F457576

General Info

Members Datasets Scaffolds Average Seq Length
513 197 1026 225

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10523687|Ga0207684_105236872
Length 242
Sequence LNSREFQDRLGRRARRAGITVGAELAAKLEIYYRLLATWNRKINLTALNLTELAPDAVDRLLIEPLVAAKHVPSATRRMIDLGTGGGSPALPMALAVPGAHLLMVESKTRKSVFLQEAVRALELEAGVATARFEELLAKPDLHEAHDLVTIRAVRIEARVLMSIQAFARPGGLIFLFRGAAGEPAETVIPPLAWQATYPLVENLRSRLVVLEKRPTGRGVPRAVGGLRQRSGCQQCGGDERY

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
153 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.19
Rhizosphere 99.81
Stem 0
Stem Tuber 0
Unclassified 9.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10523687 3300025910 Unclassified 1015
2 MRS1b_contig_387710 2162886011 Bacteria 1016
3 JGI24746J21847_1004912 3300001977 Bacteria 2097
4 JGI25406J46586_10002845 3300003203 Bacteria 8157
5 JGI25406J46586_10007838 3300003203 Bacteria 4858
6 Ga0065704_10074016 3300005289 Bacteria 6600
7 Ga0065712_10068121 3300005290 Bacteria 14453
8 Ga0065712_10119834 3300005290 Bacteria 1685
9 Ga0065715_10002036 3300005293 Bacteria 6043
10 Ga0065715_10090848 3300005293 Bacteria 6387
11 Ga0070658_10083865 3300005327 Bacteria 2620
12 Ga0070676_10005401 3300005328 Bacteria 6807
13 Ga0070676_10366879 3300005328 Unclassified 994
14 Ga0070683_100033791 3300005329 Bacteria 4666
15 Ga0070683_100087106 3300005329 Bacteria 2929
16 Ga0070690_100024641 3300005330 Bacteria 3701
17 Ga0070690_100028865 3300005330 Bacteria 3438
18 Ga0070690_100092038 3300005330 Bacteria 1999
19 Ga0070670_100016940 3300005331 Bacteria 6255
20 Ga0070670_100050412 3300005331 Bacteria 3577
21 Ga0070677_10003668 3300005333 Bacteria 4961
22 Ga0070677_10015927 3300005333 Bacteria 2670
23 Ga0068869_100002360 3300005334 Bacteria 11371
24 Ga0068869_100052654 3300005334 Bacteria 2956
25 Ga0068869_100432012 3300005334 Unclassified 1088
26 Ga0070666_10074705 3300005335 Bacteria 2311
27 Ga0070680_100158146 3300005336 Bacteria 1904
28 Ga0068868_100004023 3300005338 Bacteria 10260
29 Ga0070660_100340030 3300005339 Bacteria 1235
30 Ga0070689_100009376 3300005340 Bacteria 6937
31 Ga0070689_100018126 3300005340 Bacteria 5181
32 Ga0070689_100094911 3300005340 Bacteria 2355
33 Ga0070689_100182716 3300005340 Bacteria 1704
34 Ga0070687_100036911 3300005343 Bacteria 2439
35 Ga0070661_100013223 3300005344 Bacteria 5794
36 Ga0070692_10229418 3300005345 Bacteria 1101
37 Ga0070669_100006055 3300005353 Bacteria 8727
38 Ga0070669_100017805 3300005353 Bacteria 5071
39 Ga0070669_100041443 3300005353 Bacteria 3348
40 Ga0070669_100318936 3300005353 Bacteria 1254
41 Ga0070669_100659193 3300005353 Bacteria 881
42 Ga0070669_100674245 3300005353 Unclassified 871
43 Ga0070675_100002287 3300005354 Bacteria 14212
44 Ga0070675_100005453 3300005354 Bacteria 9729
45 Ga0070675_100007958 3300005354 Bacteria 8216
46 Ga0070675_100014842 3300005354 Bacteria 6148
47 Ga0070675_100021825 3300005354 Bacteria 5115
48 Ga0070675_100046261 3300005354 Bacteria 3563
49 Ga0070675_100210132 3300005354 Bacteria 1691
50 Ga0070671_100064753 3300005355 Bacteria 3044
51 Ga0070674_100014835 3300005356 Bacteria 4849
52 Ga0070673_100012161 3300005364 Bacteria 5899
53 Ga0070673_100023619 3300005364 Bacteria 4494
54 Ga0070673_100030805 3300005364 Bacteria 4020
55 Ga0070673_100039537 3300005364 Bacteria 3611
56 Ga0070673_100209110 3300005364 Bacteria 1684
57 Ga0070688_100008733 3300005365 Bacteria 5509
58 Ga0070688_100010648 3300005365 Bacteria 5079
59 Ga0070688_100042927 3300005365 Bacteria 2784
60 Ga0070688_100059723 3300005365 Bacteria 2406
61 Ga0070667_100004379 3300005367 Bacteria 11911
62 Ga0070713_100008483 3300005436 Bacteria 7290
63 Ga0070701_10001027 3300005438 Bacteria 10169
64 Ga0070701_10002666 3300005438 Bacteria 6919
65 Ga0070705_100011096 3300005440 Bacteria 4533
66 Ga0070700_100033139 3300005441 Bacteria 3110
67 Ga0070700_100104246 3300005441 Bacteria 1874
68 Ga0070694_100001154 3300005444 Bacteria 15172
69 Ga0070694_100001406 3300005444 Bacteria 14087
70 Ga0070694_100241345 3300005444 Bacteria 1363
71 Ga0070694_100368568 3300005444 Unclassified 1117
72 Ga0070694_100420021 3300005444 Bacteria 1050
73 Ga0070708_100501216 3300005445 Unclassified 1145
74 Ga0070678_100065365 3300005456 Bacteria 2700
75 Ga0070678_100082415 3300005456 Bacteria 2442
76 Ga0070678_100154195 3300005456 Bacteria 1854
77 Ga0070662_100126340 3300005457 Bacteria 1966
78 Ga0070662_100473551 3300005457 Bacteria 1042
79 Ga0070681_10099697 3300005458 Bacteria 2850
80 Ga0068867_100002577 3300005459 Bacteria 12775
81 Ga0068867_100045769 3300005459 Bacteria 3211
82 Ga0068867_100060652 3300005459 Bacteria 2806
83 Ga0068867_100270101 3300005459 Unclassified 1390
84 Ga0070685_10067503 3300005466 Bacteria 2110
85 Ga0070706_100188460 3300005467 Bacteria 1928
86 Ga0070706_100479383 3300005467 Unclassified 1157
87 Ga0070698_100003115 3300005471 Bacteria 18284
88 Ga0070698_100040523 3300005471 Bacteria 4786
89 Ga0070698_100290835 3300005471 Unclassified 1565
