300049571 Ga0501034_0000089 Ga0501034_0000089_23720_25813 663
91 3300049584 Ga0501068_0015356 Ga0501068_0015356_2078_4219 663
92 3300046462 Ga0495651_0011480 Ga0495651_0011480_1403_3583 664
93 3300046559 Ga0495667_0024218 Ga0495667_0024218_1403_3583 664
94 3300046678 Ga0495599_0000598 Ga0495599_0000598_2452_4632 664
95 3300049569 Ga0501032_0034952 Ga0501032_0034952_376_2481 665
96 3300049574 Ga0501038_0005191 Ga0501038_0005191_8319_10424 665
97 3300049579 Ga0501043_0034916 Ga0501043_0034916_246_2351 665
98 3300049581 Ga0501047_0005935 Ga0501047_0005935_1074_3179 665
99 3300049582 Ga0501048_0000264 Ga0501048_0000264_6068_8173 665
100 3300049586 Ga0501070_0002178 Ga0501070_0002178_4043_6148 665
101 3300013308 Ga0157375_10043696 Ga0157375_100436962 666
102 3300014968 Ga0157379_10042342 Ga0157379_100423423 666
103 3300026035 Ga0207703_10019023 Ga0207703_100190232 666
104 3300048911 Ga0496108_0039146 Ga0496108_0039146_518_2698 666
105 3300009147 Ga0114129_10025190 Ga0114129_100251905 667
106 3300049742 Ga0501080_0036960 Ga0501080_0036960_1756_3864 667
107 3300005435 Ga0070714_100003304 Ga0070714_1000033044 668
108 3300006028 Ga0070717_10033968 Ga0070717_100339682 668
109 3300025929 Ga0207664_10001387 Ga0207664_100013874 668
110 3300053153 Ga0500616_0003786 Ga0500616_0003786_8663_10777 668
111 3300006028 Ga0070717_10000099 Ga0070717_1000009930 669
112 3300021388 Ga0213875_10000373 Ga0213875_1000037324 669
113 3300037853 Ga0436364_0894784 Ga0436364_0894784_7531_9651 669
114 3300045976 Ga0466967_0030746 Ga0466967_0030746_1050_3158 669
115 3300037418 Ga0395900_0000048 Ga0395900_0000048_78496_80634 670
116 3300045051 Ga0451576_0001606 Ga0451576_0001606_9508_11568 670
117 3300048912 Ga0496109_0024976 Ga0496109_0024976_10_2106 670
118 3300049688 Ga0501259_001692 Ga0501259_001692_1158_3281 670
119 3300005983 Ga0081540_1004824 Ga0081540_10048244 671
120 3300009093 Ga0105240_10160614 Ga0105240_101606142 671
121 3300009174 Ga0105241_10051529 Ga0105241_100515292 671
122 3300025928 Ga0207700_10010189 Ga0207700_100101894 671
123 3300032005 Ga0307411_10030611 Ga0307411_100306112 671
124 3300044683 Ga0466965_0003154 Ga0466965_0003154_4202_6301 671
125 3300060353 Ga0501082_0000017 Ga0501082_0000017_39571_41679 671
126 3300003316 rootH1_10001440 rootH1_100014408 672
127 3300003320 rootH2_10000168 rootH2_1000016849 672
128 3300003323 rootH1_10067383 rootH1_100673836 672
129 3300005983 Ga0081540_1033342 Ga0081540_10333422 672
130 3300006844 Ga0075428_100000603 Ga0075428_10000060325 672
131 3300006846 Ga0075430_100000686 Ga0075430_1000006864 672
132 3300006847 Ga0075431_100001757 Ga0075431_1000017574 672
133 3300006880 Ga0075429_100000241 Ga0075429_10000024137 672
134 3300009147 Ga0114129_10000417 Ga0114129_1000041739 672
135 3300035398 Ga0316574_0020851 Ga0316574_0020851_1164_3257 672
136 3300047320 Ga0495672_0021597 Ga0495672_0021597_1064_3295 672
137 3300053139 Ga0500568_0000094 Ga0500568_0000094_43477_45588 672
138 3300005439 Ga0070711_100016882 Ga0070711_1000168822 673
139 3300006175 Ga0070712_100006064 Ga0070712_1000060644 673
140 3300025915 Ga0207693_10004042 Ga0207693_100040423 673
141 3300044673 Ga0453683_0000072 Ga0453683_0000072_113439_115598 673
142 3300045051 Ga0451576_0000280 Ga0451576_0000280_84214_86373 673
143 3300048912 Ga0496109_0104549 Ga0496109_0104549_13_2151 673
144 3300048917 Ga0496114_0057594 Ga0496114_0057594_720_2918 673
145 3300049573 Ga0501037_0039080 Ga0501037_0039080_1185_3293 673
146 3300049580 Ga0501046_0015046 Ga0501046_0015046_2399_4507 673
