F457626

General Info

Members Datasets Scaffolds Average Seq Length
513 165 1026 185

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0174217|Ga0496102_0174217_1130_1741
Length 203
Sequence MSWPDRRARMPRPGAHHQCGVTLIELLTVLVVAAILFGVAVPALDGMLRAYRLRLAAADFLGAVELTRAQAIMLGQKVTLAPTEASLDWAGGWTVFIDRDGDRRAGAGDDILMRHPPLTARAGSGAAPEIAFTMNFGPQQGPPYLAYNSMGRGCSHLSSLTARFGTMTLAQGRQLRRIKINMLGRARLCDPGRDGAACAGAEG

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
23 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
49 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
53 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
67 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
70 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
165 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 4.68
Rhizosphere 91.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0174217 3300048905 Bacteria 2025
2 Ga0055525_1000029 3300003759 Bacteria 320663
3 Ga0055542_1010022 3300003762 Bacteria 1755
4 Ga0065165_1030190 3300005262 Bacteria 1728
5 Ga0065715_10104202 3300005293 Bacteria 2979
6 Ga0070658_10276678 3300005327 Bacteria 1428
7 Ga0070658_10358154 3300005327 Bacteria 1249
8 Ga0070658_10463525 3300005327 Bacteria 1092
9 Ga0070676_10548880 3300005328 Bacteria 827
10 Ga0070660_100037524 3300005339 Bacteria 3673
11 Ga0070660_100448960 3300005339 Bacteria 1070
12 Ga0070661_100357155 3300005344 Bacteria 1148
13 Ga0070659_100018818 3300005366 Bacteria 5215
14 Ga0070659_100245979 3300005366 Bacteria 1481
15 Ga0070663_100231344 3300005455 Bacteria 1456
16 Ga0070662_100720456 3300005457 Bacteria 845
17 Ga0068853_100198288 3300005539 Bacteria 1826
18 Ga0068855_100043387 3300005563 Bacteria 5327
19 Ga0068852_100342562 3300005616 Bacteria 1457
20 Ga0105244_10138128 3300009036 Bacteria 1173
21 Ga0105240_10309066 3300009093 Bacteria 1806
22 Ga0105241_10218284 3300009174 Bacteria 1601
23 Ga0105239_11588422 3300010375 Bacteria 756
24 Ga0105246_10417768 3300011119 Bacteria 1118
25 Ga0157372_10260111 3300013307 Bacteria 2015
26 Ga0157372_11826852 3300013307 Bacteria 699
27 Ga0182006_1200468 3300015261 Bacteria 661
28 Ga0209563_100003 3300025230 Bacteria 1932942
29 Ga0209677_104901 3300025253 Bacteria 3661
30 Ga0209148_1001889 3300025254 Bacteria 8650
31 Ga0207645_10328208 3300025907 Bacteria 1021
32 Ga0207705_10012999 3300025909 Bacteria 6008
33 Ga0207654_10025591 3300025911 Bacteria 3185
34 Ga0207695_10627669 3300025913 Bacteria 956
35 Ga0207657_10015936 3300025919 Bacteria 7261
36 Ga0207657_10038101 3300025919 Bacteria 4284
37 Ga0207687_10866246 3300025927 Bacteria 772
38 Ga0207690_10006176 3300025932 Bacteria 7094
39 Ga0207690_10088951 3300025932 Bacteria 2176
40 Ga0207706_10509745 3300025933 Bacteria 1038
41 Ga0207704_10061012 3300025938 Bacteria 2336
42 Ga0207679_11091286 3300025945 Bacteria 732
43 Ga0207667_10057598 3300025949 Bacteria 4079
44 Ga0207667_10728106 3300025949 Bacteria 993
45 Ga0207678_10069271 3300026067 Bacteria 3025
46 Ga0207678_10808854 3300026067 Bacteria 828
47 Ga0207702_10522691 3300026078 Bacteria 1159
48 Ga0207674_10061971 3300026116 Bacteria 3778
49 Ga0307408_100461232 3300031548 Bacteria 1104
50 Ga0395899_0005835 3300037312 Bacteria 9557
51 Ga0395899_0007020 3300037312 Bacteria 8715
52 Ga0395899_0008179 3300037312 Bacteria 8059
53 Ga0395899_0031948 3300037312 Bacteria 3955
54 Ga0395899_0241037 3300037312 Bacteria 1244
55 Ga0395900_0000123 3300037418 Bacteria 133326
56 Ga0395900_0009882 3300037418 Bacteria 9771
57 Ga0395900_0011795 3300037418 Bacteria 8937
58 Ga0395900_0031561 3300037418 Bacteria 5445
59 Ga0395900_0034498 3300037418 Bacteria 5210
60 Ga0395900_0042909 3300037418 Bacteria 4659
61 Ga0395900_0062249 3300037418 Bacteria 3835
62 Ga0395900_0144505 3300037418 Bacteria 2433
63 Ga0395900_0285522 3300037418 Bacteria 1641
64 Ga0395900_0321283 3300037418 Bacteria 1528
65 Ga0395900_0461742 3300037418 Bacteria 1224
66 Ga0395898_0104093 3300037466 Bacteria 2722
67 Ga0395898_0168857 3300037466 Bacteria 2091
68 Ga0395898_0307865 3300037466 Bacteria 1511
69 Ga0395898_0623047 3300037466 Bacteria 1021
70 Ga0395898_0725393 3300037466 Bacteria 935
71 Ga0395905_0182636 3300037471 Bacteria 1969
72 Ga0395905_0212853 3300037471 Bacteria 1810
73 Ga0395905_0217345 3300037471 Bacteria 1789
74 Ga0395905_0986290 3300037471 Bacteria 745
75 Ga0395901_0002451 3300038443 Bacteria 18811
76 Ga0395901_0006914 3300038443 Bacteria 11463
77 Ga0395901_0094640 3300038443 Bacteria 3130
78 Ga0395901_0148484 3300038443 Bacteria 2463
79 Ga0395901_0180568 3300038443 Bacteria 2213
80 Ga0395901_0332894 3300038443 Bacteria 1569
81 Ga0395901_0680787 3300038443 Bacteria 1028
82 Ga0395901_0891070 3300038443 Bacteria 872
83 Ga0439465_0121714 3300041413 Bacteria 915
