F457591

General Info

Members Datasets Scaffolds Average Seq Length
513 321 1027 292

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10021154|Ga0307515_100211544
Length 315
Sequence MNAISPTPALPPAEATQITPLTVPGAASPAVLPVEATPPKLQRRRRGFGWGGLLGLAVIAFWALAALFGPSLMSHSISAMGGADVFAPMSSAHWLGTDYLGRDMLARVVDGARYTVGIAFVATLLASSIGTTLALLAAASGRWVDAALSRSLDTLTAIPSKMFALLMVAGFGSSVPMLVVAAAIIYVPGAYRIARSLAVNINAMDYVTVARVRGEGTPYVMLREILPNIVGPMLADLGLRFVYVVLLLAGLSFLGLGVQPPVADWGSLVRENIGALPDGGASVIAPALAIASLTIAVNLVIDNLPGRAARERGAR

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
150 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
151 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
193 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
194 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
195 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
196 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
197 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
198 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
199 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
200 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
201 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
202 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
209 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
275 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
276 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
277 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
278 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
279 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
292 2547132374 Acidovorax radicis N35 Isolate Unclassified
293 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
294 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
295 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
296 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
297 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
298 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
299 2643221658 Variovorax sp. Root411 Isolate Unclassified
300 2643221672 Variovorax sp. Root434 Isolate Unclassified
301 2643221717 Acidovorax sp. Root267 Isolate Unclassified
302 2818991446 Variovorax sp. 1180 Isolate Unclassified
303 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
304 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
305 2842677519 Variovorax sp. R-72495 Isolate Unclassified
306 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
307 2885198086 Variovorax sp. 679 Isolate Unclassified
308 2885211737 Variovorax sp. 553 Isolate Unclassified
309 2899924645 Variovorax sp. 369 Isolate Unclassified
310 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
311 2904456579 Variovorax sp. 2002 Isolate Unclassified
312 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
313 2928037797 Variovorax sp. 1126 Isolate Unclassified
314 2928044640 Variovorax sp. 1128 Isolate Unclassified
315 2928051484 Variovorax sp. 1133 Isolate Unclassified
316 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
317 2928070936 Variovorax gossypii 1167 Isolate Unclassified
318 2929520902 Variovorax beijingensis 502 Isolate Unclassified
319 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
320 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
321 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 0.39
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.39
Nodule 0.78
Rhizoplane 2.73
Rhizosphere 58.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10021154 3300028794 Bacteria 11550
2 JGI24739J22299_10041869 3300001989 Bacteria 1521
3 JGI25151J46595_10001430 3300003187 Bacteria 16253
4 rootH1_10003890 3300003316 Bacteria 2811
5 rootH1_10003890 3300003323 Bacteria 31835
6 rootH1_10004212 3300003316 Bacteria 4988
7 rootH1_10014318 3300003316 Bacteria 4742
8 rootL2_10000415 3300003322 Bacteria 223695
9 rootL2_10019742 3300003322 Bacteria 11664
10 rootH1_10023430 3300003323 Bacteria 10806
11 rootH1_10031315 3300003323 Bacteria 2808
12 rootH1_10031316 3300003323 Bacteria 2197
13 Ga0006562J51391_1024902 3300003578 Bacteria 2770
14 Ga0006562J51391_1024904 3300003578 Bacteria 1940
15 Ga0055535_1000136 3300003761 Bacteria 77549
16 Ga0055542_1000095 3300003762 Bacteria 119022
17 Ga0055537_1006203 3300003773 Bacteria 3074
18 Ga0055536_1005765 3300003781 Bacteria 5965
19 Ga0055536_1006382 3300003781 Bacteria 5522
20 Ga0055534_1005510 3300003784 Bacteria 3372
21 Ga0055528_1019892 3300003790 Bacteria 2200
22 Ga0055530_10000807 3300003791 Bacteria 26041
23 Ga0055530_10001091 3300003791 Bacteria 21331
24 Ga0055530_10007070 3300003791 Bacteria 4820
25 Ga0055540_1001328 3300003792 Bacteria 14923
26 Ga0055540_1031353 3300003792 Bacteria 1222
27 Ga0055531_10001703 3300003794 Bacteria 15767
28 Ga0065714_10083208 3300005288 Bacteria 2247
29 Ga0070676_10006380 3300005328 Bacteria 6302
30 Ga0070676_10015329 3300005328 Bacteria 4228
31 Ga0070670_100042075 3300005331 Bacteria 3926
32 Ga0070677_10046061 3300005333 Bacteria 1742
33 Ga0068869_100010836 3300005334 Bacteria 5961
34 Ga0068869_100049835 3300005334 Bacteria 3033