147 3300049586 Ga0501070_0016560 Ga0501070_0016560_3980_6088 673
148 3300028800 Ga0265338_10050368 Ga0265338_100503682 674
149 3300037068 Ga0373925_0012778 Ga0373925_0012778_1252_3378 674
150 3300046559 Ga0495667_0007050 Ga0495667_0007050_4735_6843 674
151 3300048913 Ga0496110_0021477 Ga0496110_0021477_1852_3990 674
152 3300048916 Ga0496113_0029022 Ga0496113_0029022_1088_3226 674
153 3300048917 Ga0496114_0026038 Ga0496114_0026038_1545_3683 674
154 3300025929 Ga0207664_10038893 Ga0207664_100388932 675
155 3300049569 Ga0501032_0045904 Ga0501032_0045904_503_2596 675
156 3300009098 Ga0105245_10015804 Ga0105245_100158042 676
157 3300025927 Ga0207687_10008894 Ga0207687_100088942 676
158 3300031911 Ga0307412_10026904 Ga0307412_100269042 676
159 3300031995 Ga0307409_100013643 Ga0307409_1000136432 676
160 3300032002 Ga0307416_100013124 Ga0307416_1000131244 676
161 3300032005 Ga0307411_10008896 Ga0307411_100088962 676
162 3300003320 rootH2_10001891 rootH2_10001891103 677
163 3300005937 Ga0081455_10014546 Ga0081455_100145462 677
164 3300021358 Ga0213873_10000815 Ga0213873_100008153 677
165 3300025915 Ga0207693_10001654 Ga0207693_100016542 677
166 3300025928 Ga0207700_10034134 Ga0207700_100341342 677
167 3300028800 Ga0265338_10016700 Ga0265338_100167002 677
168 3300031241 Ga0265325_10004350 Ga0265325_100043507 677
169 3300031247 Ga0265340_10004918 Ga0265340_100049185 677
170 3300039453 Ga0436362_0233102 Ga0436362_0233102_3519_5591 677
171 3300049680 Ga0501250_000409 Ga0501250_000409_133_2277 677
172 3300050510 nmdc:mga06r32_14849_c1 nmdc:mga06r32_14849_c1_798_2903 677
173 3300005518 Ga0070699_100016948 Ga0070699_1000169482 678
174 3300028800 Ga0265338_10040452 Ga0265338_100404521 678
175 3300044712 Ga0453684_0076723 Ga0453684_0076723_748_2865 678
176 3300049581 Ga0501047_0000693 Ga0501047_0000693_6951_9056 678
177 3300049822 Ga0501035_0001002 Ga0501035_0001002_20423_22528 678
178 3300049823 Ga0501044_0001167 Ga0501044_0001167_21304_23409 678
179 3300061734 Ga0530510_0058305 Ga0530510_0058305_702_2774 678
180 3300005335 Ga0070666_10006642 Ga0070666_100066423 679
181 3300005937 Ga0081455_10045466 Ga0081455_100454662 679
182 3300006871 Ga0075434_100033455 Ga0075434_1000334553 679
183 3300009094 Ga0111539_10052977 Ga0111539_100529772 679
184 3300044765 Ga0466970_0001176 Ga0466970_0001176_4847_6925 679
185 3300049577 Ga0501041_0005885 Ga0501041_0005885_2883_5066 679
186 3300049578 Ga0501042_0000150 Ga0501042_0000150_24739_26922 679
187 3300049580 Ga0501046_0008857 Ga0501046_0008857_1555_3738 679
188 3300049582 Ga0501048_0007538 Ga0501048_0007538_722_2905 679
189 3300049584 Ga0501068_0046863 Ga0501068_0046863_391_2574 679
190 3300049586 Ga0501070_0063400 Ga0501070_0063400_792_2975 679
191 3300049587 Ga0501071_0001253 Ga0501071_0001253_9830_12013 679
192 3300049588 Ga0501072_0001256 Ga0501072_0001256_9158_11341 679
193 3300049590 Ga0501074_0042084 Ga0501074_0042084_821_3004 679
194 3300049591 Ga0501075_0000125 Ga0501075_0000125_4960_7143 679
195 3300049592 Ga0501076_0008204 Ga0501076_0008204_5085_7268 679
196 3300049593 Ga0501077_0000266 Ga0501077_0000266_3950_6133 679
197 3300049741 Ga0501079_0002210 Ga0501079_0002210_3489_5672 679
198 3300049822 Ga0501035_0010193 Ga0501035_0010193_4420_6603 679
199 3300049824 Ga0501045_0001266 Ga0501045_0001266_3859_6042 679
200 3300050512 nmdc:mga0n895_94349_c1 nmdc:mga0n895_94349_c1_310_2457 679
201 3300054114 Ga0501084_0001887 Ga0501084_0001887_9047_11230 679
202 3300060353 Ga0501082_0001736 Ga0501082_0001736_5001_7184 679
203 3300005329 Ga0070683_100089968 Ga0070683_1000899682 680