84 Ga0439448_0022962 3300042005 Bacteria 1942
85 Ga0439450_034886 3300042008 Bacteria 1145
86 Ga0450906_009341 3300042145 Bacteria 1872
87 Ga0450906_034050 3300042145 Bacteria 900
88 Ga0439458_0010391 3300042157 Bacteria 2076
89 Ga0466969_0010987 3300044656 Bacteria 4794
90 Ga0466969_0068945 3300044656 Bacteria 1704
91 Ga0466981_0291823 3300044669 Bacteria 1029
92 Ga0466982_0369376 3300044672 Bacteria 789
93 Ga0466965_0080457 3300044683 Bacteria 1646
94 Ga0466966_0050504 3300044684 Bacteria 2645
95 Ga0466966_0051824 3300044684 Bacteria 2608
96 Ga0466966_0301742 3300044684 Bacteria 962
97 Ga0466961_0059694 3300044693 Bacteria 2425
98 Ga0466961_0128128 3300044693 Bacteria 1591
99 Ga0466963_0306882 3300044694 Bacteria 1116
100 Ga0466964_0000140 3300044706 Bacteria 19144
101 Ga0466971_0158970 3300044719 Bacteria 1057
102 Ga0466968_0312541 3300044735 Bacteria 758
103 Ga0466970_0169163 3300044765 Bacteria 1211
104 Ga0466970_0263381 3300044765 Bacteria 967
105 Ga0466970_0310150 3300044765 Bacteria 891
106 Ga0466957_0000524 3300044842 Bacteria 19295
107 Ga0466957_0003580 3300044842 Bacteria 8561
108 Ga0466957_0124266 3300044842 Bacteria 1647
109 Ga0466957_0543389 3300044842 Bacteria 809
110 Ga0466957_0805550 3300044842 Bacteria 667
111 Ga0466959_0081660 3300045049 Bacteria 2329
112 Ga0466959_0179083 3300045049 Bacteria 1483
113 Ga0466958_0224683 3300045836 Bacteria 1198
114 Ga0466967_0003778 3300045976 Bacteria 9998
115 Ga0466967_0008978 3300045976 Bacteria 7385
116 Ga0466967_0851216 3300045976 Bacteria 906
117 Ga0495617_000034 3300046452 Bacteria 147232
118 Ga0495627_000552 3300046453 Bacteria 30847
119 Ga0495627_021149 3300046453 Bacteria 2160
120 Ga0495627_026775 3300046453 Bacteria 1856
121 Ga0495603_0015488 3300046455 Bacteria 4615
122 Ga0495603_0040013 3300046455 Bacteria 2807
123 Ga0495603_0635986 3300046455 Bacteria 611
124 Ga0495590_0000027 3300046457 Bacteria 158323
125 Ga0495590_0008833 3300046457 Bacteria 3830
126 Ga0495590_0011897 3300046457 Bacteria 3242
127 Ga0495590_0059179 3300046457 Bacteria 1340
128 Ga0495590_0065100 3300046457 Bacteria 1276
129 Ga0495590_0167840 3300046457 Bacteria 799
130 Ga0495591_001073 3300046458 Bacteria 18284
131 Ga0495629_0015416 3300046459 Bacteria 5488
132 Ga0495629_0040475 3300046459 Bacteria 3278
133 Ga0495638_0456944 3300046460 Bacteria 651
134 Ga0495653_0017885 3300046463 Bacteria 5763
135 Ga0495653_0018518 3300046463 Bacteria 5652
136 Ga0495650_0001365 3300046471 Bacteria 24179
137 Ga0495650_0039556 3300046471 Bacteria 2034
138 Ga0495582_0009945 3300046473 Bacteria 5235
139 Ga0495582_0095095 3300046473 Bacteria 1664
140 Ga0495605_0000029 3300046474 Bacteria 215329
141 Ga0495605_0000046 3300046474 Bacteria 175985
142 Ga0495605_0006619 3300046474 Bacteria 6636
143 Ga0495605_0013787 3300046474 Bacteria 4442
144 Ga0495605_0016372 3300046474 Bacteria 4013
145 Ga0495605_0051777 3300046474 Bacteria 1998
146 Ga0495605_0065110 3300046474 Bacteria 1734
147 Ga0495605_0118189 3300046474 Bacteria 1204
148 Ga0495639_0240111 3300046475 Bacteria 894
149 Ga0495584_0001934 3300046491 Bacteria 11909
150 Ga0495584_0003426 3300046491 Bacteria 8737
151 Ga0495584_0008562 3300046491 Bacteria 5296
152 Ga0495584_0009079 3300046491 Bacteria 5135
153 Ga0495584_0022650 3300046491 Bacteria 3187
154 Ga0495584_0029944 3300046491 Bacteria 2758
155 Ga0495584_0040445 3300046491 Bacteria 2354
156 Ga0495584_0069333 3300046491 Bacteria 1772
157 Ga0495585_0001797 3300046492 Bacteria 16304
158 Ga0495585_0003192 3300046492 Bacteria 11202
159 Ga0495585_0007897 3300046492 Bacteria 6470
160 Ga0495585_0008239 3300046492 Bacteria 6328
161 Ga0495585_0013920 3300046492 Bacteria 4698
162 Ga0495585_0029454 3300046492 Bacteria 3125
163 Ga0495585_0070959 3300046492 Bacteria 1899
164 Ga0495585_0100692 3300046492 Bacteria 1545
165 Ga0495585_0100875 3300046492 Bacteria 1544
166 Ga0495585_0104835 3300046492 Bacteria 1508
167 Ga0495585_0126324 3300046492 Bacteria 1349
168 Ga0495594_0001162 3300046499 Bacteria 13768
169 Ga0495594_0011158 3300046499 Bacteria 4664
170 Ga0495594_0025783 3300046499 Bacteria 3160
171 Ga0495594_0030403 3300046499 Bacteria 2922
172 Ga0495594_0086224 3300046499 Bacteria 1757
173 Ga0495594_0168544 3300046499 Bacteria 1245
174 Ga0495596_0002495 3300046500 Bacteria 9857
175 Ga0495596_0005362 3300046500 Bacteria 6068
176 Ga0495596_0008165 3300046500 Bacteria 4674
177 Ga0495596_0010897 3300046500 Bacteria 3941
178 Ga0495596_0014144 3300046500 Bacteria 3366
179 Ga0495596_0016206 3300046500 Bacteria 3100
180 Ga0495607_0001630 3300046501 Bacteria 19431
181 Ga0495607_0002373 3300046501 Bacteria 15370
182 Ga0495607_0008322 3300046501 Bacteria 7092
183 Ga0495607_0014196 3300046501 Bacteria 5195
184 Ga0495607_0047054 3300046501 Bacteria 2529