90 Ga0070698_100442070 3300005471 Bacteria 1236
91 Ga0070699_100006579 3300005518 Bacteria 10112
92 Ga0070699_100026984 3300005518 Bacteria 4953
93 Ga0070699_100632033 3300005518 Bacteria 977
94 Ga0070679_100189094 3300005530 Bacteria 2029
95 Ga0070697_100096970 3300005536 Bacteria 2446
96 Ga0070672_100005404 3300005543 Bacteria 8461
97 Ga0070672_100051445 3300005543 Bacteria 3213
98 Ga0070672_100053626 3300005543 Bacteria 3153
99 Ga0070672_100096935 3300005543 Bacteria 2387
100 Ga0070672_100479672 3300005543 Bacteria 1074
101 Ga0070686_100284113 3300005544 Unclassified 1221
102 Ga0070686_100293645 3300005544 Unclassified 1203
103 Ga0070695_100000013 3300005545 Bacteria 69322
104 Ga0070695_100195099 3300005545 Bacteria 1443
105 Ga0070695_100341485 3300005545 Unclassified 1119
106 Ga0070696_100003152 3300005546 Bacteria 10977
107 Ga0070696_100021391 3300005546 Bacteria 4385
108 Ga0070696_100061035 3300005546 Bacteria 2637
109 Ga0070696_100135944 3300005546 Bacteria 1792
110 Ga0070696_100352547 3300005546 Unclassified 1140
111 Ga0070665_100031938 3300005548 Bacteria 5300
112 Ga0070704_100002422 3300005549 Bacteria 10469
113 Ga0070704_100004325 3300005549 Bacteria 8211
114 Ga0070704_100119681 3300005549 Bacteria 2020
115 Ga0070704_100288938 3300005549 Bacteria 1362
116 Ga0070664_100003952 3300005564 Bacteria 11940
117 Ga0070664_100020594 3300005564 Bacteria 5431
118 Ga0070664_100232466 3300005564 Bacteria 1653
119 Ga0070664_100359445 3300005564 Bacteria 1326
120 Ga0068857_100014860 3300005577 Bacteria 6790
121 Ga0070702_100036092 3300005615 Bacteria 2736
122 Ga0068859_100002987 3300005617 Bacteria 17148
123 Ga0068859_100005331 3300005617 Bacteria 13080
124 Ga0068859_100016066 3300005617 Bacteria 7521
125 Ga0068859_100118592 3300005617 Bacteria 2712
126 Ga0068859_100221686 3300005617 Bacteria 1979
127 Ga0068859_100293580 3300005617 Bacteria 1719
128 Ga0068859_100520671 3300005617 Bacteria 1284
129 Ga0068859_100614920 3300005617 Unclassified 1179
130 Ga0068864_100018454 3300005618 Bacteria 5829
131 Ga0068864_100023764 3300005618 Bacteria 5150
132 Ga0068864_100038389 3300005618 Bacteria 4090
133 Ga0068864_100046224 3300005618 Bacteria 3735
134 Ga0068864_100246155 3300005618 Bacteria 1658
135 Ga0068864_100483068 3300005618 Bacteria 1189
136 Ga0068866_10156646 3300005718 Bacteria 1324
137 Ga0068861_100010906 3300005719 Bacteria 6313
138 Ga0068861_100028966 3300005719 Bacteria 4045
139 Ga0068870_10001197 3300005840 Bacteria 10403
140 Ga0068870_10004966 3300005840 Bacteria 5769
141 Ga0068870_10046106 3300005840 Bacteria 2284
142 Ga0068858_100024277 3300005842 Bacteria 5650
143 Ga0068860_100009524 3300005843 Bacteria 9647
144 Ga0068862_100001009 3300005844 Bacteria 27013
145 Ga0068862_100001050 3300005844 Bacteria 26495
146 Ga0068862_100241598 3300005844 Bacteria 1642
147 Ga0068862_100331778 3300005844 Unclassified 1407
148 Ga0068862_100549121 3300005844 Bacteria 1103
149 Ga0081539_10000029 3300005985 Bacteria 322399
150 Ga0081539_10000036 3300005985 Bacteria 296724
151 Ga0081539_10014628 3300005985 Bacteria 5780
152 Ga0068871_100139914 3300006358 Bacteria 2058
153 Ga0075428_100000825 3300006844 Bacteria 32443
154 Ga0075428_100003615 3300006844 Bacteria 16952
155 Ga0075428_100016682 3300006844 Bacteria 8110
156 Ga0075428_100029386 3300006844 Bacteria 6081
157 Ga0075428_100046453 3300006844 Bacteria 4770
158 Ga0075428_100049052 3300006844 Bacteria 4633
159 Ga0075428_100199992 3300006844 Bacteria 2161
160 Ga0075428_100564662 3300006844 Bacteria 1216
161 Ga0075428_100648822 3300006844 Bacteria 1126
162 Ga0075428_100977263 3300006844 Bacteria 897
163 Ga0075430_100000247 3300006846 Bacteria 37440
164 Ga0075430_100001103 3300006846 Bacteria 21464
165 Ga0075430_100016025 3300006846 Bacteria 6382
166 Ga0075430_100032651 3300006846 Bacteria 4419
167 Ga0075430_100094988 3300006846 Bacteria 2492
168 Ga0075430_100253983 3300006846 Bacteria 1456
169 Ga0075431_100001568 3300006847 Bacteria 21234
170 Ga0075431_100009315 3300006847 Bacteria 9852
171 Ga0075431_100013068 3300006847 Bacteria 8384
172 Ga0075431_100120213 3300006847 Bacteria 2710
173 Ga0075431_100217976 3300006847 Bacteria 1947
174 Ga0075433_10001195 3300006852 Bacteria 18904
175 Ga0075433_10004228 3300006852 Bacteria 11148
176 Ga0075433_10006958 3300006852 Bacteria 8965
177 Ga0075433_10052925 3300006852 Bacteria 3538
178 Ga0075433_10057220 3300006852 Bacteria 3408
179 Ga0075433_10238309 3300006852 Bacteria 1615
180 Ga0075433_10266782 3300006852 Bacteria 1517
181 Ga0075434_100001546 3300006871 Bacteria 19486
182 Ga0075434_100001899 3300006871 Bacteria 18102
183 Ga0075434_100003555 3300006871 Bacteria 13914
184 Ga0075434_100006985 3300006871 Bacteria 10407
185 Ga0075434_100043743 3300006871 Bacteria 4442
186 Ga0075434_100083687 3300006871 Bacteria 3188
187 Ga0075429_100000378 3300006880 Bacteria 32769
188 Ga0075429_100014940 3300006880 Bacteria 6734
189 Ga0075429_100016527 3300006880 Bacteria 6393