35 Ga0070666_10046895 3300005335 Bacteria 2900
36 Ga0070666_10146902 3300005335 Bacteria 1644
37 Ga0068868_100010681 3300005338 Bacteria 6654
38 Ga0070669_100013521 3300005353 Bacteria 5801
39 Ga0070675_100070374 3300005354 Bacteria 2899
40 Ga0070675_100076965 3300005354 Bacteria 2776
41 Ga0070671_100005117 3300005355 Bacteria 10443
42 Ga0070671_100112423 3300005355 Bacteria 2288
43 Ga0070674_100003286 3300005356 Bacteria 9046
44 Ga0070674_100198113 3300005356 Bacteria 1549
45 Ga0070659_100116749 3300005366 Bacteria 2158
46 Ga0070667_100004999 3300005367 Bacteria 11105
47 Ga0070667_100026171 3300005367 Bacteria 4852
48 Ga0070667_100133429 3300005367 Bacteria 2169
49 Ga0070667_100237067 3300005367 Bacteria 1628
50 Ga0070667_100505856 3300005367 Bacteria 1108
51 Ga0070678_100003546 3300005456 Bacteria 8707
52 Ga0070678_100084237 3300005456 Bacteria 2419
53 Ga0070678_100262652 3300005456 Bacteria 1453
54 Ga0070662_100008001 3300005457 Bacteria 6878
55 Ga0070662_100017744 3300005457 Bacteria 4802
56 Ga0070662_100030131 3300005457 Bacteria 3792
57 Ga0070662_100161651 3300005457 Bacteria 1752
58 Ga0070662_100165606 3300005457 Bacteria 1732
59 Ga0068867_100001097 3300005459 Bacteria 18480
60 Ga0068867_100047636 3300005459 Bacteria 3151
61 Ga0070706_100002750 3300005467 Bacteria 17598
62 Ga0070707_100016227 3300005468 Bacteria 6990
63 Ga0068853_100014990 3300005539 Bacteria 6368
64 Ga0068853_100504089 3300005539 Bacteria 1143
65 Ga0070672_100000385 3300005543 Bacteria 25616
66 Ga0070672_100011464 3300005543 Bacteria 6183
67 Ga0070665_100028675 3300005548 Bacteria 5605
68 Ga0070665_100109145 3300005548 Bacteria 2769
69 Ga0068855_100414717 3300005563 Bacteria 1474
70 Ga0070664_100189310 3300005564 Bacteria 1833
71 Ga0068857_100338087 3300005577 Bacteria 1393
72 Ga0068854_100148744 3300005578 Bacteria 1804
73 Ga0068854_100351470 3300005578 Bacteria 1207
74 Ga0068852_100106374 3300005616 Bacteria 2543
75 Ga0068852_100375988 3300005616 Bacteria 1393
76 Ga0068859_100633243 3300005617 Bacteria 1162
77 Ga0068866_10155701 3300005718 Bacteria 1328
78 Ga0068861_100074757 3300005719 Bacteria 2636
79 Ga0068870_10227423 3300005840 Bacteria 1145
80 Ga0068862_100099319 3300005844 Bacteria 2544
81 Ga0075365_10086978 3300006038 Bacteria 2124
82 Ga0075368_10031736 3300006042 Bacteria 2050
83 Ga0075368_10045075 3300006042 Bacteria 1742
84 Ga0075363_100051015 3300006048 Bacteria 2205
85 Ga0075363_100078129 3300006048 Bacteria 1807
86 Ga0075364_10031671 3300006051 Bacteria 3397
87 Ga0075432_10028524 3300006058 Bacteria 1925
88 Ga0075432_10032932 3300006058 Bacteria 1796
89 Ga0075362_10018612 3300006177 Bacteria 2877
90 Ga0075362_10031289 3300006177 Bacteria 2302
91 Ga0075362_10090153 3300006177 Bacteria 1422
92 Ga0075362_10096719 3300006177 Bacteria 1376
93 Ga0075367_10027357 3300006178 Bacteria 3244
94 Ga0075369_10002113 3300006186 Bacteria 7022
95 Ga0075369_10021716 3300006186 Bacteria 2641
96 Ga0075366_10000282 3300006195 Bacteria 22748
97 Ga0075366_10021865 3300006195 Bacteria 3719
98 Ga0075366_10023034 3300006195 Bacteria 3627
99 Ga0075366_10029170 3300006195 Bacteria 3241
100 Ga0097621_100290687 3300006237 Bacteria 1441
101 Ga0075370_10002778 3300006353 Bacteria 8202
102 Ga0075370_10020711 3300006353 Bacteria 3597
103 Ga0075370_10075847 3300006353 Bacteria 1928
104 Ga0075370_10084653 3300006353 Bacteria 1825
105 Ga0075370_10166314 3300006353 Bacteria 1295
106 Ga0075370_10170927 3300006353 Bacteria 1277
107 Ga0068871_100001360 3300006358 Bacteria 16388
108 Ga0075430_100035730 3300006846 Bacteria 4215
109 Ga0075429_100000391 3300006880 Bacteria 32193
110 Ga0068865_100190776 3300006881 Bacteria 1584
111 Ga0097620_100633292 3300006931 Bacteria 1162
112 Ga0099826_10000118 3300006948 Bacteria 36216
113 Ga0099826_10119078 3300006948 Bacteria 1559
114 Ga0105244_10002508 3300009036 Bacteria 13809
115 Ga0105244_10043492 3300009036 Bacteria 2317
116 Ga0105240_10009916 3300009093 Bacteria 13431
117 Ga0105240_10129440 3300009093 Bacteria 3029
118 Ga0111539_10136942 3300009094 Bacteria 2867
119 Ga0105245_10055780 3300009098 Bacteria 3550
120 Ga0105245_10123097 3300009098 Bacteria 2425
121 Ga0105245_10303453 3300009098 Bacteria 1567
122 Ga0105243_10002595 3300009148 Bacteria 15062
123 Ga0105243_10028283 3300009148 Bacteria 4303
124 Ga0105243_10083671 3300009148 Bacteria 2611
125 Ga0105243_10403569 3300009148 Bacteria 1270
126 Ga0105242_10017870 3300009176 Bacteria 5535
127 Ga0105237_10001808 3300009545 Bacteria 27606
128 Ga0105238_10025139 3300009551 Bacteria 6069
129 Ga0105238_10548520 3300009551 Bacteria 1160
130 Ga0105239_10007228 3300010375 Bacteria 12757
131 Ga0105239_10008675 3300010375 Bacteria 11512
132 Ga0105239_10192067 3300010375 Bacteria 2285
133 Ga0105246_10284539 3300011119 Bacteria 1328
134 Ga0157373_10052934 3300013100 Bacteria 2887
135 Ga0157371_10086328 3300013102 Bacteria 2222
136 Ga0157370_10008667 3300013104 Bacteria 10945
137 Ga0157370_10021814 3300013104 Bacteria 6379
138 Ga0157369_10001241 3300013105 Bacteria 31779
139 Ga0157374_10297421 3300013296 Bacteria 1596
140 Ga0157378_10042890 3300013297 Bacteria 4016
141 Ga0157378_10084844 3300013297 Bacteria 2868