185 Ga0495607_0049241 3300046501 Bacteria 2458
186 Ga0495607_0074034 3300046501 Bacteria 1891
187 Ga0495607_0119915 3300046501 Bacteria 1382
188 Ga0495583_0002093 3300046506 Bacteria 18002
189 Ga0495583_0002376 3300046506 Bacteria 16249
190 Ga0495583_0006915 3300046506 Bacteria 7292
191 Ga0495583_0009100 3300046506 Bacteria 5972
192 Ga0495583_0013415 3300046506 Bacteria 4570
193 Ga0495583_0022985 3300046506 Bacteria 3166
194 Ga0495583_0105027 3300046506 Bacteria 1202
195 Ga0495606_0003932 3300046507 Bacteria 15287
196 Ga0495606_0020302 3300046507 Bacteria 4903
197 Ga0495606_0093334 3300046507 Bacteria 1846
198 Ga0495606_0257205 3300046507 Bacteria 965
199 Ga0495610_0001480 3300046512 Bacteria 20696
200 Ga0495616_0000073 3300046513 Bacteria 85397
201 Ga0495616_0000347 3300046513 Bacteria 36641
202 Ga0495616_0000715 3300046513 Bacteria 24552
203 Ga0495616_0010990 3300046513 Bacteria 5208
204 Ga0495616_0019110 3300046513 Bacteria 3744
205 Ga0495616_0040647 3300046513 Bacteria 2374
206 Ga0495616_0075236 3300046513 Bacteria 1625
207 Ga0495616_0127053 3300046513 Bacteria 1171
208 Ga0495616_0159396 3300046513 Bacteria 1016
209 Ga0495616_0185450 3300046513 Bacteria 922
210 Ga0495631_0000008 3300046518 Bacteria 121368
211 Ga0495631_0002215 3300046518 Bacteria 11184
212 Ga0495631_0003481 3300046518 Bacteria 8610
213 Ga0495631_0004552 3300046518 Bacteria 7362
214 Ga0495631_0005131 3300046518 Bacteria 6901
215 Ga0495631_0009266 3300046518 Bacteria 4925
216 Ga0495631_0013242 3300046518 Bacteria 4008
217 Ga0495631_0018259 3300046518 Bacteria 3305
218 Ga0495631_0048365 3300046518 Bacteria 1865
219 Ga0495631_0049874 3300046518 Bacteria 1831
220 Ga0495631_0050492 3300046518 Bacteria 1819
221 Ga0495631_0113616 3300046518 Bacteria 1164
222 Ga0495631_0162061 3300046518 Bacteria 959
223 Ga0495632_0000027 3300046519 Bacteria 173785
224 Ga0495632_0000472 3300046519 Bacteria 38169
225 Ga0495632_0001501 3300046519 Bacteria 19295
226 Ga0495632_0004155 3300046519 Bacteria 9928
227 Ga0495632_0005941 3300046519 Bacteria 7953
228 Ga0495632_0013023 3300046519 Bacteria 4766
229 Ga0495632_0020738 3300046519 Bacteria 3552
230 Ga0495632_0072775 3300046519 Bacteria 1649
231 Ga0495637_0000012 3300046520 Bacteria 273124
232 Ga0495637_0015828 3300046520 Bacteria 3532
233 Ga0495643_0000200 3300046522 Bacteria 93353
234 Ga0495643_0000881 3300046522 Bacteria 31951
235 Ga0495643_0021585 3300046522 Bacteria 3692
236 Ga0495643_0035560 3300046522 Bacteria 2742
237 Ga0495643_0057503 3300046522 Bacteria 2072
238 Ga0495643_0071862 3300046522 Bacteria 1815
239 Ga0495643_0080414 3300046522 Bacteria 1696
240 Ga0495643_0105708 3300046522 Bacteria 1437
241 Ga0495643_0225070 3300046522 Bacteria 887
242 Ga0495644_0014798 3300046523 Bacteria 2987
243 Ga0495644_0019343 3300046523 Bacteria 2600
244 Ga0495644_0045597 3300046523 Bacteria 1648
245 Ga0495644_0069762 3300046523 Bacteria 1320
246 Ga0495644_0095416 3300046523 Bacteria 1123
247 Ga0495648_0000754 3300046524 Bacteria 34587
248 Ga0495648_0016899 3300046524 Bacteria 5242
249 Ga0495648_0026612 3300046524 Bacteria 3891
250 Ga0495648_0044002 3300046524 Bacteria 2791
251 Ga0495648_0055720 3300046524 Bacteria 2382
252 Ga0495648_0072783 3300046524 Bacteria 1987
253 Ga0495648_0123189 3300046524 Bacteria 1390
254 Ga0495666_0002202 3300046526 Bacteria 9716
255 Ga0495666_0233060 3300046526 Bacteria 841
256 Ga0495666_0268829 3300046526 Bacteria 774
257 Ga0495642_0000050 3300046528 Bacteria 71246
258 Ga0495642_0001146 3300046528 Bacteria 12180
259 Ga0495642_0006209 3300046528 Bacteria 4587
260 Ga0495642_0008169 3300046528 Bacteria 4003
261 Ga0495642_0017537 3300046528 Bacteria 2797
262 Ga0495642_0027152 3300046528 Bacteria 2276
263 Ga0495642_0028417 3300046528 Bacteria 2228
264 Ga0495642_0031446 3300046528 Bacteria 2128
265 Ga0495642_0039865 3300046528 Bacteria 1906
266 Ga0495642_0081767 3300046528 Bacteria 1361
267 Ga0495642_0110672 3300046528 Bacteria 1174
268 Ga0495642_0158571 3300046528 Bacteria 980
269 Ga0495642_0207698 3300046528 Bacteria 854
270 Ga0495654_0002753 3300046530 Bacteria 11090
271 Ga0495654_0035477 3300046530 Bacteria 2511
272 Ga0495654_0148323 3300046530 Bacteria 1039
273 Ga0495665_0010210 3300046531 Bacteria 5086
274 Ga0495665_0178674 3300046531 Bacteria 1103
275 Ga0495665_0373812 3300046531 Bacteria 725
276 Ga0495640_0133037 3300046533 Bacteria 1608
277 Ga0495640_0620268 3300046533 Bacteria 652
278 Ga0495586_0003961 3300046535 Bacteria 7949
279 Ga0495586_0041102 3300046535 Bacteria 2490
280 Ga0495586_0059362 3300046535 Bacteria 2079
281 Ga0495587_0036105 3300046536 Bacteria 2974
282 Ga0495609_0000022 3300046538 Bacteria 279488
283 Ga0495609_0001482 3300046538 Bacteria 15574
284 Ga0495609_0005440 3300046538 Bacteria 6690