190 Ga0075429_100023485 3300006880 Bacteria 5351
191 Ga0075429_100039557 3300006880 Bacteria 4104
192 Ga0075429_100060258 3300006880 Bacteria 3306
193 Ga0075429_100107149 3300006880 Bacteria 2442
194 Ga0075429_100307833 3300006880 Bacteria 1387
195 Ga0075429_100313100 3300006880 Bacteria 1374
196 Ga0068865_100154011 3300006881 Bacteria 1747
197 Ga0068865_100305011 3300006881 Bacteria 1276
198 Ga0075436_100291428 3300006914 Bacteria 1168
199 Ga0097620_100002987 3300006931 Bacteria 17148
200 Ga0097620_100005331 3300006931 Bacteria 13080
201 Ga0097620_100016066 3300006931 Bacteria 7521
202 Ga0097620_100118598 3300006931 Bacteria 2712
203 Ga0097620_100221696 3300006931 Bacteria 1979
204 Ga0097620_100293568 3300006931 Bacteria 1719
205 Ga0097620_100520698 3300006931 Bacteria 1284
206 Ga0097620_100614934 3300006931 Unclassified 1179
207 Ga0075435_100009149 3300007076 Bacteria 7152
208 Ga0075435_100058984 3300007076 Bacteria 3110
209 Ga0075435_100180588 3300007076 Bacteria 1783
210 Ga0111539_10000134 3300009094 Bacteria 84765
211 Ga0111539_10000191 3300009094 Bacteria 71382
212 Ga0111539_10000596 3300009094 Bacteria 46666
213 Ga0111539_10002220 3300009094 Bacteria 25940
214 Ga0111539_10004160 3300009094 Bacteria 18970
215 Ga0111539_10008357 3300009094 Bacteria 13170
216 Ga0111539_10084466 3300009094 Bacteria 3732
217 Ga0111539_10099700 3300009094 Bacteria 3411
218 Ga0111539_10122699 3300009094 Bacteria 3045
219 Ga0111539_10342193 3300009094 Bacteria 1741
220 Ga0111539_10456904 3300009094 Bacteria 1487
221 Ga0105245_10500943 3300009098 Unclassified 1231
222 Ga0105245_10549384 3300009098 Bacteria 1177
223 Ga0114129_10000550 3300009147 Bacteria 45963
224 Ga0114129_10001213 3300009147 Bacteria 34237
225 Ga0114129_10025725 3300009147 Bacteria 8338
226 Ga0114129_10046452 3300009147 Bacteria 6102
227 Ga0114129_10061089 3300009147 Bacteria 5267
228 Ga0114129_10072301 3300009147 Bacteria 4808
229 Ga0114129_10092535 3300009147 Bacteria 4189
230 Ga0114129_10133480 3300009147 Bacteria 3408
231 Ga0114129_10427398 3300009147 Bacteria 1741
232 Ga0114129_10486722 3300009147 Bacteria 1613
233 Ga0114129_10893372 3300009147 Bacteria 1126
234 Ga0114129_11023884 3300009147 Unclassified 1038
235 Ga0114129_11221850 3300009147 Unclassified 935
236 Ga0105243_10039392 3300009148 Bacteria 3683
237 Ga0105243_10068266 3300009148 Bacteria 2865
238 Ga0105243_11279516 3300009148 Bacteria 750
239 Ga0105242_10124782 3300009176 Bacteria 2215
240 Ga0105249_10000828 3300009553 Bacteria 27861
241 Ga0105249_10001504 3300009553 Bacteria 20446
242 Ga0105249_10536814 3300009553 Bacteria 1219
243 Ga0105246_10685900 3300011119 Bacteria 896
244 Ga0157374_10456499 3300013296 Bacteria 1280
245 Ga0157378_10513204 3300013297 Bacteria 1199
246 Ga0163162_10006203 3300013306 Bacteria 11580
247 Ga0157375_10007218 3300013308 Bacteria 9718
248 Ga0157375_10139347 3300013308 Bacteria 2552
249 Ga0157375_10183063 3300013308 Bacteria 2247
250 Ga0157375_10246611 3300013308 Bacteria 1946
251 Ga0163163_10368893 3300014325 Bacteria 1492
252 Ga0163163_10419882 3300014325 Unclassified 1396
253 Ga0157380_10028740 3300014326 Bacteria 4243
254 Ga0157380_10077931 3300014326 Bacteria 2702
255 Ga0157380_10198379 3300014326 Bacteria 1778
256 Ga0157380_10255952 3300014326 Bacteria 1587
257 Ga0157380_10406904 3300014326 Bacteria 1293
258 Ga0157380_10702796 3300014326 Bacteria 1016
259 Ga0157380_11090746 3300014326 Unclassified 837
260 Ga0157377_10005232 3300014745 Bacteria 6074
261 Ga0157377_10028756 3300014745 Bacteria 2994
262 Ga0157377_10070293 3300014745 Bacteria 2022
263 Ga0157379_10074380 3300014968 Bacteria 3042
264 Ga0157376_10093131 3300014969 Bacteria 2615
265 Ga0157376_10920835 3300014969 Unclassified 893
266 Ga0157376_11006000 3300014969 Bacteria 856
267 Ga0163161_10053883 3300017792 Bacteria 2918
268 Ga0163161_10148198 3300017792 Bacteria 1782
269 Ga0163161_10626907 3300017792 Bacteria 889
270 Ga0207682_10002603 3300025893 Bacteria 8050
271 Ga0207682_10009938 3300025893 Bacteria 3738
272 Ga0207682_10017319 3300025893 Bacteria 2814
273 Ga0207688_10000665 3300025901 Bacteria 16968
274 Ga0207688_10090212 3300025901 Bacteria 1759
275 Ga0207688_10091041 3300025901 Bacteria 1752
276 Ga0207680_10012699 3300025903 Bacteria 4299
277 Ga0207647_10074887 3300025904 Bacteria 2038
278 Ga0207645_10000277 3300025907 Bacteria 42576
279 Ga0207645_10144844 3300025907 Bacteria 1549
280 Ga0207643_10000129 3300025908 Bacteria 51178
281 Ga0207643_10002219 3300025908 Bacteria 10585
282 Ga0207643_10004548 3300025908 Bacteria 7452
283 Ga0207705_10072823 3300025909 Bacteria 2493
284 Ga0207707_10203216 3300025912 Bacteria 1727
285 Ga0207662_10001289 3300025918 Bacteria 12062
286 Ga0207662_10003301 3300025918 Bacteria 8280
287 Ga0207662_10062604 3300025918 Bacteria 2236
288 Ga0207657_10058837 3300025919 Bacteria 3305
289 Ga0207649_10089212 3300025920 Bacteria 2015
290 Ga0207646_10090535 3300025922 Bacteria 2739