204 3300005336 Ga0070680_100021927 Ga0070680_1000219274 680
205 3300005343 Ga0070687_100017017 Ga0070687_1000170172 680
206 3300005344 Ga0070661_100012047 Ga0070661_1000120473 680
207 3300005354 Ga0070675_100012148 Ga0070675_1000121483 680
208 3300005366 Ga0070659_100060722 Ga0070659_1000607222 680
209 3300005466 Ga0070685_10020317 Ga0070685_100203172 680
210 3300005518 Ga0070699_100001172 Ga0070699_10000117211 680
211 3300005545 Ga0070695_100049771 Ga0070695_1000497712 680
212 3300005547 Ga0070693_100039018 Ga0070693_1000390182 680
213 3300005841 Ga0068863_100111888 Ga0068863_1001118882 680
214 3300005983 Ga0081540_1000255 Ga0081540_100025551 680
215 3300006237 Ga0097621_100009390 Ga0097621_1000093903 680
216 3300013306 Ga0163162_10006390 Ga0163162_1000639010 680
217 3300013308 Ga0157375_10001683 Ga0157375_100016838 680
218 3300021388 Ga0213875_10000774 Ga0213875_100007749 680
219 3300025885 Ga0207653_10005025 Ga0207653_100050252 680
220 3300025899 Ga0207642_10022670 Ga0207642_100226701 680
221 3300025901 Ga0207688_10005543 Ga0207688_100055433 680
222 3300025908 Ga0207643_10009321 Ga0207643_100093213 680
223 3300025918 Ga0207662_10005433 Ga0207662_100054332 680
224 3300025919 Ga0207657_10026592 Ga0207657_100265922 680
225 3300025921 Ga0207652_10013880 Ga0207652_100138803 680
226 3300025922 Ga0207646_10005559 Ga0207646_100055593 680
227 3300025925 Ga0207650_10013391 Ga0207650_100133912 680
228 3300025940 Ga0207691_10031885 Ga0207691_100318853 680
229 3300025942 Ga0207689_10002061 Ga0207689_1000206111 680
230 3300025961 Ga0207712_10032800 Ga0207712_100328002 680
231 3300026078 Ga0207702_10030312 Ga0207702_100303122 680
232 3300026121 Ga0207683_10000774 Ga0207683_100007749 680
233 3300035083 Ga0373926_0005823 Ga0373926_0005823_1401_3527 680
234 3300035089 Ga0373944_0000943 Ga0373944_0000943_2764_4890 680
235 3300035111 Ga0373923_0011221 Ga0373923_0011221_353_2479 680
236 3300035113 Ga0373936_0002658 Ga0373936_0002658_4261_6387 680
237 3300035116 Ga0373945_0006198 Ga0373945_0006198_1568_3694 680
238 3300035119 Ga0373956_0009588 Ga0373956_0009588_401_2527 680
239 3300035120 Ga0373957_0000317 Ga0373957_0000317_674_2800 680
240 3300035171 Ga0373946_0007155 Ga0373946_0007155_1800_3926 680
241 3300035410 Ga0373924_0002867 Ga0373924_0002867_674_2800 680
242 3300035695 Ga0373927_0009188 Ga0373927_0009188_2481_4607 680
243 3300037068 Ga0373925_0024957 Ga0373925_0024957_1678_3804 680
244 3300037853 Ga0436364_0176464 Ga0436364_0176464_3490_5616 680
245 3300044712 Ga0453684_0019163 Ga0453684_0019163_6937_9069 680
246 3300046455 Ga0495603_0011459 Ga0495603_0011459_2291_4417 680
247 3300046461 Ga0495641_0011508 Ga0495641_0011508_2074_4200 680
248 3300046463 Ga0495653_0012548 Ga0495653_0012548_1009_3135 680
249 3300046473 Ga0495582_0000396 Ga0495582_0000396_11110_13236 680
250 3300046475 Ga0495639_0002474 Ga0495639_0002474_452_2578 680
251 3300046501 Ga0495607_0028760 Ga0495607_0028760_675_2786 680
252 3300046511 Ga0495608_0073318 Ga0495608_0073318_70_2196 680
253 3300046516 Ga0495628_0015961 Ga0495628_0015961_70_2196 680
254 3300046517 Ga0495630_0008948 Ga0495630_0008948_4500_6626 680
255 3300046522 Ga0495643_0005631 Ga0495643_0005631_1939_4050 680
256 3300046526 Ga0495666_0004839 Ga0495666_0004839_4198_6324 680
257 3300046531 Ga0495665_0011683 Ga0495665_0011683_150_2276 680
258 3300046533 Ga0495640_0025685 Ga0495640_0025685_191_2317 680
259 3300046535 Ga0495586_0016961 Ga0495586_0016961_842_2968 680
260 3300046536 Ga0495587_0052561 Ga0495587_0052561_208_2334 680