285 Ga0495609_0007546 3300046538 Bacteria 5410
286 Ga0495609_0013081 3300046538 Bacteria 3926
287 Ga0495609_0058037 3300046538 Bacteria 1712
288 Ga0495597_0000064 3300046542 Bacteria 91446
289 Ga0495597_0001990 3300046542 Bacteria 13719
290 Ga0495597_0002295 3300046542 Bacteria 12418
291 Ga0495597_0006148 3300046542 Bacteria 6243
292 Ga0495597_0007073 3300046542 Bacteria 5744
293 Ga0495597_0021694 3300046542 Bacteria 2985
294 Ga0495597_0026407 3300046542 Bacteria 2667
295 Ga0495597_0083942 3300046542 Bacteria 1359
296 Ga0495597_0092797 3300046542 Bacteria 1280
297 Ga0495597_0102926 3300046542 Bacteria 1202
298 Ga0495597_0116415 3300046542 Bacteria 1117
299 Ga0495597_0275446 3300046542 Bacteria 656
300 Ga0495622_0013997 3300046557 Bacteria 3723
301 Ga0495622_0040446 3300046557 Bacteria 2170
302 Ga0495622_0072173 3300046557 Bacteria 1592
303 Ga0495622_0151689 3300046557 Bacteria 1048
304 Ga0495633_0002422 3300046558 Bacteria 13189
305 Ga0495633_0002576 3300046558 Bacteria 12696
306 Ga0495633_0013832 3300046558 Bacteria 4235
307 Ga0495633_0028186 3300046558 Bacteria 2739
308 Ga0495633_0036833 3300046558 Bacteria 2342
309 Ga0495633_0299415 3300046558 Bacteria 730
310 Ga0495656_0158485 3300046615 Bacteria 1098
311 Ga0495668_0000597 3300046616 Bacteria 43942
312 Ga0495668_0000852 3300046616 Bacteria 34433
313 Ga0495668_0001454 3300046616 Bacteria 22820
314 Ga0495668_0021159 3300046616 Bacteria 3733
315 Ga0495668_0077281 3300046616 Bacteria 1827
316 Ga0495668_0186313 3300046616 Bacteria 1137
317 Ga0495668_0221251 3300046616 Bacteria 1036
318 Ga0495634_0468726 3300046642 Bacteria 741
319 Ga0495611_0002443 3300046648 Bacteria 8488
320 Ga0495611_0015248 3300046648 Bacteria 3285
321 Ga0495611_0021595 3300046648 Bacteria 2781
322 Ga0495611_0023024 3300046648 Bacteria 2699
323 Ga0495611_0055607 3300046648 Bacteria 1790
324 Ga0495611_0064793 3300046648 Bacteria 1664
325 Ga0495625_0060740 3300046660 Bacteria 2677
326 Ga0495625_0109730 3300046660 Bacteria 1887
327 Ga0495625_0217236 3300046660 Bacteria 1254
328 Ga0495625_0328385 3300046660 Bacteria 972
329 Ga0495625_0345793 3300046660 Bacteria 941
330 Ga0495635_0005806 3300046663 Bacteria 8601
331 Ga0495635_0070059 3300046663 Bacteria 2404
332 Ga0495661_0000151 3300046665 Bacteria 81275
333 Ga0495661_0001661 3300046665 Bacteria 18119
334 Ga0495661_0001694 3300046665 Bacteria 17864
335 Ga0495661_0004085 3300046665 Bacteria 10628
336 Ga0495661_0011707 3300046665 Bacteria 5941
337 Ga0495661_0015905 3300046665 Bacteria 5008
338 Ga0495661_0020590 3300046665 Bacteria 4304
339 Ga0495661_0030013 3300046665 Bacteria 3464
340 Ga0495661_0037114 3300046665 Bacteria 3044
341 Ga0495661_0048283 3300046665 Bacteria 2587
342 Ga0495661_0098911 3300046665 Bacteria 1645
343 Ga0495661_0262707 3300046665 Bacteria 876
344 Ga0495661_0267824 3300046665 Bacteria 866
345 Ga0495661_0325405 3300046665 Bacteria 763
346 Ga0495588_0009961 3300046674 Bacteria 4406
347 Ga0495588_0037455 3300046674 Bacteria 2464
348 Ga0495588_0121854 3300046674 Bacteria 1374
349 Ga0495588_0155600 3300046674 Bacteria 1208
350 Ga0495623_0060865 3300046679 Bacteria 2369
351 Ga0495623_0112643 3300046679 Bacteria 1647
352 Ga0495669_0000018 3300046684 Bacteria 127866
353 Ga0495669_0025555 3300046684 Bacteria 2575
354 Ga0495669_0100133 3300046684 Bacteria 1345
355 Ga0495669_0270096 3300046684 Bacteria 817
356 Ga0495613_0041817 3300046689 Bacteria 3393
357 Ga0495613_0112765 3300046689 Bacteria 1958
358 Ga0495670_0003698 3300046691 Bacteria 7518
359 Ga0495670_0027120 3300046691 Bacteria 2836
360 Ga0495670_0038781 3300046691 Bacteria 2375
361 Ga0495670_0053693 3300046691 Bacteria 2018
362 Ga0495670_0077428 3300046691 Bacteria 1690
363 Ga0495670_0189469 3300046691 Bacteria 1087
364 Ga0495671_0000565 3300046692 Bacteria 27666
365 Ga0495671_0017286 3300046692 Bacteria 3840
366 Ga0495649_0002513 3300046694 Bacteria 12886
367 Ga0495649_0002969 3300046694 Bacteria 11680
368 Ga0495649_0075569 3300046694 Bacteria 1804
369 Ga0495649_0189485 3300046694 Bacteria 1071
370 Ga0495649_0441720 3300046694 Bacteria 650
371 Ga0495589_0000017 3300046794 Bacteria 206113
372 Ga0495589_0000428 3300046794 Bacteria 31186
373 Ga0495589_0004242 3300046794 Bacteria 7665
374 Ga0495589_0016985 3300046794 Bacteria 3736
375 Ga0495589_0048019 3300046794 Bacteria 2114
376 Ga0495589_0088983 3300046794 Bacteria 1499
377 Ga0495589_0114349 3300046794 Bacteria 1301
378 Ga0495600_0156569 3300046809 Bacteria 1474
379 Ga0495660_0000067 3300046810 Bacteria 119390
380 Ga0495660_0011378 3300046810 Bacteria 5166
381 Ga0495660_0014661 3300046810 Bacteria 4533
382 Ga0495660_0031414 3300046810 Bacteria 2985
383 Ga0495660_0031930 3300046810 Bacteria 2958
384 Ga0495660_0039518 3300046810 Bacteria 2620