142 Ga0163162_10018032 3300013306 Bacteria 6907
143 Ga0157372_10152783 3300013307 Bacteria 2665
144 Ga0157372_10353694 3300013307 Bacteria 1712
145 Ga0157375_10008195 3300013308 Bacteria 9150
146 Ga0157375_10036361 3300013308 Bacteria 4710
147 Ga0182008_10002215 3300014497 Bacteria 12318
148 Ga0182008_10002418 3300014497 Bacteria 11711
149 Ga0182008_10024907 3300014497 Bacteria 3043
150 Ga0157376_10458006 3300014969 Bacteria 1246
151 Ga0182006_1005201 3300015261 Bacteria 6236
152 Ga0182007_10000193 3300015262 Bacteria 41031
153 Ga0182007_10003952 3300015262 Bacteria 6848
154 Ga0163161_10000165 3300017792 Bacteria 60584
155 Ga0163161_10044860 3300017792 Bacteria 3186
156 Ga0209436_108738 3300025208 Bacteria 1988
157 Ga0209672_100385 3300025228 Bacteria 26891
158 Ga0209147_101099 3300025229 Bacteria 11279
159 Ga0209258_100069 3300025242 Bacteria 280496
160 Ga0207425_1000236 3300025245 Bacteria 42815
161 Ga0209148_1000076 3300025254 Bacteria 301449
162 Ga0209129_1000055 3300025258 Bacteria 261708
163 Ga0209129_1002422 3300025258 Bacteria 9168
164 Ga0209565_1000182 3300025263 Bacteria 77316
165 Ga0209565_1000275 3300025263 Bacteria 52195
166 Ga0209565_1006859 3300025263 Bacteria 3143
167 Ga0209673_1000106 3300025273 Bacteria 185426
168 Ga0209673_1000415 3300025273 Bacteria 74762
169 Ga0209673_1001604 3300025273 Bacteria 19856
170 Ga0209673_1013932 3300025273 Bacteria 3143
171 Ga0209675_1000058 3300025291 Bacteria 185426
172 Ga0209676_1000028 3300025292 Bacteria 559745
173 Ga0209676_1000216 3300025292 Bacteria 125759
174 Ga0209676_1000912 3300025292 Bacteria 36938
175 Ga0209025_1000174 3300025294 Bacteria 158915
176 Ga0209025_1003933 3300025294 Bacteria 13352
177 Ga0209564_1000220 3300025295 Bacteria 129579
178 Ga0209564_1000442 3300025295 Bacteria 71380
179 Ga0209758_1000042 3300025297 Bacteria 407145
180 Ga0209050_1000072 3300025298 Bacteria 293619
181 Ga0209050_1000133 3300025298 Bacteria 184688
182 Ga0209050_1000699 3300025298 Bacteria 49865
183 Ga0209256_1000117 3300025299 Bacteria 169435
184 Ga0209256_1000148 3300025299 Bacteria 147639
185 Ga0207426_1000055 3300025302 Bacteria 374450
186 Ga0207426_1000166 3300025302 Bacteria 169435
187 Ga0209051_1000015 3300025303 Bacteria 546798
188 Ga0209051_1000056 3300025303 Bacteria 271616
189 Ga0209051_1000126 3300025303 Bacteria 142582
190 Ga0209051_1000355 3300025303 Bacteria 67873
191 Ga0209257_1000037 3300025304 Bacteria 612915
192 Ga0209257_1000214 3300025304 Bacteria 136547
193 Ga0207656_10005634 3300025321 Bacteria 4443
194 Ga0207655_1034294 3300025728 Bacteria 2284
195 Ga0207682_10048026 3300025893 Bacteria 1759
196 Ga0207642_10045253 3300025899 Bacteria 1953
197 Ga0207680_10002712 3300025903 Bacteria 8271
198 Ga0207645_10002729 3300025907 Bacteria 13746
199 Ga0207645_10190223 3300025907 Bacteria 1349
200 Ga0207645_10250490 3300025907 Bacteria 1172
201 Ga0207643_10271995 3300025908 Bacteria 1049
202 Ga0207684_10002611 3300025910 Bacteria 18016
203 Ga0207695_10014701 3300025913 Bacteria 9255
204 Ga0207695_10143937 3300025913 Bacteria 2330
205 Ga0207695_10241623 3300025913 Bacteria 1707
206 Ga0207671_10005941 3300025914 Bacteria 11060
207 Ga0207671_10011317 3300025914 Bacteria 7271
208 Ga0207671_10069790 3300025914 Bacteria 2619
209 Ga0207649_10168442 3300025920 Bacteria 1524
210 Ga0207646_10394959 3300025922 Bacteria 1249
211 Ga0207681_10023385 3300025923 Bacteria 3952
212 Ga0207694_10018637 3300025924 Bacteria 5247
213 Ga0207694_10037157 3300025924 Bacteria 3738
214 Ga0207650_10123326 3300025925 Bacteria 2019
215 Ga0207644_10001695 3300025931 Bacteria 14215
216 Ga0207644_10087428 3300025931 Bacteria 2317
217 Ga0207690_10198788 3300025932 Bacteria 1521
218 Ga0207706_10005300 3300025933 Bacteria 12021
219 Ga0207706_10049062 3300025933 Bacteria 3732
220 Ga0207706_10058965 3300025933 Bacteria 3381
221 Ga0207706_10101250 3300025933 Bacteria 2534
222 Ga0207709_10000762 3300025935 Bacteria 25398
223 Ga0207709_10034199 3300025935 Bacteria 2993
224 Ga0207669_10004075 3300025937 Bacteria 6401
225 Ga0207669_10033374 3300025937 Bacteria 2904
226 Ga0207669_10072471 3300025937 Bacteria 2169
227 Ga0207704_10025320 3300025938 Bacteria 3235
228 Ga0207691_10002117 3300025940 Bacteria 19415
229 Ga0207691_10056892 3300025940 Bacteria 3561
230 Ga0207691_10105695 3300025940 Bacteria 2508
231 Ga0207689_10036374 3300025942 Bacteria 4088
232 Ga0207689_10064467 3300025942 Bacteria 3015
233 Ga0207689_10351088 3300025942 Bacteria 1226
234 Ga0207679_10031030 3300025945 Bacteria 3738
235 Ga0207651_10005747 3300025960 Bacteria 6405
236 Ga0207640_10087560 3300025981 Bacteria 2147
237 Ga0207640_10225876 3300025981 Bacteria 1437
238 Ga0207658_10023403 3300025986 Bacteria 4311
239 Ga0207658_10586484 3300025986 Bacteria 1000
240 Ga0207639_10010235 3300026041 Bacteria 6489
241 Ga0207639_10018865 3300026041 Bacteria 4909
242 Ga0207639_10096554 3300026041 Bacteria 2378
243 Ga0207678_10024716 3300026067 Bacteria 5245
244 Ga0207708_10029490 3300026075 Bacteria 4159
245 Ga0207648_10001677 3300026089 Bacteria 24259
246 Ga0207648_10010070 3300026089 Bacteria 8993