261 3300046543 Ga0495645_0034819 Ga0495645_0034819_1240_3366 680
262 3300046674 Ga0495588_0009401 Ga0495588_0009401_2025_4151 680
263 3300046690 Ga0495624_0005701 Ga0495624_0005701_4780_6906 680
264 3300047315 Ga0495581_0000829 Ga0495581_0000829_2164_4290 680
265 3300047317 Ga0495604_0008302 Ga0495604_0008302_3794_5920 680
266 3300047319 Ga0495674_0078782 Ga0495674_0078782_520_2646 680
267 3300047321 Ga0495676_0019846 Ga0495676_0019846_1541_3667 680
268 3300047471 Ga0495684_0038353 Ga0495684_0038353_965_3091 680
269 3300048088 Ga0495602_0068704 Ga0495602_0068704_836_2962 680
270 3300048906 Ga0496103_0019527 Ga0496103_0019527_1370_3496 680
271 3300048908 Ga0496105_0007585 Ga0496105_0007585_738_2864 680
272 3300048914 Ga0496111_0007944 Ga0496111_0007944_691_2817 680
273 3300049571 Ga0501034_0016416 Ga0501034_0016416_3434_5551 680
274 3300053078 Ga0495612_0007728 Ga0495612_0007728_312_2438 680
275 3300053085 Ga0495619_0006421 Ga0495619_0006421_4332_6458 680
276 3300025940 Ga0207691_10090881 Ga0207691_100908812 681
277 3300030522 Ga0307512_10010890 Ga0307512_100108907 681
278 3300035083 Ga0373926_0003540 Ga0373926_0003540_2019_4151 681
279 3300035086 Ga0373934_0003415 Ga0373934_0003415_2488_4644 681
280 3300035116 Ga0373945_0000377 Ga0373945_0000377_7369_9501 681
281 3300035119 Ga0373956_0004461 Ga0373956_0004461_1929_4085 681
282 3300035170 Ga0373943_0000181 Ga0373943_0000181_12555_14687 681
283 3300035692 Ga0373935_0000806 Ga0373935_0000806_3099_5231 681
284 3300035695 Ga0373927_0001841 Ga0373927_0001841_3000_5132 681
285 3300035725 Ga0373947_0006365 Ga0373947_0006365_919_3051 681
286 3300044712 Ga0453684_0133902 Ga0453684_0133902_542_2701 681
287 3300045051 Ga0451576_0017044 Ga0451576_0017044_2155_4314 681
288 3300046463 Ga0495653_0001121 Ga0495653_0001121_7804_9936 681
289 3300046477 Ga0495664_0001297 Ga0495664_0001297_1644_3776 681
290 3300046517 Ga0495630_0003036 Ga0495630_0003036_3241_5373 681
291 3300046559 Ga0495667_0005691 Ga0495667_0005691_2960_5092 681
292 3300046559 Ga0495667_0027860 Ga0495667_0027860_1319_3475 681
293 3300046663 Ga0495635_0001577 Ga0495635_0001577_10296_12428 681
294 3300046690 Ga0495624_0003291 Ga0495624_0003291_6316_8448 681
295 3300047317 Ga0495604_0020817 Ga0495604_0020817_502_2619 681
296 3300047319 Ga0495674_0000327 Ga0495674_0000327_15135_17267 681
297 3300047321 Ga0495676_0001524 Ga0495676_0001524_2940_5072 681
298 3300047322 Ga0495680_0004908 Ga0495680_0004908_2872_5004 681
299 3300049586 Ga0501070_0015077 Ga0501070_0015077_3353_5446 681
300 3300049590 Ga0501074_0008663 Ga0501074_0008663_1537_3630 681
301 3300049741 Ga0501079_0006181 Ga0501079_0006181_4256_6349 681
302 3300005290 Ga0065712_10079582 Ga0065712_100795822 682
303 3300005445 Ga0070708_100004573 Ga0070708_1000045731 682
304 3300025915 Ga0207693_10046833 Ga0207693_100468333 682
305 3300046511 Ga0495608_0029985 Ga0495608_0029985_573_2690 682
306 3300046536 Ga0495587_0022976 Ga0495587_0022976_1029_3146 682
307 3300046559 Ga0495667_0028835 Ga0495667_0028835_366_2483 682
308 3300046679 Ga0495623_0011872 Ga0495623_0011872_225_2342 682
309 3300048088 Ga0495602_0026435 Ga0495602_0026435_963_3080 682
310 3300049576 Ga0501040_0002676 Ga0501040_0002676_8156_10288 682
311 3300049581 Ga0501047_0073657 Ga0501047_0073657_1138_3234 682
312 3300049589 Ga0501073_0021757 Ga0501073_0021757_2039_4222 682
313 3300049590 Ga0501074_0005851 Ga0501074_0005851_1407_3503 682
314 3300049590 Ga0501074_0011185 Ga0501074_0011185_1727_3859 682
315 3300054114 Ga0501084_0001893 Ga0501084_0001893_12814_14946 682