385 Ga0495660_0053013 3300046810 Bacteria 2203
386 Ga0495660_0209152 3300046810 Bacteria 926
387 Ga0495581_0003349 3300047315 Bacteria 9200
388 Ga0495604_0022692 3300047317 Bacteria 5011
389 Ga0495604_0223073 3300047317 Bacteria 1297
390 Ga0495636_0022692 3300047318 Bacteria 2538
391 Ga0495636_0072938 3300047318 Bacteria 1468
392 Ga0495674_0020950 3300047319 Bacteria 6049
393 Ga0495672_0000138 3300047320 Bacteria 108026
394 Ga0495672_0000162 3300047320 Bacteria 96750
395 Ga0495672_0003671 3300047320 Bacteria 12966
396 Ga0495672_0005481 3300047320 Bacteria 10059
397 Ga0495672_0006294 3300047320 Bacteria 9236
398 Ga0495676_0000067 3300047321 Bacteria 80084
399 Ga0495676_0104872 3300047321 Bacteria 2085
400 Ga0495676_0235870 3300047321 Bacteria 1254
401 Ga0495680_0004379 3300047322 Bacteria 13524
402 Ga0495680_0149736 3300047322 Bacteria 1702
403 Ga0495683_0000335 3300047323 Bacteria 39334
404 Ga0495683_0014035 3300047323 Bacteria 4174
405 Ga0495683_0025283 3300047323 Bacteria 3045
406 Ga0495683_0035202 3300047323 Bacteria 2545
407 Ga0495683_0053696 3300047323 Bacteria 2009
408 Ga0495683_0125960 3300047323 Bacteria 1212
409 Ga0495683_0212871 3300047323 Bacteria 865
410 Ga0495687_000033 3300047443 Bacteria 263788
411 Ga0495687_000126 3300047443 Bacteria 117879
412 Ga0495687_002542 3300047443 Bacteria 14451
413 Ga0495687_007040 3300047443 Bacteria 6734
414 Ga0495687_056275 3300047443 Bacteria 1641
415 Ga0495675_0001065 3300047444 Bacteria 16669
416 Ga0495675_0064189 3300047444 Bacteria 2323
417 Ga0495675_0150057 3300047444 Bacteria 1440
418 Ga0495677_0000002 3300047445 Bacteria 346767
419 Ga0495677_0000586 3300047445 Bacteria 14934
420 Ga0495677_0002373 3300047445 Bacteria 7402
421 Ga0495677_0002655 3300047445 Bacteria 6987
422 Ga0495677_0006387 3300047445 Bacteria 4454
423 Ga0495677_0006549 3300047445 Bacteria 4399
424 Ga0495677_0012130 3300047445 Bacteria 3145
425 Ga0495677_0028278 3300047445 Bacteria 2035
426 Ga0495677_0038539 3300047445 Bacteria 1746
427 Ga0495677_0045420 3300047445 Bacteria 1611
428 Ga0495677_0053122 3300047445 Bacteria 1493
429 Ga0495679_005853 3300047446 Bacteria 5397
430 Ga0495679_008278 3300047446 Bacteria 4244
431 Ga0495679_023361 3300047446 Bacteria 2098
432 Ga0495679_111345 3300047446 Bacteria 753
433 Ga0495685_015566 3300047447 Bacteria 2596
434 Ga0495685_047935 3300047447 Bacteria 1452
435 Ga0495685_070495 3300047447 Bacteria 1171
436 Ga0495681_0000816 3300047470 Bacteria 23959
437 Ga0495681_0001822 3300047470 Bacteria 15671
438 Ga0495681_0009130 3300047470 Bacteria 6138
439 Ga0495681_0020692 3300047470 Bacteria 3563
440 Ga0495681_0042256 3300047470 Bacteria 2207
441 Ga0495681_0178980 3300047470 Bacteria 872
442 Ga0495686_0000272 3300047472 Bacteria 92063
443 Ga0495686_0007310 3300047472 Bacteria 8297
444 Ga0495686_0036798 3300047472 Bacteria 3140
445 Ga0495686_0062325 3300047472 Bacteria 2313
446 Ga0495686_0149431 3300047472 Bacteria 1373
447 Ga0495593_0003969 3300047673 Bacteria 8831
448 Ga0495593_0008273 3300047673 Bacteria 6054
449 Ga0495593_0229637 3300047673 Bacteria 931
450 Ga0495614_0001470 3300048089 Bacteria 10182
451 Ga0495614_0011014 3300048089 Bacteria 3979
452 Ga0495615_0014692 3300048090 Bacteria 1660
453 Ga0495615_0073152 3300048090 Bacteria 927
454 Ga0495626_0000097 3300048091 Bacteria 113925
455 Ga0495626_0002543 3300048091 Bacteria 12530
456 Ga0495626_0004795 3300048091 Bacteria 8161
457 Ga0495626_0006645 3300048091 Bacteria 6557
458 Ga0495626_0007449 3300048091 Bacteria 6092
459 Ga0495626_0008735 3300048091 Bacteria 5515
460 Ga0495626_0009893 3300048091 Bacteria 5125
461 Ga0495626_0009938 3300048091 Bacteria 5114
462 Ga0495626_0025598 3300048091 Bacteria 2884
463 Ga0495626_0034164 3300048091 Bacteria 2434
464 Ga0495626_0038317 3300048091 Bacteria 2273
465 Ga0495626_0050017 3300048091 Bacteria 1932
466 Ga0495626_0058016 3300048091 Bacteria 1770
467 Ga0495626_0062751 3300048091 Bacteria 1687
468 Ga0495626_0092021 3300048091 Bacteria 1332
469 Ga0496100_0209974 3300048903 Bacteria 1423
470 Ga0496101_0454598 3300048904 Bacteria 1010
471 Ga0496101_0506983 3300048904 Bacteria 953
472 Ga0496102_0000341 3300048905 Bacteria 57211
473 Ga0496102_0013731 3300048905 Bacteria 7023
474 Ga0496102_0035644 3300048905 Bacteria 4479
475 Ga0496102_0147853 3300048905 Bacteria 2206
476 Ga0496103_0046550 3300048906 Bacteria 2678
477 Ga0496103_0065142 3300048906 Bacteria 2272
478 Ga0496103_0276599 3300048906 Bacteria 1080
479 Ga0496104_0093261 3300048907 Bacteria 2880
480 Ga0496105_0078236 3300048908 Bacteria 2731
481 Ga0496105_0200710 3300048908 Bacteria 1628
482 Ga0496106_0015168 3300048909 Bacteria 5702
483 Ga0496107_0022354 3300048910 Bacteria 4469
484 Ga0496109_0238662 3300048912 Bacteria 1710