291 Ga0207646_10485046 3300025922 Bacteria 1114
292 Ga0207681_10011317 3300025923 Bacteria 5480
293 Ga0207681_10282785 3300025923 Unclassified 1307
294 Ga0207650_10000653 3300025925 Bacteria 27547
295 Ga0207659_10029613 3300025926 Bacteria 3733
296 Ga0207690_10229629 3300025932 Bacteria 1424
297 Ga0207706_10027597 3300025933 Bacteria 5076
298 Ga0207706_10035227 3300025933 Bacteria 4451
299 Ga0207706_10158469 3300025933 Bacteria 1990
300 Ga0207706_10179096 3300025933 Bacteria 1862
301 Ga0207706_10272511 3300025933 Bacteria 1477
302 Ga0207670_10042153 3300025936 Bacteria 3006
303 Ga0207670_10077700 3300025936 Bacteria 2313
304 Ga0207670_10117243 3300025936 Bacteria 1929
305 Ga0207670_10179168 3300025936 Bacteria 1595
306 Ga0207669_10000173 3300025937 Bacteria 30195
307 Ga0207669_10038413 3300025937 Bacteria 2756
308 Ga0207704_10102813 3300025938 Bacteria 1909
309 Ga0207691_10002509 3300025940 Bacteria 17953
310 Ga0207691_10013481 3300025940 Bacteria 7821
311 Ga0207691_10094711 3300025940 Bacteria 2671
312 Ga0207691_10208459 3300025940 Bacteria 1699
313 Ga0207691_10272879 3300025940 Bacteria 1456
314 Ga0207689_10020574 3300025942 Bacteria 5553
315 Ga0207689_10065676 3300025942 Bacteria 2984
316 Ga0207689_10329225 3300025942 Bacteria 1268
317 Ga0207679_10016367 3300025945 Bacteria 4924
318 Ga0207679_10019165 3300025945 Bacteria 4594
319 Ga0207679_10050593 3300025945 Bacteria 3037
320 Ga0207679_10058898 3300025945 Bacteria 2848
321 Ga0207679_10294710 3300025945 Bacteria 1396
322 Ga0207651_10006701 3300025960 Bacteria 6065
323 Ga0207651_10013049 3300025960 Bacteria 4735
324 Ga0207651_10049633 3300025960 Bacteria 2844
325 Ga0207651_10059040 3300025960 Bacteria 2654
326 Ga0207651_10067615 3300025960 Bacteria 2515
327 Ga0207651_10415733 3300025960 Bacteria 1147
328 Ga0207712_10051468 3300025961 Bacteria 2881
329 Ga0207668_10066013 3300025972 Bacteria 2563
330 Ga0207668_10532859 3300025972 Bacteria 1015
331 Ga0207677_10317432 3300026023 Bacteria 1293
332 Ga0207708_10006372 3300026075 Bacteria 8742
333 Ga0207708_10022127 3300026075 Bacteria 4802
334 Ga0207708_10124550 3300026075 Bacteria 2011
335 Ga0207708_10142724 3300026075 Bacteria 1880
336 Ga0207708_10389628 3300026075 Bacteria 1150
337 Ga0207708_10526037 3300026075 Unclassified 994
338 Ga0207641_10020487 3300026088 Bacteria 5431
339 Ga0207641_10350505 3300026088 Bacteria 1407
340 Ga0207648_10000506 3300026089 Bacteria 43472
341 Ga0207648_10099589 3300026089 Bacteria 2545
342 Ga0207648_10151531 3300026089 Bacteria 2046
343 Ga0207648_10342766 3300026089 Unclassified 1346
344 Ga0207676_10017765 3300026095 Bacteria 5161
345 Ga0207676_10021739 3300026095 Bacteria 4709
346 Ga0207676_10037503 3300026095 Bacteria 3694
347 Ga0207676_10098290 3300026095 Bacteria 2420
348 Ga0207676_10403673 3300026095 Bacteria 1278
349 Ga0207674_10011761 3300026116 Bacteria 9820
350 Ga0207675_100002376 3300026118 Bacteria 18642
351 Ga0207675_100008956 3300026118 Bacteria 9390
352 Ga0207675_100732971 3300026118 Unclassified 999
353 Ga0207683_10144219 3300026121 Bacteria 2147
354 Ga0209971_1070810 3300027682 Unclassified 846
355 Ga0209974_10022202 3300027876 Bacteria 2102
356 Ga0207428_10000156 3300027907 Bacteria 93294
357 Ga0207428_10002283 3300027907 Bacteria 19243
358 Ga0207428_10003472 3300027907 Bacteria 15299
359 Ga0207428_10007107 3300027907 Bacteria 10244
360 Ga0207428_10010303 3300027907 Bacteria 8354
361 Ga0207428_10016525 3300027907 Bacteria 6345
362 Ga0207428_10048267 3300027907 Bacteria 3416
363 Ga0207428_10749854 3300027907 Unclassified 696
364 Ga0268265_10000135 3300028380 Bacteria 93986
365 Ga0268265_10025009 3300028380 Bacteria 4232
366 Ga0268265_10157492 3300028380 Bacteria 1924
367 Ga0268265_10214939 3300028380 Bacteria 1678
368 Ga0268264_10610179 3300028381 Bacteria 1076
369 Ga0307408_100035297 3300031548 Bacteria 3508
370 Ga0307408_100268856 3300031548 Bacteria 1414
371 Ga0307408_100420787 3300031548 Unclassified 1152
372 Ga0307405_10013421 3300031731 Bacteria 4369
373 Ga0307405_10257078 3300031731 Bacteria 1302
374 Ga0307405_10265323 3300031731 Bacteria 1285
375 Ga0307413_10006068 3300031824 Bacteria 5475
376 Ga0307410_10019350 3300031852 Bacteria 4140
377 Ga0307410_10118020 3300031852 Bacteria 1930
378 Ga0307410_10295867 3300031852 Bacteria 1275
379 Ga0307410_10501031 3300031852 Unclassified 999
380 Ga0307406_10598512 3300031901 Bacteria 909
381 Ga0307407_10003430 3300031903 Bacteria 6498
382 Ga0307407_10004644 3300031903 Bacteria 5860
383 Ga0307407_10009779 3300031903 Bacteria 4486
384 Ga0307412_10004084 3300031911 Bacteria 8133
385 Ga0307412_10117391 3300031911 Bacteria 1910
386 Ga0307409_100010618 3300031995 Bacteria 5741
387 Ga0307409_100348971 3300031995 Bacteria 1395
388 Ga0307416_100069342 3300032002 Bacteria 2917
389 Ga0307416_100234264 3300032002 Bacteria 1773
390 Ga0307414_10118708 3300032004 Bacteria 2029
391 Ga0307414_10616157 3300032004 Archaea 975
392 Ga0307411_10008874 3300032005 Bacteria 5242