316 3300060353 Ga0501082_0009158 Ga0501082_0009158_5722_7854 682
317 3300005331 Ga0070670_100005087 Ga0070670_1000050877 683
318 3300007265 Ga0099794_10012756 Ga0099794_100127564 683
319 3300026118 Ga0207675_100017666 Ga0207675_1000176661 683
320 3300003322 rootL2_10010183 rootL2_100101833 684
321 3300048912 Ga0496109_0015434 Ga0496109_0015434_4004_6109 684
322 3300049570 Ga0501033_0000152 Ga0501033_0000152_48252_50360 684
323 3300049581 Ga0501047_0071779 Ga0501047_0071779_355_2463 684
324 3300005329 Ga0070683_100002617 Ga0070683_1000026178 685
325 3300006237 Ga0097621_100001393 Ga0097621_10000139310 685
326 3300006914 Ga0075436_100058086 Ga0075436_1000580861 685
327 3300009094 Ga0111539_10019873 Ga0111539_100198735 685
328 3300009098 Ga0105245_10015648 Ga0105245_100156482 685
329 3300013297 Ga0157378_10000813 Ga0157378_1000081329 685
330 3300026035 Ga0207703_10025892 Ga0207703_100258922 685
331 3300031995 Ga0307409_100074140 Ga0307409_1000741402 685
332 3300032002 Ga0307416_100021161 Ga0307416_1000211614 685
333 3300037466 Ga0395898_0022774 Ga0395898_0022774_1624_3738 685
334 3300038443 Ga0395901_0025061 Ga0395901_0025061_1642_3756 685
335 3300049686 Ga0501257_000775 Ga0501257_000775_1342_3483 685
336 3300049705 Ga0501225_0005740 Ga0501225_0005740_604_2745 685
337 3300050511 nmdc:mga08y16_29492_c1 nmdc:mga08y16_29492_c1_2590_4686 685
338 3300005331 Ga0070670_100014124 Ga0070670_1000141242 686
339 3300005344 Ga0070661_100004126 Ga0070661_1000041264 686
340 3300005356 Ga0070674_100034906 Ga0070674_1000349062 686
341 3300009147 Ga0114129_10021814 Ga0114129_100218143 686
342 3300014325 Ga0163163_10003462 Ga0163163_1000346211 686
343 3300025920 Ga0207649_10012345 Ga0207649_100123452 686
344 3300026121 Ga0207683_10064492 Ga0207683_100644922 686
345 3300027512 Ga0209179_1001311 Ga0209179_10013112 686
346 3300035086 Ga0373934_0026920 Ga0373934_0026920_89_2209 686
347 3300035113 Ga0373936_0001929 Ga0373936_0001929_57_2177 686
348 3300035119 Ga0373956_0008925 Ga0373956_0008925_21_2141 686
349 3300035171 Ga0373946_0005032 Ga0373946_0005032_2436_4556 686
350 3300035172 Ga0373955_0001068 Ga0373955_0001068_2080_4200 686
351 3300035692 Ga0373935_0000009 Ga0373935_0000009_89068_91188 686
352 3300035725 Ga0373947_0001366 Ga0373947_0001366_12278_14398 686
353 3300036401 Ga0373937_0000061 Ga0373937_0000061_54153_56273 686
354 3300037068 Ga0373925_0001422 Ga0373925_0001422_10744_12864 686
355 3300046454 Ga0495592_0000022 Ga0495592_0000022_71189_73309 686
356 3300046463 Ga0495653_0000043 Ga0495653_0000043_104189_106309 686
357 3300046477 Ga0495664_0000006 Ga0495664_0000006_306218_308338 686
358 3300046511 Ga0495608_0000002 Ga0495608_0000002_306166_308286 686
359 3300046514 Ga0495618_0000001 Ga0495618_0000001_163108_165228 686
360 3300046516 Ga0495628_0000004 Ga0495628_0000004_120073_122193 686
361 3300046529 Ga0495652_0000007 Ga0495652_0000007_109655_111775 686
362 3300046533 Ga0495640_0000004 Ga0495640_0000004_328283_330403 686
363 3300046536 Ga0495587_0000002 Ga0495587_0000002_117009_119129 686
364 3300046543 Ga0495645_0000008 Ga0495645_0000008_23123_25243 686
365 3300046559 Ga0495667_0000006 Ga0495667_0000006_116996_119116 686
366 3300046642 Ga0495634_0000001 Ga0495634_0000001_95095_97215 686
367 3300046663 Ga0495635_0000004 Ga0495635_0000004_328239_330359 686
368 3300046675 Ga0495657_0001727 Ga0495657_0001727_10763_12883 686
369 3300046678 Ga0495599_0000003 Ga0495599_0000003_10734_12854 686
370 3300046679 Ga0495623_0000048 Ga0495623_0000048_64913_67033 686