485 Ga0496110_0000024 3300048913 Bacteria 74685
486 Ga0496111_0082781 3300048914 Bacteria 2344
487 Ga0496112_0362930 3300048915 Bacteria 1390
488 Ga0496113_0009723 3300048916 Bacteria 6319
489 Ga0496113_0875514 3300048916 Bacteria 711
490 Ga0496114_0489520 3300048917 Bacteria 1088
491 Ga0496115_0159750 3300048918 Bacteria 1862
492 Ga0496121_0115001 3300048924 Bacteria 2044
493 Ga0496122_0000439 3300048925 Bacteria 87380
494 Ga0496122_0024714 3300048925 Bacteria 5248
495 Ga0496123_0000487 3300048926 Bacteria 69019
496 Ga0496123_0008326 3300048926 Bacteria 9545
497 Ga0496124_0005623 3300048927 Bacteria 14023
498 Ga0496124_0011001 3300048927 Bacteria 9089
499 Ga0496124_0017083 3300048927 Bacteria 6860
500 Ga0496124_0111837 3300048927 Bacteria 2197
501 Ga0496125_0006338 3300048928 Bacteria 12840
502 Ga0495678_000131 3300049459 Bacteria 88620
503 Ga0495678_000816 3300049459 Bacteria 27884
504 Ga0495678_001555 3300049459 Bacteria 17692
505 Ga0495678_021148 3300049459 Bacteria 2869
506 Ga0495682_0000221 3300049460 Bacteria 44509
507 Ga0495682_0007658 3300049460 Bacteria 4286
508 Ga0495682_0023258 3300049460 Bacteria 2313
509 Ga0501035_0005739 3300049822 Bacteria 11710
510 Ga0501044_0135216 3300049823 Bacteria 2457
511 Ga0466962_0124979 3300061719 Bacteria 1242
512 2809142506 2808606418 Bacteria 6724496
513 8047674808 8047673197 Bacteria 7395230
514 Ga0496102_0174217
515 Ga0055525_1000029
516 Ga0055542_1010022
517 Ga0065165_1030190
518 Ga0065715_10104202
519 Ga0070658_10276678
520 Ga0070658_10358154
521 Ga0070658_10463525
522 Ga0070676_10548880
523 Ga0070660_100037524
524 Ga0070660_100448960
525 Ga0070661_100357155
526 Ga0070659_100018818
527 Ga0070659_100245979
528 Ga0070663_100231344
529 Ga0070662_100720456
530 Ga0068853_100198288
531 Ga0068855_100043387
532 Ga0068852_100342562
533 Ga0105244_10138128
534 Ga0105240_10309066
535 Ga0105241_10218284
536 Ga0105239_11588422
537 Ga0105246_10417768
538 Ga0157372_10260111
539 Ga0157372_11826852
540 Ga0182006_1200468
541 Ga0209563_100003
542 Ga0209677_104901
543 Ga0209148_1001889
544 Ga0207645_10328208
545 Ga0207705_10012999
546 Ga0207654_10025591
547 Ga0207695_10627669
548 Ga0207657_10015936
549 Ga0207657_10038101
550 Ga0207687_10866246
551 Ga0207690_10006176
552 Ga0207690_10088951
553 Ga0207706_10509745
554 Ga0207704_10061012
555 Ga0207679_11091286
556 Ga0207667_10057598
557 Ga0207667_10728106
558 Ga0207678_10069271
559 Ga0207678_10808854
560 Ga0207702_10522691
561 Ga0207674_10061971
562 Ga0307408_100461232
563 Ga0395899_0005835
564 Ga0395899_0007020
565 Ga0395899_0008179
566 Ga0395899_0031948
567 Ga0395899_0241037
568 Ga0395900_0000123
569 Ga0395900_0009882
570 Ga0395900_0011795
571 Ga0395900_0031561
572 Ga0395900_0034498
573 Ga0395900_0042909
574 Ga0395900_0062249
575 Ga0395900_0144505
576 Ga0395900_0285522
577 Ga0395900_0321283
578 Ga0395900_0461742
579 Ga0395898_0104093
580 Ga0395898_0168857
581 Ga0395898_0307865
582 Ga0395898_0623047
583 Ga0395898_0725393
584 Ga0395905_0182636
585 Ga0395905_0212853
586 Ga0395905_0217345
587 Ga0395905_0986290
588 Ga0395901_0002451
589 Ga0395901_0006914
590 Ga0395901_0094640
591 Ga0395901_0148484
592 Ga0395901_0180568
593 Ga0395901_0332894
594 Ga0395901_0680787
595 Ga0395901_0891070
596 Ga0439465_0121714
597 Ga0439448_0022962
598 Ga0439450_034886
599 Ga0450906_009341
600 Ga0450906_034050
601 Ga0439458_0010391
602 Ga0466969_0010987
603 Ga0466969_0068945
604 Ga0466981_0291823
605 Ga0466982_0369376
606 Ga0466965_0080457
607 Ga0466966_0050504
608 Ga0466966_0051824
609 Ga0466966_0301742
610 Ga0466961_0059694
611 Ga0466961_0128128
612 Ga0466963_0306882
613 Ga0466964_0000140
614 Ga0466971_0158970
615 Ga0466968_0312541
616 Ga0466970_0169163
617 Ga0466970_0263381
618 Ga0466970_0310150
619 Ga0466957_0000524
620 Ga0466957_0003580
621 Ga0466957_0124266
622 Ga0466957_0543389
623 Ga0466957_0805550
624 Ga0466959_0081660
625 Ga0466959_0179083
626 Ga0466958_0224683
627 Ga0466967_0003778
628 Ga0466967_0008978
629 Ga0466967_0851216
630 Ga0495617_000034
631 Ga0495627_000552
632 Ga0495627_021149
633 Ga0495627_026775
634 Ga0495603_0015488
635 Ga0495603_0040013
636 Ga0495603_0635986
637 Ga0495590_0000027
638 Ga0495590_0008833
639 Ga0495590_0011897
640 Ga0495590_0059179
641 Ga0495590_0065100
642 Ga0495590_0167840
643 Ga0495591_001073
644 Ga0495629_0015416
645 Ga0495629_0040475
646 Ga0495638_0456944
647 Ga0495653_0017885
648 Ga0495653_0018518
649 Ga0495650_0001365
650 Ga0495650_0039556
651 Ga0495582_0009945
652 Ga0495582_0095095
653 Ga0495605_0000029
654 Ga0495605_0000046
655 Ga0495605_0006619
656 Ga0495605_0013787
657 Ga0495605_0016372
658 Ga0495605_0051777
659 Ga0495605_0065110
660 Ga0495605_0118189
661 Ga0495639_0240111
662 Ga0495584_0001934
663 Ga0495584_0003426