247 Ga0207648_10011635 3300026089 Bacteria 8282
248 Ga0207648_10171025 3300026089 Bacteria 1920
249 Ga0207648_10406261 3300026089 Bacteria 1235
250 Ga0207676_10344982 3300026095 Bacteria 1375
251 Ga0207674_10023050 3300026116 Bacteria 6676
252 Ga0207674_10064216 3300026116 Bacteria 3704
253 Ga0207683_10001175 3300026121 Bacteria 23700
254 Ga0207698_10046901 3300026142 Bacteria 3268
255 Ga0207698_10062576 3300026142 Bacteria 2907
256 Ga0207698_10107134 3300026142 Bacteria 2333
257 Ga0207698_10157878 3300026142 Bacteria 1979
258 Ga0207698_10275886 3300026142 Bacteria 1552
259 Ga0209973_1003911 3300027252 Bacteria 1498
260 Ga0209282_1000893 3300027666 Bacteria 15507
261 Ga0209813_10024316 3300027866 Bacteria 1731
262 Ga0207428_10297628 3300027907 Bacteria 1194
263 Ga0268266_10142866 3300028379 Bacteria 2149
264 Ga0307517_10017727 3300028786 Bacteria 9257
265 Ga0307515_10000424 3300028794 Bacteria 101910
266 Ga0307515_10001625 3300028794 Bacteria 50019
267 Ga0307515_10027502 3300028794 Bacteria 9721
268 Ga0307515_10029411 3300028794 Bacteria 9285
269 Ga0307515_10053185 3300028794 Bacteria 5982
270 Ga0307515_10063943 3300028794 Bacteria 5154
271 Ga0307515_10084863 3300028794 Bacteria 4060
272 Ga0307512_10062767 3300030522 Bacteria 2846
273 Ga0307512_10063559 3300030522 Bacteria 2820
274 Ga0307512_10188126 3300030522 Bacteria 1145
275 Ga0314311_1036622 3300030733 Bacteria 1363
276 Ga0316183_1111195 3300030742 Bacteria 2387
277 Ga0316182_1143789 3300030745 Bacteria 1622
278 Ga0307513_10001531 3300031456 Bacteria 33094
279 Ga0307513_10013499 3300031456 Bacteria 10023
280 Ga0307513_10028426 3300031456 Bacteria 6394
281 Ga0307513_10058728 3300031456 Bacteria 4086
282 Ga0307513_10061071 3300031456 Bacteria 3992
283 Ga0307509_10001361 3300031507 Bacteria 41386
284 Ga0307509_10003877 3300031507 Bacteria 22152
285 Ga0307509_10011254 3300031507 Bacteria 10856
286 Ga0307509_10171710 3300031507 Bacteria 2046
287 Ga0307408_100000939 3300031548 Bacteria 22685
288 Ga0307508_10011189 3300031616 Bacteria 8208
289 Ga0307508_10032811 3300031616 Bacteria 4688
290 Ga0307508_10204999 3300031616 Bacteria 1572
291 Ga0307514_10025905 3300031649 Bacteria 4743
292 Ga0307514_10043556 3300031649 Bacteria 3523
293 Ga0307516_10003867 3300031730 Bacteria 18921
294 Ga0307516_10025853 3300031730 Bacteria 5971
295 Ga0307516_10098504 3300031730 Bacteria 2742
296 Ga0307405_10032061 3300031731 Bacteria 3101
297 Ga0307518_10081695 3300031838 Bacteria 2333
298 Ga0307406_10000738 3300031901 Bacteria 18317
299 Ga0307406_10006122 3300031901 Bacteria 6611
300 Ga0307406_10119347 3300031901 Bacteria 1830
301 Ga0307412_10042638 3300031911 Bacteria 2950
302 Ga0307412_10454017 3300031911 Bacteria 1056
303 Ga0307416_100052505 3300032002 Bacteria 3264
304 Ga0307416_100691522 3300032002 Bacteria 1108
305 Ga0307411_10000452 3300032005 Bacteria 14127
306 Ga0307411_10012742 3300032005 Bacteria 4606
307 Ga0307411_10097028 3300032005 Bacteria 2073
308 Ga0307507_10040295 3300033179 Bacteria 4694
309 Ga0307507_10104515 3300033179 Bacteria 2350
310 Ga0307510_10098640 3300033180 Bacteria 2724
311 Ga0307510_10206075 3300033180 Bacteria 1494
312 Ga0373925_0009219 3300037068 Bacteria 7183
313 Ga0395899_0002873 3300037312 Bacteria 13843
314 Ga0395899_0100342 3300037312 Bacteria 2090
315 Ga0395900_0000569 3300037418 Bacteria 51069
316 Ga0395905_0006783 3300037471 Bacteria 11475
317 Ga0395905_0016418 3300037471 Bacteria 7037
318 Ga0395905_0039287 3300037471 Bacteria 4439
319 Ga0395905_0133536 3300037471 Bacteria 2334
320 Ga0395901_0000378 3300038443 Bacteria 53368
321 Ga0395901_0052071 3300038443 Bacteria 4255
322 Ga0439436_0017664 3300041404 Bacteria 2134
323 Ga0439447_010115 3300041407 Bacteria 2815
324 Ga0439461_0006998 3300041410 Bacteria 1983
325 Ga0439466_0004713 3300041411 Bacteria 5242
326 Ga0439466_0048340 3300041411 Bacteria 1399
327 Ga0439465_0000713 3300041413 Bacteria 10223
328 Ga0439465_0012978 3300041413 Bacteria 2604
329 Ga0451800_0175717 3300041459 Bacteria 1126
330 Ga0451853_3557593 3300041512 Bacteria 1877
331 Ga0439431_0001073 3300041997 Bacteria 5921
332 Ga0439431_0008323 3300041997 Bacteria 2330
333 Ga0439433_0001657 3300041999 Bacteria 4637
334 Ga0439442_003895 3300042002 Bacteria 2959
335 Ga0439442_004850 3300042002 Bacteria 2678
336 Ga0439442_016052 3300042002 Bacteria 1543
337 Ga0439445_0001873 3300042004 Bacteria 4632
338 Ga0439445_0005692 3300042004 Bacteria 2847
339 Ga0439448_0110389 3300042005 Bacteria 939
340 Ga0439432_018189 3300042006 Bacteria 2351
341 Ga0439449_0009465 3300042007 Bacteria 3694
342 Ga0439449_0030927 3300042007 Bacteria 1995
343 Ga0439450_037704 3300042008 Bacteria 1112
344 Ga0439452_003220 3300042010 Bacteria 5774
345 Ga0439452_006084 3300042010 Bacteria 3811
346 Ga0439454_007759 3300042011 Bacteria 1353
347 Ga0439455_0018192 3300042012 Bacteria 1646
348 Ga0439457_003147 3300042014 Bacteria 4555
349 Ga0439457_003203 3300042014 Bacteria 4502
350 Ga0439462_0003329 3300042015 Bacteria 3845
351 Ga0439462_0010897 3300042015 Bacteria 2308
352 Ga0450919_000104 3300042121 Bacteria 8491
353 Ga0450920_007056 3300042122 Bacteria 2030