371 3300046680 Ga0495646_0000001 Ga0495646_0000001_306275_308395 686
372 3300046689 Ga0495613_0039298 Ga0495613_0039298_856_2976 686
373 3300046809 Ga0495600_0000390 Ga0495600_0000390_9824_11944 686
374 3300047317 Ga0495604_0000003 Ga0495604_0000003_306140_308260 686
375 3300047319 Ga0495674_0000006 Ga0495674_0000006_159579_161699 686
376 3300047322 Ga0495680_0000366 Ga0495680_0000366_23161_25281 686
377 3300047444 Ga0495675_0000088 Ga0495675_0000088_18201_20321 686
378 3300047471 Ga0495684_0000003 Ga0495684_0000003_219594_221714 686
379 3300048088 Ga0495602_0000011 Ga0495602_0000011_105603_107723 686
380 3300048907 Ga0496104_0004383 Ga0496104_0004383_9359_11491 686
381 3300048908 Ga0496105_0062844 Ga0496105_0062844_465_2663 686
382 3300048911 Ga0496108_0001111 Ga0496108_0001111_12877_15009 686
383 3300048913 Ga0496110_0027530 Ga0496110_0027530_744_2876 686
384 3300048914 Ga0496111_0039778 Ga0496111_0039778_377_2509 686
385 3300049581 Ga0501047_0013293 Ga0501047_0013293_4419_6587 686
386 3300049744 Ga0501083_0001232 Ga0501083_0001232_6183_8291 686
387 3300053077 Ga0495601_0000004 Ga0495601_0000004_140692_142812 686
388 3300053078 Ga0495612_0000008 Ga0495612_0000008_70450_72570 686
389 3300053084 Ga0495595_0000025 Ga0495595_0000025_31973_34093 686
390 3300053085 Ga0495619_0000005 Ga0495619_0000005_306281_308401 686
391 3300053153 Ga0500616_0001253 Ga0500616_0001253_573_2702 686
392 3300005293 Ga0065715_10095353 Ga0065715_100953531 687
393 3300006038 Ga0075365_10011245 Ga0075365_100112455 687
394 3300011119 Ga0105246_10021813 Ga0105246_100218132 687
395 3300025315 Ga0207697_10024864 Ga0207697_100248642 687
396 3300035725 Ga0373947_0020871 Ga0373947_0020871_1323_3455 687
397 3300036401 Ga0373937_0016629 Ga0373937_0016629_3460_5583 687
398 3300037068 Ga0373925_0000407 Ga0373925_0000407_33884_36007 687
399 3300042156 Ga0439446_0006240 Ga0439446_0006240_552_2675 687
400 3300047319 Ga0495674_0084309 Ga0495674_0084309_378_2501 687
401 3300048915 Ga0496112_0034643 Ga0496112_0034643_1473_3599 687
402 3300049591 Ga0501075_0000991 Ga0501075_0000991_5910_8018 687
403 3300049593 Ga0501077_0003036 Ga0501077_0003036_4191_6299 687
404 3300050492 nmdc:mga0yw44_43426_c1 nmdc:mga0yw44_43426_c1_205_2388 687
405 iso_pu_bacteria 2919679072 2919682474 687
406 3300005331 Ga0070670_100043713 Ga0070670_1000437132 688
407 3300005937 Ga0081455_10001140 Ga0081455_1000114019 688
408 3300009551 Ga0105238_10026444 Ga0105238_100264442 688
409 3300025924 Ga0207694_10045445 Ga0207694_100454452 688
410 3300025949 Ga0207667_10011781 Ga0207667_100117812 688
411 3300048917 Ga0496114_0000542 Ga0496114_0000542_15387_17501 688
412 3300050491 nmdc:mga00v17_7225_c1 nmdc:mga00v17_7225_c1_3410_5575 688
413 3300050515 nmdc:mga0a205_18705_c1 nmdc:mga0a205_18705_c1_271_2379 688
414 iso_pu_bacteria 8055172936 8055180353 688
415 3300005518 Ga0070699_100004132 Ga0070699_1000041327 689
416 3300005536 Ga0070697_100007695 Ga0070697_1000076951 689
417 3300006847 Ga0075431_100004792 Ga0075431_1000047929 689
418 3300025922 Ga0207646_10007887 Ga0207646_100078874 689
419 3300035086 Ga0373934_0011375 Ga0373934_0011375_110_2227 689
420 3300036401 Ga0373937_0015565 Ga0373937_0015565_272_2389 689
421 3300046462 Ga0495651_0011722 Ga0495651_0011722_1350_3467 689
422 3300046463 Ga0495653_0030416 Ga0495653_0030416_1824_3941 689
423 3300050510 nmdc:mga06r32_30_c3 nmdc:mga06r32_30_c3_4318_6432 689
424 3300053156 Ga0500622_0001148 Ga0500622_0001148_18823_20991 689
425 iso_pu_bacteria 2643221681 2644458118 689
426 iso_pu_bacteria 2891326441 2891326747 689