664 Ga0495584_0008562
665 Ga0495584_0009079
666 Ga0495584_0022650
667 Ga0495584_0029944
668 Ga0495584_0040445
669 Ga0495584_0069333
670 Ga0495585_0001797
671 Ga0495585_0003192
672 Ga0495585_0007897
673 Ga0495585_0008239
674 Ga0495585_0013920
675 Ga0495585_0029454
676 Ga0495585_0070959
677 Ga0495585_0100692
678 Ga0495585_0100875
679 Ga0495585_0104835
680 Ga0495585_0126324
681 Ga0495594_0001162
682 Ga0495594_0011158
683 Ga0495594_0025783
684 Ga0495594_0030403
685 Ga0495594_0086224
686 Ga0495594_0168544
687 Ga0495596_0002495
688 Ga0495596_0005362
689 Ga0495596_0008165
690 Ga0495596_0010897
691 Ga0495596_0014144
692 Ga0495596_0016206
693 Ga0495607_0001630
694 Ga0495607_0002373
695 Ga0495607_0008322
696 Ga0495607_0014196
697 Ga0495607_0047054
698 Ga0495607_0049241
699 Ga0495607_0074034
700 Ga0495607_0119915
701 Ga0495583_0002093
702 Ga0495583_0002376
703 Ga0495583_0006915
704 Ga0495583_0009100
705 Ga0495583_0013415
706 Ga0495583_0022985
707 Ga0495583_0105027
708 Ga0495606_0003932
709 Ga0495606_0020302
710 Ga0495606_0093334
711 Ga0495606_0257205
712 Ga0495610_0001480
713 Ga0495616_0000073
714 Ga0495616_0000347
715 Ga0495616_0000715
716 Ga0495616_0010990
717 Ga0495616_0019110
718 Ga0495616_0040647
719 Ga0495616_0075236
720 Ga0495616_0127053
721 Ga0495616_0159396
722 Ga0495616_0185450
723 Ga0495631_0000008
724 Ga0495631_0002215
725 Ga0495631_0003481
726 Ga0495631_0004552
727 Ga0495631_0005131
728 Ga0495631_0009266
729 Ga0495631_0013242
730 Ga0495631_0018259
731 Ga0495631_0048365
732 Ga0495631_0049874
733 Ga0495631_0050492
734 Ga0495631_0113616
735 Ga0495631_0162061
736 Ga0495632_0000027
737 Ga0495632_0000472
738 Ga0495632_0001501
739 Ga0495632_0004155
740 Ga0495632_0005941
741 Ga0495632_0013023
742 Ga0495632_0020738
743 Ga0495632_0072775
744 Ga0495637_0000012
745 Ga0495637_0015828
746 Ga0495643_0000200
747 Ga0495643_0000881
748 Ga0495643_0021585
749 Ga0495643_0035560
750 Ga0495643_0057503
751 Ga0495643_0071862
752 Ga0495643_0080414
753 Ga0495643_0105708
754 Ga0495643_0225070
755 Ga0495644_0014798
756 Ga0495644_0019343
757 Ga0495644_0045597
758 Ga0495644_0069762
759 Ga0495644_0095416
760 Ga0495648_0000754
761 Ga0495648_0016899
762 Ga0495648_0026612
763 Ga0495648_0044002
764 Ga0495648_0055720
765 Ga0495648_0072783
766 Ga0495648_0123189
767 Ga0495666_0002202
768 Ga0495666_0233060
769 Ga0495666_0268829
770 Ga0495642_0000050
771 Ga0495642_0001146
772 Ga0495642_0006209
773 Ga0495642_0008169
774 Ga0495642_0017537
775 Ga0495642_0027152
776 Ga0495642_0028417
777 Ga0495642_0031446
778 Ga0495642_0039865
779 Ga0495642_0081767
780 Ga0495642_0110672
781 Ga0495642_0158571
782 Ga0495642_0207698
783 Ga0495654_0002753
784 Ga0495654_0035477
785 Ga0495654_0148323
786 Ga0495665_0010210
787 Ga0495665_0178674
788 Ga0495665_0373812
789 Ga0495640_0133037
790 Ga0495640_0620268
791 Ga0495586_0003961
792 Ga0495586_0041102
793 Ga0495586_0059362
794 Ga0495587_0036105
795 Ga0495609_0000022
796 Ga0495609_0001482
797 Ga0495609_0005440
798 Ga0495609_0007546
799 Ga0495609_0013081
800 Ga0495609_0058037
801 Ga0495597_0000064
802 Ga0495597_0001990
803 Ga0495597_0002295
804 Ga0495597_0006148
805 Ga0495597_0007073
806 Ga0495597_0021694
807 Ga0495597_0026407
808 Ga0495597_0083942
809 Ga0495597_0092797
810 Ga0495597_0102926
811 Ga0495597_0116415
812 Ga0495597_0275446
813 Ga0495622_0013997
814 Ga0495622_0040446
815 Ga0495622_0072173
816 Ga0495622_0151689
817 Ga0495633_0002422
818 Ga0495633_0002576
819 Ga0495633_0013832
820 Ga0495633_0028186
821 Ga0495633_0036833
822 Ga0495633_0299415
823 Ga0495656_0158485
824 Ga0495668_0000597
825 Ga0495668_0000852
826 Ga0495668_0001454
827 Ga0495668_0021159
828 Ga0495668_0077281
829 Ga0495668_0186313
830 Ga0495668_0221251
831 Ga0495634_0468726
832 Ga0495611_0002443
833 Ga0495611_0015248
834 Ga0495611_0021595
835 Ga0495611_0023024
836 Ga0495611_0055607
837 Ga0495611_0064793
838 Ga0495625_0060740
839 Ga0495625_0109730
840 Ga0495625_0217236
841 Ga0495625_0328385
842 Ga0495625_0345793
843 Ga0495635_0005806
844 Ga0495635_0070059
845 Ga0495661_0000151
846 Ga0495661_0001661
847 Ga0495661_0001694
848 Ga0495661_0004085
849 Ga0495661_0011707
850 Ga0495661_0015905
851 Ga0495661_0020590
852 Ga0495661_0030013
853 Ga0495661_0037114
854 Ga0495661_0048283
855 Ga0495661_0098911
856 Ga0495661_0262707
857 Ga0495661_0267824
858 Ga0495661_0325405
859 Ga0495588_0009961
860 Ga0495588_0037455
861 Ga0495588_0121854
862 Ga0495588_0155600
863 Ga0495623_0060865
864 Ga0495623_0112643
865 Ga0495669_0000018
866 Ga0495669_0025555
867 Ga0495669_0100133
868 Ga0495669_0270096
869 Ga0495613_0041817
870 Ga0495613_0112765
871 Ga0495670_0003698
872 Ga0495670_0027120
873 Ga0495670_0038781
874 Ga0495670_0053693
875 Ga0495670_0077428
876 Ga0495670_0189469
877 Ga0495671_0000565