393 Ga0307411_10028364 3300032005 Bacteria 3402
394 Ga0307411_10527781 3300032005 Bacteria 1003
395 Ga0307415_100012114 3300032126 Bacteria 4973
396 Ga0307415_100207199 3300032126 Bacteria 1561
397 Ga0373934_0106101 3300035086 Unclassified 1137
398 Ga0373956_0208925 3300035119 Unclassified 926
399 Ga0373943_0397683 3300035170 Unclassified 795
400 Ga0373946_0119054 3300035171 Unclassified 1204
401 Ga0373935_0035925 3300035692 Bacteria 3095
402 Ga0373937_0105036 3300036401 Bacteria 2624
403 Ga0373937_0184917 3300036401 Unclassified 1957
404 Ga0242420_036328 3300038996 Bacteria 930
405 Ga0439450_014135 3300042008 Bacteria 1614
406 Ga0439435_0136127 3300042436 Unclassified 779
407 Ga0439444_0035517 3300042437 Unclassified 956
408 Ga0439460_0014251 3300042461 Bacteria 2089
409 Ga0451577_0551304 3300042876 Bacteria 1047
410 Ga0451576_0010856 3300045051 Bacteria 10423
411 Ga0451576_0033794 3300045051 Bacteria 5434
412 Ga0451576_0087694 3300045051 Bacteria 3236
413 Ga0451576_0535414 3300045051 Bacteria 1230
414 Ga0451576_0868478 3300045051 Unclassified 947
415 Ga0495603_0015526 3300046455 Bacteria 4610
416 Ga0495629_0112232 3300046459 Bacteria 1900
417 Ga0495584_0014069 3300046491 Bacteria 4076
418 Ga0495594_0063371 3300046499 Bacteria 2048
419 Ga0495643_0005324 3300046522 Bacteria 8719
420 Ga0495644_0119007 3300046523 Unclassified 1004
421 Ga0495663_0027500 3300046525 Bacteria 1669
422 Ga0495609_0011821 3300046538 Bacteria 4150
423 Ga0495621_0007101 3300046539 Bacteria 3302
424 Ga0495621_0044557 3300046539 Bacteria 1569
425 Ga0495621_0081922 3300046539 Bacteria 1204
426 Ga0495659_0005360 3300046664 Bacteria 4034
427 Ga0495647_0157167 3300046681 Unclassified 978
428 Ga0496109_0062244 3300048912 Bacteria 3412
429 Ga0501039_0096630 3300049575 Bacteria 2303
430 Ga0501040_0011742 3300049576 Bacteria 5729
431 Ga0501041_0129895 3300049577 Unclassified 1569
432 Ga0501042_0043503 3300049578 Bacteria 3198
433 Ga0501042_0257515 3300049578 Bacteria 1259
434 Ga0501043_0270119 3300049579 Bacteria 1306
435 Ga0501043_0392653 3300049579 Unclassified 1049
436 Ga0501046_0395040 3300049580 Bacteria 999
437 Ga0501048_0075356 3300049582 Bacteria 2380
438 Ga0501067_0047038 3300049583 Bacteria 2394
439 Ga0501071_0199342 3300049587 Unclassified 1503
440 Ga0501073_0460830 3300049589 Bacteria 879
441 Ga0501075_0095681 3300049591 Bacteria 2253
442 Ga0501076_0025420 3300049592 Bacteria 4582
443 Ga0501076_0050355 3300049592 Bacteria 3295
444 Ga0501077_0194536 3300049593 Bacteria 1288
445 Ga0501077_0238672 3300049593 Unclassified 1155
446 Ga0501081_0044739 3300049743 Bacteria 3040
447 Ga0501081_0380825 3300049743 Bacteria 1042
448 Ga0501045_0138765 3300049824 Unclassified 1808
449 Ga0501045_0206845 3300049824 Bacteria 1462
450 nmdc:mga05p37_100039_c1 3300050507 Bacteria 3571
451 nmdc:mga05p37_1854_c1 3300050507 Bacteria 24613
452 nmdc:mga05p37_221497_c1 3300050507 Bacteria 2283
453 nmdc:mga05p37_231266_c1 3300050507 Bacteria 2227
454 nmdc:mga05p37_245821_c1 3300050507 Bacteria 2148
455 nmdc:mga05p37_256239_c1 3300050507 Bacteria 2096
456 nmdc:mga05p37_278878_c1 3300050507 Unclassified 1994
457 nmdc:mga05p37_35283_c1 3300050507 Bacteria 6130
458 nmdc:mga05p37_43996_c1 3300050507 Bacteria 5494
459 nmdc:mga05p37_541244_c1 3300050507 Bacteria 1328
460 nmdc:mga05p37_76590_c1 3300050507 Bacteria 4117
461 nmdc:mga05p37_769768_c1 3300050507 Bacteria 1058
462 nmdc:mga09592_101627_c1 3300050508 Bacteria 2463
463 nmdc:mga09592_157585_c1 3300050508 Bacteria 1960
464 nmdc:mga09592_252_c1 3300050508 Bacteria 39064
465 nmdc:mga09592_26536_c1 3300050508 Bacteria 4800
466 nmdc:mga09592_27446_c1 3300050508 Bacteria 4724
467 nmdc:mga09592_302938_c1 3300050508 Bacteria 1386
468 nmdc:mga09592_333401_c1 3300050508 Bacteria 1313
469 nmdc:mga09592_419660_c1 3300050508 Unclassified 1156
470 nmdc:mga09592_4536_c1 3300050508 Bacteria 11230
471 nmdc:mga0qj67_307775_c1 3300050509 Bacteria 1283
472 nmdc:mga0qj67_8836_c1 3300050509 Bacteria 7476
473 nmdc:mga0qj67_9418_c1 3300050509 Bacteria 7267
474 nmdc:mga06r32_148444_c1 3300050510 Bacteria 2322
475 nmdc:mga06r32_168473_c1 3300050510 Bacteria 2174
476 nmdc:mga06r32_187318_c1 3300050510 Bacteria 2056
477 nmdc:mga06r32_48299_c1 3300050510 Bacteria 4067
478 nmdc:mga06r32_504_c1 3300050510 Bacteria 33617
479 nmdc:mga06r32_69967_c1 3300050510 Bacteria 3393
480 nmdc:mga06r32_793904_c1 3300050510 Bacteria 908
481 nmdc:mga08y16_1568_c1 3300050511 Bacteria 23067
482 nmdc:mga08y16_167722_c1 3300050511 Bacteria 2281
483 nmdc:mga08y16_2643_c1 3300050511 Bacteria 18424
484 nmdc:mga08y16_6025_c1 3300050511 Bacteria 12707
485 nmdc:mga08y16_614_c1 3300050511 Bacteria 33280
486 nmdc:mga08y16_624036_c1 3300050511 Bacteria 1085
487 nmdc:mga08y16_690655_c1 3300050511 Bacteria 1021
488 nmdc:mga08y16_70963_c1 3300050511 Bacteria 3630
489 nmdc:mga08y16_72077_c1 3300050511 Bacteria 3600
490 nmdc:mga08y16_812_c1 3300050511 Bacteria 29900