354 Ga0450922_003686 3300042124 Bacteria 1408
355 Ga0450923_000920 3300042125 Bacteria 3629
356 Ga0450923_009801 3300042125 Bacteria 1684
357 Ga0450897_000032 3300042128 Bacteria 6299
358 Ga0450895_002968 3300042132 Bacteria 1290
359 Ga0450898_000702 3300042134 Bacteria 4051
360 Ga0450899_000336 3300042135 Bacteria 5172
361 Ga0450906_001370 3300042145 Bacteria 5316
362 Ga0450907_007476 3300042146 Bacteria 1823
363 Ga0450910_000479 3300042147 Bacteria 4748
364 Ga0450910_001490 3300042147 Bacteria 2960
365 Ga0439446_0001731 3300042156 Bacteria 5068
366 Ga0439458_0041490 3300042157 Bacteria 1118
367 Ga0450908_000605 3300042184 Bacteria 6875
368 Ga0439434_0007134 3300042435 Bacteria 3269
369 Ga0439434_0008678 3300042435 Bacteria 2985
370 Ga0439459_0011334 3300042438 Bacteria 1570
371 Ga0450918_000256 3300042531 Bacteria 12019
372 Ga0450918_000535 3300042531 Bacteria 8146
373 Ga0450893_0015020 3300042532 Bacteria 1303
374 Ga0451577_0000270 3300042876 Bacteria 101581
375 Ga0451577_0004473 3300042876 Bacteria 14756
376 Ga0466972_0028113 3300044658 Bacteria 2777
377 Ga0453684_0000868 3300044712 Bacteria 101512
378 Ga0453684_0010698 3300044712 Bacteria 15601
379 Ga0466971_0053094 3300044719 Bacteria 1826
380 Ga0451576_0214035 3300045051 Bacteria 2012
381 Ga0495627_011304 3300046453 Bacteria 3208
382 Ga0495592_0000418 3300046454 Bacteria 32266
383 Ga0495638_0069462 3300046460 Bacteria 2159
384 Ga0495582_0199725 3300046473 Bacteria 1142
385 Ga0495583_0097412 3300046506 Bacteria 1259
386 Ga0495610_0021976 3300046512 Bacteria 3499
387 Ga0495610_0052598 3300046512 Bacteria 1976
388 Ga0495616_0000220 3300046513 Bacteria 47083
389 Ga0495618_0164603 3300046514 Bacteria 1413
390 Ga0495620_0003900 3300046515 Bacteria 8508
391 Ga0495620_0021944 3300046515 Bacteria 3088
392 Ga0495620_0059930 3300046515 Bacteria 1589
393 Ga0495630_0064464 3300046517 Bacteria 2753
394 Ga0495631_0000512 3300046518 Bacteria 25952
395 Ga0495632_0023011 3300046519 Bacteria 3333
396 Ga0495637_0015742 3300046520 Bacteria 3544
397 Ga0495654_0029878 3300046530 Bacteria 2777
398 Ga0495609_0034785 3300046538 Bacteria 2282
399 Ga0495668_0167650 3300046616 Bacteria 1203
400 Ga0495625_0000052 3300046660 Bacteria 190656
401 Ga0495588_0019458 3300046674 Bacteria 3324
402 Ga0495624_0095023 3300046690 Bacteria 1837
403 Ga0495687_021154 3300047443 Bacteria 3155
404 Ga0495687_044313 3300047443 Bacteria 1934
405 Ga0495593_0042628 3300047673 Bacteria 2435
406 Ga0495614_0094787 3300048089 Bacteria 1301
407 Ga0495626_0095752 3300048091 Bacteria 1300
408 Ga0496100_0134940 3300048903 Bacteria 1743
409 Ga0496101_0116536 3300048904 Bacteria 2015
410 Ga0496102_0032427 3300048905 Bacteria 4691
411 Ga0496102_0691654 3300048905 Bacteria 943
412 Ga0496103_0137117 3300048906 Bacteria 1564
413 Ga0496105_0089725 3300048908 Bacteria 2539
414 Ga0496106_0006204 3300048909 Bacteria 8841
415 Ga0496108_0011171 3300048911 Bacteria 7295
416 Ga0496109_0287684 3300048912 Bacteria 1549
417 Ga0496113_0152184 3300048916 Bacteria 1826
418 Ga0496116_0018757 3300048919 Bacteria 5317
419 Ga0496117_0061917 3300048920 Bacteria 2568
420 Ga0496118_0010901 3300048921 Bacteria 8940
421 Ga0496118_0189605 3300048921 Bacteria 1231
422 Ga0496122_0152335 3300048925 Bacteria 1425
423 Ga0496123_0032119 3300048926 Bacteria 3808
424 Ga0496124_0006696 3300048927 Bacteria 12473
425 Ga0496124_0247535 3300048927 Bacteria 1321
426 Ga0496124_0257261 3300048927 Bacteria 1287
427 Ga0496125_0020311 3300048928 Bacteria 6235
428 Ga0496126_0103587 3300048929 Bacteria 2487
429 Ga0501298_000677 3300049521 Bacteria 4724
430 Ga0501047_0077598 3300049581 Bacteria 3195
431 Ga0501249_002002 3300049679 Bacteria 4144
432 Ga0501225_0004839 3300049705 Bacteria 3982
433 Ga0501262_000340 3300049759 Bacteria 5669
434 Ga0501262_001467 3300049759 Bacteria 2649
435 Ga0501035_0001776 3300049822 Bacteria 21781
436 Ga0501044_0023820 3300049823 Bacteria 6507
437 nmdc:mga03683_25055_c1 3300050489 Bacteria 2339
438 nmdc:mga03683_264_c1 3300050489 Bacteria 12697
439 nmdc:mga03683_53572_c1 3300050489 Bacteria 1689
440 nmdc:mga03683_69067_c1 3300050489 Bacteria 1507
441 nmdc:mga03n38_40105_c1 3300050490 Bacteria 2034
442 nmdc:mga00v17_111375_c1 3300050491 Bacteria 1737
443 nmdc:mga0yw44_129643_c1 3300050492 Bacteria 1631
444 nmdc:mga0k408_121639_c1 3300050493 Bacteria 1546
445 nmdc:mga0k408_5052_c1 3300050493 Bacteria 6987
446 nmdc:mga0k408_52679_c1 3300050493 Bacteria 2359
447 nmdc:mga0k408_6824_c1 3300050493 Bacteria 6088
448 nmdc:mga0k408_80394_c1 3300050493 Bacteria 1908
449 nmdc:mga0k408_91025_c1 3300050493 Bacteria 1792
450 nmdc:mga06z11_52835_c1 3300050494 Bacteria 2087
451 nmdc:mga07m45_10356_c1 3300050496 Bacteria 4868
452 nmdc:mga07m45_16151_c1 3300050496 Bacteria 3995
453 nmdc:mga07m45_17477_c1 3300050496 Bacteria 3853
454 nmdc:mga07m45_24957_c1 3300050496 Bacteria 3277
455 nmdc:mga07m45_35054_c1 3300050496 Bacteria 2791
456 nmdc:mga07m45_39174_c1 3300050496 Bacteria 2648
457 nmdc:mga07m45_8155_c1 3300050496 Bacteria 5372
458 nmdc:mga09592_728_c1 3300050508 Bacteria 25328
459 nmdc:mga08y16_237336_c1 3300050511 Bacteria 1885