427 3300003203 JGI25406J46586_10013129 JGI25406J46586_100131293 690
428 3300005434 Ga0070709_10001376 Ga0070709_100013763 690
429 3300005439 Ga0070711_100003179 Ga0070711_1000031793 690
430 3300005467 Ga0070706_100017990 Ga0070706_1000179904 690
431 3300005985 Ga0081539_10000128 Ga0081539_10000128126 690
432 3300025898 Ga0207692_10003323 Ga0207692_100033234 690
433 3300025906 Ga0207699_10001648 Ga0207699_100016483 690
434 3300025916 Ga0207663_10006017 Ga0207663_100060172 690
435 3300037853 Ga0436364_0644502 Ga0436364_0644502_600_2726 690
436 3300042876 Ga0451577_0000060 Ga0451577_0000060_40921_43041 690
437 3300044712 Ga0453684_0001498 Ga0453684_0001498_30210_32330 690
438 3300044712 Ga0453684_0205927 Ga0453684_0205927_45_2159 690
439 3300044735 Ga0466968_0001843 Ga0466968_0001843_1941_4118 690
440 3300049571 Ga0501034_0000086 Ga0501034_0000086_125173_127290 690
441 iso_pu_bacteria 2984592036 2984592862 690
442 3300005546 Ga0070696_100013273 Ga0070696_1000132733 691
443 3300025905 Ga0207685_10000884 Ga0207685_100008842 691
444 3300025906 Ga0207699_10002880 Ga0207699_100028807 691
445 3300025910 Ga0207684_10021941 Ga0207684_100219412 691
446 3300025928 Ga0207700_10003799 Ga0207700_100037998 691
447 3300033179 Ga0307507_10092331 Ga0307507_100923311 691
448 3300047471 Ga0495684_0002732 Ga0495684_0002732_2996_5128 691
449 3300048915 Ga0496112_0004272 Ga0496112_0004272_9770_11929 691
450 iso_pu_bacteria 2643221697 2644537612 691
451 3300009147 Ga0114129_10009295 Ga0114129_100092955 692
452 3300046462 Ga0495651_0004547 Ga0495651_0004547_177_2297 692
453 3300046559 Ga0495667_0020485 Ga0495667_0020485_106_2226 692
454 3300046679 Ga0495623_0032583 Ga0495623_0032583_568_2688 692
455 3300048925 Ga0496122_0012692 Ga0496122_0012692_2047_4170 693
456 3300006042 Ga0075368_10005451 Ga0075368_100054512 694
457 3300006051 Ga0075364_10000451 Ga0075364_100004512 694
458 3300006178 Ga0075367_10008071 Ga0075367_100080712 694
459 3300006353 Ga0075370_10016045 Ga0075370_100160452 694
460 3300026121 Ga0207683_10032657 Ga0207683_100326573 694
461 3300050489 nmdc:mga03683_3152_c1 nmdc:mga03683_3152_c1_409_2553 694
462 3300050491 nmdc:mga00v17_4256_c1 nmdc:mga00v17_4256_c1_5152_7305 694
463 3300050494 nmdc:mga06z11_19798_c1 nmdc:mga06z11_19798_c1_831_2975 694
464 3300050496 nmdc:mga07m45_33560_c1 nmdc:mga07m45_33560_c1_112_2256 694
465 3300013297 Ga0157378_10021973 Ga0157378_100219733 698
466 3300005518 Ga0070699_100067345 Ga0070699_1000673452 699
467 3300025910 Ga0207684_10011356 Ga0207684_100113562 699
468 3300039437 Ga0436365_1791131 Ga0436365_1791131_928_3144 699
469 3300005434 Ga0070709_10003161 Ga0070709_100031613 700
470 3300005435 Ga0070714_100022101 Ga0070714_1000221012 700
471 3300005436 Ga0070713_100001778 Ga0070713_1000017783 700
472 3300005439 Ga0070711_100001350 Ga0070711_1000013504 700
473 3300005468 Ga0070707_100010437 Ga0070707_1000104372 700
474 3300006175 Ga0070712_100002533 Ga0070712_1000025332 700
475 3300025915 Ga0207693_10000559 Ga0207693_1000055915 700
476 3300025922 Ga0207646_10094806 Ga0207646_100948062 700
477 3300021388 Ga0213875_10000846 Ga0213875_1000084617 702
478 3300037853 Ga0436364_1476073 Ga0436364_1476073_30496_32910 702
479 3300037466 Ga0395898_0025022 Ga0395898_0025022_1673_3799 703
480 3300005436 Ga0070713_100000264 Ga0070713_10000026424 704
481 3300025928 Ga0207700_10002444 Ga0207700_100024443 704
482 3300005458 Ga0070681_10029040 Ga0070681_100290403 705
483 3300005539 Ga0068853_100007980 Ga0068853_1000079802 705
484 3300005563 Ga0068855_100021189 Ga0068855_1000211892 705