491 nmdc:mga0n895_112801_c1 3300050512 Bacteria 2736
492 nmdc:mga0n895_1515_c1 3300050512 Bacteria 17423
493 nmdc:mga0n895_380386_c1 3300050512 Viruses 1429
494 nmdc:mga0n895_38713_c1 3300050512 Bacteria 4621
495 nmdc:mga0n895_985_c1 3300050512 Bacteria 20624
496 nmdc:mga0rr50_100757_c1 3300050513 Bacteria 2269
497 nmdc:mga0rr50_73072_c1 3300050513 Bacteria 2621
498 nmdc:mga0a205_10401_c1 3300050515 Bacteria 8551
499 nmdc:mga0a205_120835_c1 3300050515 Bacteria 2519
500 nmdc:mga0a205_196100_c1 3300050515 Bacteria 1910
501 nmdc:mga0a205_613_c1 3300050515 Bacteria 28395
502 nmdc:mga0a205_64046_c1 3300050515 Bacteria 3551
503 nmdc:mga0a205_742454_c1 3300050515 Unclassified 830
504 Ga0495601_0153898 3300053077 Unclassified 1502
505 Ga0501084_0019155 3300054114 Bacteria 5701
506 Ga0590071_000123 3300059421 Bacteria 21754
507 Ga0590071_000480 3300059421 Bacteria 11665
508 Ga0590074_000763 3300059423 Bacteria 4916
509 Ga0590074_000955 3300059423 Bacteria 4542
510 Ga0590075_004273 3300059424 Bacteria 3380
511 Ga0590075_013282 3300059424 Bacteria 2006
512 Ga0590077_000341 3300059426 Bacteria 13241
513 Ga0530510_0009458 3300061734 Bacteria 6833
514 Ga0207684_10523687
515 MRS1b_contig_387710
516 JGI24746J21847_1004912
517 JGI25406J46586_10002845
518 JGI25406J46586_10007838
519 Ga0065704_10074016
520 Ga0065712_10068121
521 Ga0065712_10119834
522 Ga0065715_10002036
523 Ga0065715_10090848
524 Ga0070658_10083865
525 Ga0070676_10005401
526 Ga0070676_10366879
527 Ga0070683_100033791
528 Ga0070683_100087106
529 Ga0070690_100024641
530 Ga0070690_100028865
531 Ga0070690_100092038
532 Ga0070670_100016940
533 Ga0070670_100050412
534 Ga0070677_10003668
535 Ga0070677_10015927
536 Ga0068869_100002360
537 Ga0068869_100052654
538 Ga0068869_100432012
539 Ga0070666_10074705
540 Ga0070680_100158146
541 Ga0068868_100004023
542 Ga0070660_100340030
543 Ga0070689_100009376
544 Ga0070689_100018126
545 Ga0070689_100094911
546 Ga0070689_100182716
547 Ga0070687_100036911
548 Ga0070661_100013223
549 Ga0070692_10229418
550 Ga0070669_100006055
551 Ga0070669_100017805
552 Ga0070669_100041443
553 Ga0070669_100318936
554 Ga0070669_100659193
555 Ga0070669_100674245
556 Ga0070675_100002287
557 Ga0070675_100005453
558 Ga0070675_100007958
559 Ga0070675_100014842
560 Ga0070675_100021825
561 Ga0070675_100046261
562 Ga0070675_100210132
563 Ga0070671_100064753
564 Ga0070674_100014835
565 Ga0070673_100012161
566 Ga0070673_100023619
567 Ga0070673_100030805
568 Ga0070673_100039537
569 Ga0070673_100209110
570 Ga0070688_100008733
571 Ga0070688_100010648
572 Ga0070688_100042927
573 Ga0070688_100059723
574 Ga0070667_100004379
575 Ga0070713_100008483
576 Ga0070701_10001027
577 Ga0070701_10002666
578 Ga0070705_100011096
579 Ga0070700_100033139
580 Ga0070700_100104246
581 Ga0070694_100001154
582 Ga0070694_100001406
583 Ga0070694_100241345
584 Ga0070694_100368568
585 Ga0070694_100420021
586 Ga0070708_100501216
587 Ga0070678_100065365
588 Ga0070678_100082415
589 Ga0070678_100154195
590 Ga0070662_100126340
591 Ga0070662_100473551
592 Ga0070681_10099697
593 Ga0068867_100002577
594 Ga0068867_100045769
595 Ga0068867_100060652
596 Ga0068867_100270101
597 Ga0070685_10067503
598 Ga0070706_100188460
599 Ga0070706_100479383
600 Ga0070698_100003115
601 Ga0070698_100040523
602 Ga0070698_100290835
603 Ga0070698_100442070
604 Ga0070699_100006579
605 Ga0070699_100026984
606 Ga0070699_100632033
607 Ga0070679_100189094
608 Ga0070697_100096970
609 Ga0070672_100005404
610 Ga0070672_100051445
611 Ga0070672_100053626
612 Ga0070672_100096935
613 Ga0070672_100479672
614 Ga0070686_100284113
615 Ga0070686_100293645
616 Ga0070695_100000013
617 Ga0070695_100195099
618 Ga0070695_100341485
619 Ga0070696_100003152
620 Ga0070696_100021391
621 Ga0070696_100061035
622 Ga0070696_100135944
623 Ga0070696_100352547
624 Ga0070665_100031938
625 Ga0070704_100002422
626 Ga0070704_100004325
627 Ga0070704_100119681
628 Ga0070704_100288938
629 Ga0070664_100003952
630 Ga0070664_100020594
631 Ga0070664_100232466
632 Ga0070664_100359445
633 Ga0068857_100014860
634 Ga0070702_100036092
635 Ga0068859_100002987
636 Ga0068859_100005331
637 Ga0068859_100016066
638 Ga0068859_100118592
639 Ga0068859_100221686
640 Ga0068859_100293580
641 Ga0068859_100520671
642 Ga0068859_100614920
643 Ga0068864_100018454
644 Ga0068864_100023764
645 Ga0068864_100038389
646 Ga0068864_100046224
647 Ga0068864_100246155
648 Ga0068864_100483068
649 Ga0068866_10156646
650 Ga0068861_100010906
651 Ga0068861_100028966
652 Ga0068870_10001197
653 Ga0068870_10004966
654 Ga0068870_10046106
655 Ga0068858_100024277
656 Ga0068860_100009524
657 Ga0068862_100001009
658 Ga0068862_100001050
659 Ga0068862_100241598
660 Ga0068862_100331778
661 Ga0068862_100549121
662 Ga0081539_10000029
663 Ga0081539_10000036
664 Ga0081539_10014628
665 Ga0068871_100139914
666 Ga0075428_100000825
667 Ga0075428_100003615
668 Ga0075428_100016682
669 Ga0075428_100029386
670 Ga0075428_100046453
671 Ga0075428_100049052
672 Ga0075428_100199992