460 Ga0500643_006387 3300053087 Bacteria 4931
461 Ga0500583_0114109 3300053092 Bacteria 1333
462 Ga0500651_0000123 3300053093 Bacteria 47588
463 Ga0500651_0178501 3300053093 Bacteria 1262
464 Ga0500571_000013 3300053110 Bacteria 71532
465 Ga0500593_001517 3300053117 Bacteria 8344
466 Ga0500597_069739 3300053120 Bacteria 1519
467 Ga0500607_000211 3300053121 Bacteria 53358
468 Ga0500626_032153 3300053128 Bacteria 2372
469 Ga0500655_005312 3300053133 Bacteria 2327
470 Ga0500658_0000332 3300053134 Bacteria 21039
471 Ga0500658_0006167 3300053134 Bacteria 4459
472 Ga0500658_0016790 3300053134 Bacteria 2729
473 Ga0500559_0000021 3300053136 Bacteria 129980
474 Ga0500564_101518 3300053138 Bacteria 1270
475 Ga0500568_0000409 3300053139 Bacteria 32815
476 Ga0500568_0025138 3300053139 Bacteria 2516
477 Ga0500574_054337 3300053141 Bacteria 1151
478 Ga0500616_0011574 3300053153 Bacteria 5200
479 Ga0500619_053276 3300053154 Bacteria 1315
480 Ga0500627_0001945 3300053158 Bacteria 5944
481 Ga0500634_0109903 3300053161 Bacteria 1363
482 Ga0500638_103784 3300053162 Bacteria 1322
483 Ga0466962_0042096 3300061719 Bacteria 2186
484 2513226795 2513020051 Bacteria 6053213
485 2548498082 2547132374 Bacteria 5530232
486 2599622274 2599185214 Bacteria 8209958
487 2599676983 2599185226 Bacteria 8233575
488 2599680319 2599185227 Bacteria 8246414
489 2599692335 2599185229 Bacteria 8216126
490 2643746302 2643221544 Bacteria 5886209
491 2644158807 2643221628 Bacteria 5745828
492 2644326449 2643221658 Bacteria 6064537
493 2644397049 2643221672 Bacteria 6322190
494 2644645965 2643221717 Bacteria 5676132
495 2819598244 2818991446 Bacteria 7757362
496 2831269718 2831265667 Bacteria 7184833
497 2838055264 2838054893 Bacteria 7451788
498 2842678387 2842677519 Bacteria 5615038
499 2885197075 2885192300 Bacteria 5882526
500 2885202426 2885198086 Bacteria 7212419
501 2885216079 2885211737 Bacteria 7212420
502 2899926356 2899924645 Bacteria 7487985
503 2904453704 2904449895 Bacteria 6927402
504 2904458989 2904456579 Bacteria 6819253
505 2919707888 2919704043 Bacteria 5560311
506 2928044382 2928037797 Bacteria 7273642
507 2928051223 2928044640 Bacteria 7271509
508 2928058471 2928051484 Bacteria 7773759
509 2928069116 2928064002 Bacteria 7419480
510 2928074173 2928070936 Bacteria 8062541
511 2929524244 2929520902 Bacteria 6765052
512 2945915872 2945909444 Bacteria 7065066
513 2945948507 2945945610 Bacteria 5951079
514 2945988694 2945984333 Bacteria 7358892
515 Ga0307515_10021154
516 JGI24739J22299_10041869
517 JGI25151J46595_10001430
518 rootH1_10003890
519 rootH1_10004212
520 rootH1_10014318
521 rootL2_10000415
522 rootL2_10019742
523 rootH1_10023430
524 rootH1_10031315
525 rootH1_10031316
526 Ga0006562J51391_1024902
527 Ga0006562J51391_1024904
528 Ga0055535_1000136
529 Ga0055542_1000095
530 Ga0055537_1006203
531 Ga0055536_1005765
532 Ga0055536_1006382
533 Ga0055534_1005510
534 Ga0055528_1019892
535 Ga0055530_10000807
536 Ga0055530_10001091
537 Ga0055530_10007070
538 Ga0055540_1001328
539 Ga0055540_1031353
540 Ga0055531_10001703
541 Ga0065714_10083208
542 Ga0070676_10006380
543 Ga0070676_10015329
544 Ga0070670_100042075
545 Ga0070677_10046061
546 Ga0068869_100010836
547 Ga0068869_100049835
548 Ga0070666_10046895
549 Ga0070666_10146902
550 Ga0068868_100010681
551 Ga0070669_100013521
552 Ga0070675_100070374
553 Ga0070675_100076965
554 Ga0070671_100005117
555 Ga0070671_100112423
556 Ga0070674_100003286
557 Ga0070674_100198113
558 Ga0070659_100116749
559 Ga0070667_100004999
560 Ga0070667_100026171
561 Ga0070667_100133429
562 Ga0070667_100237067
563 Ga0070667_100505856
564 Ga0070678_100003546
565 Ga0070678_100084237
566 Ga0070678_100262652
567 Ga0070662_100008001
568 Ga0070662_100017744
569 Ga0070662_100030131
570 Ga0070662_100161651
571 Ga0070662_100165606
572 Ga0068867_100001097
573 Ga0068867_100047636
574 Ga0070706_100002750
575 Ga0070707_100016227
576 Ga0068853_100014990
577 Ga0068853_100504089
578 Ga0070672_100000385
579 Ga0070672_100011464
580 Ga0070665_100028675
581 Ga0070665_100109145
582 Ga0068855_100414717
583 Ga0070664_100189310
584 Ga0068857_100338087
585 Ga0068854_100148744
586 Ga0068854_100351470
587 Ga0068852_100106374
588 Ga0068852_100375988
589 Ga0068859_100633243
590 Ga0068866_10155701
591 Ga0068861_100074757
592 Ga0068870_10227423
593 Ga0068862_100099319
594 Ga0075365_10086978
595 Ga0075368_10031736
596 Ga0075368_10045075
597 Ga0075363_100051015
598 Ga0075363_100078129
599 Ga0075364_10031671
600 Ga0075432_10028524
601 Ga0075432_10032932
602 Ga0075362_10018612
603 Ga0075362_10031289
604 Ga0075362_10090153
605 Ga0075362_10096719
606 Ga0075367_10027357
607 Ga0075369_10002113
608 Ga0075369_10021716
609 Ga0075366_10000282
610 Ga0075366_10021865
611 Ga0075366_10023034
612 Ga0075366_10029170
613 Ga0097621_100290687
614 Ga0075370_10002778
615 Ga0075370_10020711
616 Ga0075370_10075847
617 Ga0075370_10084653
618 Ga0075370_10166314
619 Ga0075370_10170927
620 Ga0068871_100001360
621 Ga0075430_100035730
622 Ga0075429_100000391
623 Ga0068865_100190776
624 Ga0097620_100633292
625 Ga0099826_10000118
626 Ga0099826_10119078
627 Ga0105244_10002508
628 Ga0105244_10043492