485 3300005578 Ga0068854_100000893 Ga0068854_1000008937 705
486 3300005614 Ga0068856_100004316 Ga0068856_1000043166 705
487 3300005834 Ga0068851_10005240 Ga0068851_100052402 705
488 3300010375 Ga0105239_10026105 Ga0105239_100261053 705
489 3300013296 Ga0157374_10032453 Ga0157374_100324532 705
490 3300025911 Ga0207654_10014207 Ga0207654_100142072 705
491 3300025919 Ga0207657_10004945 Ga0207657_1000494510 705
492 3300025932 Ga0207690_10039790 Ga0207690_100397902 705
493 3300025945 Ga0207679_10044502 Ga0207679_100445022 705
494 3300026041 Ga0207639_10015385 Ga0207639_100153853 705
495 3300026078 Ga0207702_10063441 Ga0207702_100634411 705
496 3300048905 Ga0496102_0014672 Ga0496102_0014672_3162_5306 705
497 3300048909 Ga0496106_0053323 Ga0496106_0053323_495_2639 705
498 3300048911 Ga0496108_0007888 Ga0496108_0007888_3363_5507 705
499 3300048913 Ga0496110_0096551 Ga0496110_0096551_395_2539 705
500 3300048914 Ga0496111_0011183 Ga0496111_0011183_1561_3705 705
501 3300048915 Ga0496112_0053092 Ga0496112_0053092_959_3103 705
502 3300005435 Ga0070714_100003805 Ga0070714_1000038054 706
503 3300005439 Ga0070711_100024118 Ga0070711_1000241182 706
504 3300025915 Ga0207693_10009175 Ga0207693_100091752 706
505 3300025945 Ga0207679_10055338 Ga0207679_100553382 706
506 3300026078 Ga0207702_10029993 Ga0207702_100299933 706
507 3300005295 Ga0065707_10083283 Ga0065707_100832833 708
508 3300035089 Ga0373944_0001042 Ga0373944_0001042_480_2624 708
509 3300037068 Ga0373925_0006054 Ga0373925_0006054_539_2683 708
510 3300049744 Ga0501083_0006386 Ga0501083_0006386_5779_7923 709
511 3300049590 Ga0501074_0031046 Ga0501074_0031046_753_2972 710
512 3300049742 Ga0501080_0075757 Ga0501080_0075757_624_2843 710
513 3300003187 JGI25151J46595_10015433 JGI25151J46595_100154332 714

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02922

CBM_48

Carbohydrate-binding module 48 (Isoamylase N-terminal domain)

80

166

0.93

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

257

363

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u3b-assembly4.cif.gz_G structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.9782 11 708
7u3a-assembly1.cif.gz_A structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.9776 10 708
7u3b-assembly4.cif.gz_G structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.9768 11 708
7u3a-assembly2.cif.gz_D structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.9767 11 708
7eav-assembly1.cif.gz_A the x-ray crystallographic structure of glycogen debranching enzyme from sulfolobus solfataricus stb09 0.9762 11 710
ID Description Score Start End Superfamily
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9847 152 587 3.20.20.80
af_P9WQ25_15_155_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9762 11 150 2.60.40.10
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9705 153 591 3.20.20.80
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9628 152 587 3.20.20.80
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9618 153 591 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A2V6A6K3-F1-model_v4 Glycogen debranching enzyme 1.002 259 362 GO:0005975
AF-A0A060BX92-F1-model_v4 CAZy families CBM48|GH13 protein 1.001 411 546
AF-A0A7K2FPN3-F1-model_v4 Glycogen debranching enzyme 0.9991 435 551
AF-A0A3R9V3A0-F1-model_v4 deleted 0.9991 422 547
AF-A0A350T3I0-F1-model_v4 Glycogen debranching enzyme GlgX 0.9981 6 548 GO:0004133
GO:0004553
GO:0005980

Feature Viewer

pLDDT pTM Quality
93.03 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map