673 Ga0075428_100564662
674 Ga0075428_100648822
675 Ga0075428_100977263
676 Ga0075430_100000247
677 Ga0075430_100001103
678 Ga0075430_100016025
679 Ga0075430_100032651
680 Ga0075430_100094988
681 Ga0075430_100253983
682 Ga0075431_100001568
683 Ga0075431_100009315
684 Ga0075431_100013068
685 Ga0075431_100120213
686 Ga0075431_100217976
687 Ga0075433_10001195
688 Ga0075433_10004228
689 Ga0075433_10006958
690 Ga0075433_10052925
691 Ga0075433_10057220
692 Ga0075433_10238309
693 Ga0075433_10266782
694 Ga0075434_100001546
695 Ga0075434_100001899
696 Ga0075434_100003555
697 Ga0075434_100006985
698 Ga0075434_100043743
699 Ga0075434_100083687
700 Ga0075429_100000378
701 Ga0075429_100014940
702 Ga0075429_100016527
703 Ga0075429_100023485
704 Ga0075429_100039557
705 Ga0075429_100060258
706 Ga0075429_100107149
707 Ga0075429_100307833
708 Ga0075429_100313100
709 Ga0068865_100154011
710 Ga0068865_100305011
711 Ga0075436_100291428
712 Ga0097620_100002987
713 Ga0097620_100005331
714 Ga0097620_100016066
715 Ga0097620_100118598
716 Ga0097620_100221696
717 Ga0097620_100293568
718 Ga0097620_100520698
719 Ga0097620_100614934
720 Ga0075435_100009149
721 Ga0075435_100058984
722 Ga0075435_100180588
723 Ga0111539_10000134
724 Ga0111539_10000191
725 Ga0111539_10000596
726 Ga0111539_10002220
727 Ga0111539_10004160
728 Ga0111539_10008357
729 Ga0111539_10084466
730 Ga0111539_10099700
731 Ga0111539_10122699
732 Ga0111539_10342193
733 Ga0111539_10456904
734 Ga0105245_10500943
735 Ga0105245_10549384
736 Ga0114129_10000550
737 Ga0114129_10001213
738 Ga0114129_10025725
739 Ga0114129_10046452
740 Ga0114129_10061089
741 Ga0114129_10072301
742 Ga0114129_10092535
743 Ga0114129_10133480
744 Ga0114129_10427398
745 Ga0114129_10486722
746 Ga0114129_10893372
747 Ga0114129_11023884
748 Ga0114129_11221850
749 Ga0105243_10039392
750 Ga0105243_10068266
751 Ga0105243_11279516
752 Ga0105242_10124782
753 Ga0105249_10000828
754 Ga0105249_10001504
755 Ga0105249_10536814
756 Ga0105246_10685900
757 Ga0157374_10456499
758 Ga0157378_10513204
759 Ga0163162_10006203
760 Ga0157375_10007218
761 Ga0157375_10139347
762 Ga0157375_10183063
763 Ga0157375_10246611
764 Ga0163163_10368893
765 Ga0163163_10419882
766 Ga0157380_10028740
767 Ga0157380_10077931
768 Ga0157380_10198379
769 Ga0157380_10255952
770 Ga0157380_10406904
771 Ga0157380_10702796
772 Ga0157380_11090746
773 Ga0157377_10005232
774 Ga0157377_10028756
775 Ga0157377_10070293
776 Ga0157379_10074380
777 Ga0157376_10093131
778 Ga0157376_10920835
779 Ga0157376_11006000
780 Ga0163161_10053883
781 Ga0163161_10148198
782 Ga0163161_10626907
783 Ga0207682_10002603
784 Ga0207682_10009938
785 Ga0207682_10017319
786 Ga0207688_10000665
787 Ga0207688_10090212
788 Ga0207688_10091041
789 Ga0207680_10012699
790 Ga0207647_10074887
791 Ga0207645_10000277
792 Ga0207645_10144844
793 Ga0207643_10000129
794 Ga0207643_10002219
795 Ga0207643_10004548
796 Ga0207705_10072823
797 Ga0207707_10203216
798 Ga0207662_10001289
799 Ga0207662_10003301
800 Ga0207662_10062604
801 Ga0207657_10058837
802 Ga0207649_10089212
803 Ga0207646_10090535
804 Ga0207646_10485046
805 Ga0207681_10011317
806 Ga0207681_10282785
807 Ga0207650_10000653
808 Ga0207659_10029613
809 Ga0207690_10229629
810 Ga0207706_10027597
811 Ga0207706_10035227
812 Ga0207706_10158469
813 Ga0207706_10179096
814 Ga0207706_10272511
815 Ga0207670_10042153
816 Ga0207670_10077700
817 Ga0207670_10117243
818 Ga0207670_10179168
819 Ga0207669_10000173
820 Ga0207669_10038413
821 Ga0207704_10102813
822 Ga0207691_10002509
823 Ga0207691_10013481
824 Ga0207691_10094711
825 Ga0207691_10208459
826 Ga0207691_10272879
827 Ga0207689_10020574
828 Ga0207689_10065676
829 Ga0207689_10329225
830 Ga0207679_10016367
831 Ga0207679_10019165
832 Ga0207679_10050593
833 Ga0207679_10058898
834 Ga0207679_10294710
835 Ga0207651_10006701
836 Ga0207651_10013049
837 Ga0207651_10049633
838 Ga0207651_10059040
839 Ga0207651_10067615
840 Ga0207651_10415733
841 Ga0207712_10051468
842 Ga0207668_10066013
843 Ga0207668_10532859
844 Ga0207677_10317432
845 Ga0207708_10006372
846 Ga0207708_10022127
847 Ga0207708_10124550
848 Ga0207708_10142724
849 Ga0207708_10389628
850 Ga0207708_10526037
851 Ga0207641_10020487
852 Ga0207641_10350505
853 Ga0207648_10000506
854 Ga0207648_10099589
855 Ga0207648_10151531
856 Ga0207648_10342766
857 Ga0207676_10017765
858 Ga0207676_10021739
859 Ga0207676_10037503
860 Ga0207676_10098290
861 Ga0207676_10403673
862 Ga0207674_10011761
863 Ga0207675_100002376
864 Ga0207675_100008956
865 Ga0207675_100732971
866 Ga0207683_10144219
867 Ga0209971_1070810
868 Ga0209974_10022202
869 Ga0207428_10000156
870 Ga0207428_10002283
871 Ga0207428_10003472
872 Ga0207428_10007107
873 Ga0207428_10010303
874 Ga0207428_10016525
875 Ga0207428_10048267
876 Ga0207428_10749854
877 Ga0268265_10000135
878 Ga0268265_10025009
879 Ga0268265_10157492
880 Ga0268265_10214939
881 Ga0268264_10610179
882 Ga0307408_100035297
883 Ga0307408_100268856
884 Ga0307408_100420787