629 Ga0105240_10009916
630 Ga0105240_10129440
631 Ga0111539_10136942
632 Ga0105245_10055780
633 Ga0105245_10123097
634 Ga0105245_10303453
635 Ga0105243_10002595
636 Ga0105243_10028283
637 Ga0105243_10083671
638 Ga0105243_10403569
639 Ga0105242_10017870
640 Ga0105237_10001808
641 Ga0105238_10025139
642 Ga0105238_10548520
643 Ga0105239_10007228
644 Ga0105239_10008675
645 Ga0105239_10192067
646 Ga0105246_10284539
647 Ga0157373_10052934
648 Ga0157371_10086328
649 Ga0157370_10008667
650 Ga0157370_10021814
651 Ga0157369_10001241
652 Ga0157374_10297421
653 Ga0157378_10042890
654 Ga0157378_10084844
655 Ga0163162_10018032
656 Ga0157372_10152783
657 Ga0157372_10353694
658 Ga0157375_10008195
659 Ga0157375_10036361
660 Ga0182008_10002215
661 Ga0182008_10002418
662 Ga0182008_10024907
663 Ga0157376_10458006
664 Ga0182006_1005201
665 Ga0182007_10000193
666 Ga0182007_10003952
667 Ga0163161_10000165
668 Ga0163161_10044860
669 Ga0209436_108738
670 Ga0209672_100385
671 Ga0209147_101099
672 Ga0209258_100069
673 Ga0207425_1000236
674 Ga0209148_1000076
675 Ga0209129_1000055
676 Ga0209129_1002422
677 Ga0209565_1000182
678 Ga0209565_1000275
679 Ga0209565_1006859
680 Ga0209673_1000106
681 Ga0209673_1000415
682 Ga0209673_1001604
683 Ga0209673_1013932
684 Ga0209675_1000058
685 Ga0209676_1000028
686 Ga0209676_1000216
687 Ga0209676_1000912
688 Ga0209025_1000174
689 Ga0209025_1003933
690 Ga0209564_1000220
691 Ga0209564_1000442
692 Ga0209758_1000042
693 Ga0209050_1000072
694 Ga0209050_1000133
695 Ga0209050_1000699
696 Ga0209256_1000117
697 Ga0209256_1000148
698 Ga0207426_1000055
699 Ga0207426_1000166
700 Ga0209051_1000015
701 Ga0209051_1000056
702 Ga0209051_1000126
703 Ga0209051_1000355
704 Ga0209257_1000037
705 Ga0209257_1000214
706 Ga0207656_10005634
707 Ga0207655_1034294
708 Ga0207682_10048026
709 Ga0207642_10045253
710 Ga0207680_10002712
711 Ga0207645_10002729
712 Ga0207645_10190223
713 Ga0207645_10250490
714 Ga0207643_10271995
715 Ga0207684_10002611
716 Ga0207695_10014701
717 Ga0207695_10143937
718 Ga0207695_10241623
719 Ga0207671_10005941
720 Ga0207671_10011317
721 Ga0207671_10069790
722 Ga0207649_10168442
723 Ga0207646_10394959
724 Ga0207681_10023385
725 Ga0207694_10018637
726 Ga0207694_10037157
727 Ga0207650_10123326
728 Ga0207644_10001695
729 Ga0207644_10087428
730 Ga0207690_10198788
731 Ga0207706_10005300
732 Ga0207706_10049062
733 Ga0207706_10058965
734 Ga0207706_10101250
735 Ga0207709_10000762
736 Ga0207709_10034199
737 Ga0207669_10004075
738 Ga0207669_10033374
739 Ga0207669_10072471
740 Ga0207704_10025320
741 Ga0207691_10002117
742 Ga0207691_10056892
743 Ga0207691_10105695
744 Ga0207689_10036374
745 Ga0207689_10064467
746 Ga0207689_10351088
747 Ga0207679_10031030
748 Ga0207651_10005747
749 Ga0207640_10087560
750 Ga0207640_10225876
751 Ga0207658_10023403
752 Ga0207658_10586484
753 Ga0207639_10010235
754 Ga0207639_10018865
755 Ga0207639_10096554
756 Ga0207678_10024716
757 Ga0207708_10029490
758 Ga0207648_10001677
759 Ga0207648_10010070
760 Ga0207648_10011635
761 Ga0207648_10171025
762 Ga0207648_10406261
763 Ga0207676_10344982
764 Ga0207674_10023050
765 Ga0207674_10064216
766 Ga0207683_10001175
767 Ga0207698_10046901
768 Ga0207698_10062576
769 Ga0207698_10107134
770 Ga0207698_10157878
771 Ga0207698_10275886
772 Ga0209973_1003911
773 Ga0209282_1000893
774 Ga0209813_10024316
775 Ga0207428_10297628
776 Ga0268266_10142866
777 Ga0307517_10017727
778 Ga0307515_10000424
779 Ga0307515_10001625
780 Ga0307515_10027502
781 Ga0307515_10029411
782 Ga0307515_10053185
783 Ga0307515_10063943
784 Ga0307515_10084863
785 Ga0307512_10062767
786 Ga0307512_10063559
787 Ga0307512_10188126
788 Ga0314311_1036622
789 Ga0316183_1111195
790 Ga0316182_1143789
791 Ga0307513_10001531
792 Ga0307513_10013499
793 Ga0307513_10028426
794 Ga0307513_10058728
795 Ga0307513_10061071
796 Ga0307509_10001361
797 Ga0307509_10003877
798 Ga0307509_10011254
799 Ga0307509_10171710
800 Ga0307408_100000939
801 Ga0307508_10011189
802 Ga0307508_10032811
803 Ga0307508_10204999
804 Ga0307514_10025905
805 Ga0307514_10043556
806 Ga0307516_10003867
807 Ga0307516_10025853
808 Ga0307516_10098504
809 Ga0307405_10032061
810 Ga0307518_10081695
811 Ga0307406_10000738
812 Ga0307406_10006122
813 Ga0307406_10119347
814 Ga0307412_10042638
815 Ga0307412_10454017
816 Ga0307416_100052505
817 Ga0307416_100691522
818 Ga0307411_10000452
819 Ga0307411_10012742
820 Ga0307411_10097028
821 Ga0307507_10040295
822 Ga0307507_10104515
823 Ga0307510_10098640
824 Ga0307510_10206075
825 Ga0373925_0009219
826 Ga0395899_0002873
827 Ga0395899_0100342
828 Ga0395900_0000569
829 Ga0395905_0006783
830 Ga0395905_0016418
831 Ga0395905_0039287
832 Ga0395905_0133536
833 Ga0395901_0000378
834 Ga0395901_0052071
835 Ga0439436_0017664
836 Ga0439447_010115
837 Ga0439461_0006998
838 Ga0439466_0004713
839 Ga0439466_0048340
840 Ga0439465_0000713
841 Ga0439465_0012978
842 Ga0451800_0175717
843 Ga0451853_3557593
844 Ga0439431_0001073
845 Ga0439431_0008323
846 Ga0439433_0001657
847 Ga0439442_003895
848 Ga0439442_004850
849 Ga0439442_016052
850 Ga0439445_0001873
851 Ga0439445_0005692
852 Ga0439448_0110389
853 Ga0439432_018189
854 Ga0439449_0009465
855 Ga0439449_0030927
856 Ga0439450_037704
857 Ga0439452_003220
858 Ga0439452_006084
859 Ga0439454_007759
860 Ga0439455_0018192
861 Ga0439457_003147
862 Ga0439457_003203
863 Ga0439462_0003329
864 Ga0439462_0010897
865 Ga0450919_000104
866 Ga0450920_007056
867 Ga0450922_003686
868 Ga0450923_000920
869 Ga0450923_009801
870 Ga0450897_000032
871 Ga0450895_002968
872 Ga0450898_000702
873 Ga0450899_000336
874 Ga0450906_001370
875 Ga0450907_007476
876 Ga0450910_000479
877 Ga0450910_001490
878 Ga0439446_0001731
879 Ga0439458_0041490
880 Ga0450908_000605
881 Ga0439434_0007134
882 Ga0439434_0008678
883 Ga0439459_0011334
884 Ga0450918_000256
885 Ga0450918_000535
886 Ga0450893_0015020
887 Ga0451577_0000270
888 Ga0451577_0004473
889 Ga0466972_0028113
890 Ga0453684_0000868
891 Ga0453684_0010698
892 Ga0466971_0053094
893 Ga0451576_0214035
894 Ga0495627_011304
895 Ga0495592_0000418
896 Ga0495638_0069462
897 Ga0495582_0199725
898 Ga0495583_0097412
899 Ga0495610_0021976
900 Ga0495610_0052598
901 Ga0495616_0000220
902 Ga0495618_0164603
903 Ga0495620_0003900
904 Ga0495620_0021944
905 Ga0495620_0059930
906 Ga0495630_0064464
907 Ga0495631_0000512
908 Ga0495632_0023011
909 Ga0495637_0015742
910 Ga0495654_0029878
911 Ga0495609_0034785
912 Ga0495668_0167650
913 Ga0495625_0000052
914 Ga0495588_0019458
915 Ga0495624_0095023
916 Ga0495687_021154
917 Ga0495687_044313
918 Ga0495593_0042628
919 Ga0495614_0094787
920 Ga0495626_0095752
921 Ga0496100_0134940
922 Ga0496101_0116536
923 Ga0496102_0032427
924 Ga0496102_0691654
925 Ga0496103_0137117
926 Ga0496105_0089725
927 Ga0496106_0006204
928 Ga0496108_0011171
929 Ga0496109_0287684
930 Ga0496113_0152184
931 Ga0496116_0018757
932 Ga0496117_0061917
933 Ga0496118_0010901
934 Ga0496118_0189605
935 Ga0496122_0152335
936 Ga0496123_0032119
937 Ga0496124_0006696
938 Ga0496124_0247535
939 Ga0496124_0257261
940 Ga0496125_0020311
941 Ga0496126_0103587
942 Ga0501298_000677
943 Ga0501047_0077598
944 Ga0501249_002002
945 Ga0501225_0004839
946 Ga0501262_000340
947 Ga0501262_001467
948 Ga0501035_0001776
949 Ga0501044_0023820
950 nmdc:mga03683_25055_c1
951 nmdc:mga03683_264_c1
952 nmdc:mga03683_53572_c1
953 nmdc:mga03683_69067_c1
954 nmdc:mga03n38_40105_c1
955 nmdc:mga00v17_111375_c1
956 nmdc:mga0yw44_129643_c1
957 nmdc:mga0k408_121639_c1
958 nmdc:mga0k408_5052_c1
959 nmdc:mga0k408_52679_c1
960 nmdc:mga0k408_6824_c1
961 nmdc:mga0k408_80394_c1
962 nmdc:mga0k408_91025_c1
963 nmdc:mga06z11_52835_c1
964 nmdc:mga07m45_10356_c1
965 nmdc:mga07m45_16151_c1
966 nmdc:mga07m45_17477_c1
967 nmdc:mga07m45_24957_c1
968 nmdc:mga07m45_35054_c1
969 nmdc:mga07m45_39174_c1
970 nmdc:mga07m45_8155_c1
971 nmdc:mga09592_728_c1
972 nmdc:mga08y16_237336_c1
973 Ga0500643_006387
974 Ga0500583_0114109
975 Ga0500651_0000123
976 Ga0500651_0178501
977 Ga0500571_000013
978 Ga0500593_001517
979 Ga0500597_069739
980 Ga0500607_000211
981 Ga0500626_032153
982 Ga0500655_005312
983 Ga0500658_0000332
984 Ga0500658_0006167
985 Ga0500658_0016790
986 Ga0500559_0000021
987 Ga0500564_101518
988 Ga0500568_0000409
989 Ga0500568_0025138
990 Ga0500574_054337
991 Ga0500616_0011574
992 Ga0500619_053276
993 Ga0500627_0001945
994 Ga0500634_0109903
995 Ga0500638_103784
996 Ga0466962_0042096
997 2513226795
998 2548498082
999 2599622274
1000 2599676983
1001 2599680319
1002 2599692335
1003 2643746302
1004 2644158807
1005 2644326449
1006 2644397049
1007 2644645965
1008 2819598244
1009 2831269718
1010 2838055264
1011 2842678387
1012 2885197075
1013 2885202426
1014 2885216079
1015 2899926356
1016 2904453704
1017 2904458989
1018 2919707888
1019 2928044382
1020 2928051223
1021 2928058471
1022 2928069116
1023 2928074173
1024 2929524244
1025 2945915872
1026 2945948507
1027 2945988694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

130

310

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7052 87 284
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7028 86 287
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.652 87 284
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.638 86 291
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6149 86 291
ID Description Score Start End Superfamily
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7806 87 289 1.10.3720.10
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7714 86 289 1.10.3720.10
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7703 87 289 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7659 87 291 1.10.3720.10
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7659 86 292 1.10.3720.10
ID Description Score Start End GO Terms
AF-W1WJM0-F1-model_v4 Putative D,D-dipeptide transport system permease protein ddpC 0.9573 95 225 GO:0005886
GO:0071916
AF-W1WJM0-F1-model_v4 Putative D,D-dipeptide transport system permease protein ddpC 0.9233 95 225 GO:0005886
GO:0071916
AF-A0A529N9P4-F1-model_v4 ABC transporter permease 0.8877 78 228 GO:0005886
GO:0055085
AF-X0TP74-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8829 83 242 GO:0005886
GO:0055085
AF-X0TP74-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8628 83 242 GO:0005886
GO:0055085

Map