885 Ga0307405_10013421
886 Ga0307405_10257078
887 Ga0307405_10265323
888 Ga0307413_10006068
889 Ga0307410_10019350
890 Ga0307410_10118020
891 Ga0307410_10295867
892 Ga0307410_10501031
893 Ga0307406_10598512
894 Ga0307407_10003430
895 Ga0307407_10004644
896 Ga0307407_10009779
897 Ga0307412_10004084
898 Ga0307412_10117391
899 Ga0307409_100010618
900 Ga0307409_100348971
901 Ga0307416_100069342
902 Ga0307416_100234264
903 Ga0307414_10118708
904 Ga0307414_10616157
905 Ga0307411_10008874
906 Ga0307411_10028364
907 Ga0307411_10527781
908 Ga0307415_100012114
909 Ga0307415_100207199
910 Ga0373934_0106101
911 Ga0373956_0208925
912 Ga0373943_0397683
913 Ga0373946_0119054
914 Ga0373935_0035925
915 Ga0373937_0105036
916 Ga0373937_0184917
917 Ga0242420_036328
918 Ga0439450_014135
919 Ga0439435_0136127
920 Ga0439444_0035517
921 Ga0439460_0014251
922 Ga0451577_0551304
923 Ga0451576_0010856
924 Ga0451576_0033794
925 Ga0451576_0087694
926 Ga0451576_0535414
927 Ga0451576_0868478
928 Ga0495603_0015526
929 Ga0495629_0112232
930 Ga0495584_0014069
931 Ga0495594_0063371
932 Ga0495643_0005324
933 Ga0495644_0119007
934 Ga0495663_0027500
935 Ga0495609_0011821
936 Ga0495621_0007101
937 Ga0495621_0044557
938 Ga0495621_0081922
939 Ga0495659_0005360
940 Ga0495647_0157167
941 Ga0496109_0062244
942 Ga0501039_0096630
943 Ga0501040_0011742
944 Ga0501041_0129895
945 Ga0501042_0043503
946 Ga0501042_0257515
947 Ga0501043_0270119
948 Ga0501043_0392653
949 Ga0501046_0395040
950 Ga0501048_0075356
951 Ga0501067_0047038
952 Ga0501071_0199342
953 Ga0501073_0460830
954 Ga0501075_0095681
955 Ga0501076_0025420
956 Ga0501076_0050355
957 Ga0501077_0194536
958 Ga0501077_0238672
959 Ga0501081_0044739
960 Ga0501081_0380825
961 Ga0501045_0138765
962 Ga0501045_0206845
963 nmdc:mga05p37_100039_c1
964 nmdc:mga05p37_1854_c1
965 nmdc:mga05p37_221497_c1
966 nmdc:mga05p37_231266_c1
967 nmdc:mga05p37_245821_c1
968 nmdc:mga05p37_256239_c1
969 nmdc:mga05p37_278878_c1
970 nmdc:mga05p37_35283_c1
971 nmdc:mga05p37_43996_c1
972 nmdc:mga05p37_541244_c1
973 nmdc:mga05p37_76590_c1
974 nmdc:mga05p37_769768_c1
975 nmdc:mga09592_101627_c1
976 nmdc:mga09592_157585_c1
977 nmdc:mga09592_252_c1
978 nmdc:mga09592_26536_c1
979 nmdc:mga09592_27446_c1
980 nmdc:mga09592_302938_c1
981 nmdc:mga09592_333401_c1
982 nmdc:mga09592_419660_c1
983 nmdc:mga09592_4536_c1
984 nmdc:mga0qj67_307775_c1
985 nmdc:mga0qj67_8836_c1
986 nmdc:mga0qj67_9418_c1
987 nmdc:mga06r32_148444_c1
988 nmdc:mga06r32_168473_c1
989 nmdc:mga06r32_187318_c1
990 nmdc:mga06r32_48299_c1
991 nmdc:mga06r32_504_c1
992 nmdc:mga06r32_69967_c1
993 nmdc:mga06r32_793904_c1
994 nmdc:mga08y16_1568_c1
995 nmdc:mga08y16_167722_c1
996 nmdc:mga08y16_2643_c1
997 nmdc:mga08y16_6025_c1
998 nmdc:mga08y16_614_c1
999 nmdc:mga08y16_624036_c1
1000 nmdc:mga08y16_690655_c1
1001 nmdc:mga08y16_70963_c1
1002 nmdc:mga08y16_72077_c1
1003 nmdc:mga08y16_812_c1
1004 nmdc:mga0n895_112801_c1
1005 nmdc:mga0n895_1515_c1
1006 nmdc:mga0n895_380386_c1
1007 nmdc:mga0n895_38713_c1
1008 nmdc:mga0n895_985_c1
1009 nmdc:mga0rr50_100757_c1
1010 nmdc:mga0rr50_73072_c1
1011 nmdc:mga0a205_10401_c1
1012 nmdc:mga0a205_120835_c1
1013 nmdc:mga0a205_196100_c1
1014 nmdc:mga0a205_613_c1
1015 nmdc:mga0a205_64046_c1
1016 nmdc:mga0a205_742454_c1
1017 Ga0495601_0153898
1018 Ga0501084_0019155
1019 Ga0590071_000123
1020 Ga0590071_000480
1021 Ga0590074_000763
1022 Ga0590074_000955
1023 Ga0590075_004273
1024 Ga0590075_013282
1025 Ga0590077_000341
1026 Ga0530510_0009458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

25

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8334 1 197
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8288 5 197
1xdz-assembly1.cif.gz_A crystal structure of gram_positive bacillus subtilis glucose inhibited division protein b (gidb), structural genomics, mcsg 0.8201 1 197
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8076 57 196
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.7992 57 197
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8522 59 119 3.40.50.150
af_A0A1D6LW08_103_253_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8493 82 197 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8334 1 197 3.40.50.150
3g8bB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8256 9 197 3.40.50.150
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8253 3 197 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2G4JM36-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9714 1 197 GO:0005829
GO:0070043
AF-A0A2D9M476-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9538 1 205 GO:0005829
GO:0070043
AF-A0A3N5PIC8-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9495 1 197 GO:0005829
GO:0070043
AF-A0A2D9M476-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9403 1 205 GO:0005829
GO:0070043
AF-A0A2G4JM36-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.-) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9297 1 197 GO:0005829
GO:0070043

Map