878 Ga0495671_0017286
879 Ga0495649_0002513
880 Ga0495649_0002969
881 Ga0495649_0075569
882 Ga0495649_0189485
883 Ga0495649_0441720
884 Ga0495589_0000017
885 Ga0495589_0000428
886 Ga0495589_0004242
887 Ga0495589_0016985
888 Ga0495589_0048019
889 Ga0495589_0088983
890 Ga0495589_0114349
891 Ga0495600_0156569
892 Ga0495660_0000067
893 Ga0495660_0011378
894 Ga0495660_0014661
895 Ga0495660_0031414
896 Ga0495660_0031930
897 Ga0495660_0039518
898 Ga0495660_0053013
899 Ga0495660_0209152
900 Ga0495581_0003349
901 Ga0495604_0022692
902 Ga0495604_0223073
903 Ga0495636_0022692
904 Ga0495636_0072938
905 Ga0495674_0020950
906 Ga0495672_0000138
907 Ga0495672_0000162
908 Ga0495672_0003671
909 Ga0495672_0005481
910 Ga0495672_0006294
911 Ga0495676_0000067
912 Ga0495676_0104872
913 Ga0495676_0235870
914 Ga0495680_0004379
915 Ga0495680_0149736
916 Ga0495683_0000335
917 Ga0495683_0014035
918 Ga0495683_0025283
919 Ga0495683_0035202
920 Ga0495683_0053696
921 Ga0495683_0125960
922 Ga0495683_0212871
923 Ga0495687_000033
924 Ga0495687_000126
925 Ga0495687_002542
926 Ga0495687_007040
927 Ga0495687_056275
928 Ga0495675_0001065
929 Ga0495675_0064189
930 Ga0495675_0150057
931 Ga0495677_0000002
932 Ga0495677_0000586
933 Ga0495677_0002373
934 Ga0495677_0002655
935 Ga0495677_0006387
936 Ga0495677_0006549
937 Ga0495677_0012130
938 Ga0495677_0028278
939 Ga0495677_0038539
940 Ga0495677_0045420
941 Ga0495677_0053122
942 Ga0495679_005853
943 Ga0495679_008278
944 Ga0495679_023361
945 Ga0495679_111345
946 Ga0495685_015566
947 Ga0495685_047935
948 Ga0495685_070495
949 Ga0495681_0000816
950 Ga0495681_0001822
951 Ga0495681_0009130
952 Ga0495681_0020692
953 Ga0495681_0042256
954 Ga0495681_0178980
955 Ga0495686_0000272
956 Ga0495686_0007310
957 Ga0495686_0036798
958 Ga0495686_0062325
959 Ga0495686_0149431
960 Ga0495593_0003969
961 Ga0495593_0008273
962 Ga0495593_0229637
963 Ga0495614_0001470
964 Ga0495614_0011014
965 Ga0495615_0014692
966 Ga0495615_0073152
967 Ga0495626_0000097
968 Ga0495626_0002543
969 Ga0495626_0004795
970 Ga0495626_0006645
971 Ga0495626_0007449
972 Ga0495626_0008735
973 Ga0495626_0009893
974 Ga0495626_0009938
975 Ga0495626_0025598
976 Ga0495626_0034164
977 Ga0495626_0038317
978 Ga0495626_0050017
979 Ga0495626_0058016
980 Ga0495626_0062751
981 Ga0495626_0092021
982 Ga0496100_0209974
983 Ga0496101_0454598
984 Ga0496101_0506983
985 Ga0496102_0000341
986 Ga0496102_0013731
987 Ga0496102_0035644
988 Ga0496102_0147853
989 Ga0496103_0046550
990 Ga0496103_0065142
991 Ga0496103_0276599
992 Ga0496104_0093261
993 Ga0496105_0078236
994 Ga0496105_0200710
995 Ga0496106_0015168
996 Ga0496107_0022354
997 Ga0496109_0238662
998 Ga0496110_0000024
999 Ga0496111_0082781
1000 Ga0496112_0362930
1001 Ga0496113_0009723
1002 Ga0496113_0875514
1003 Ga0496114_0489520
1004 Ga0496115_0159750
1005 Ga0496121_0115001
1006 Ga0496122_0000439
1007 Ga0496122_0024714
1008 Ga0496123_0000487
1009 Ga0496123_0008326
1010 Ga0496124_0005623
1011 Ga0496124_0011001
1012 Ga0496124_0017083
1013 Ga0496124_0111837
1014 Ga0496125_0006338
1015 Ga0495678_000131
1016 Ga0495678_000816
1017 Ga0495678_001555
1018 Ga0495678_021148
1019 Ga0495682_0000221
1020 Ga0495682_0007658
1021 Ga0495682_0023258
1022 Ga0501035_0005739
1023 Ga0501044_0135216
1024 Ga0466962_0124979
1025 2809142506
1026 8047674808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07963

N_methyl

Prokaryotic N-terminal methylation motif

15

41

0.93

PF12019

GspH

Type II transport protein GspH

56

184

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ipv-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa (strain: pao1) type iv minor pilin fimu in space group p65 0.8207 49 176
4ipu-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa (strain: pao1) type iv minor pilin fimu in space group p21 0.8134 46 176
4ipv-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa (strain: pao1) type iv minor pilin fimu in space group p65 0.7727 49 176
2qv8-assembly2.cif.gz_B structure of the minor pseudopilin epsh from the type 2 secretion system of vibrio cholerae 0.7494 48 175
4ipu-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa (strain: pao1) type iv minor pilin fimu in space group p21 0.7469 46 176
ID Description Score Start End Superfamily
4ipvB00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.8207 49 176 3.55.40.10
4ipvB00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.7727 49 176 3.55.40.10
2qv8B00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.755 48 175 3.55.40.10
2qv8B00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.7334 48 175 3.55.40.10
4dq9B00 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;minor pseudopilin epsh domain 0.6915 47 174 3.55.40.10
ID Description Score Start End GO Terms
AF-A0A520G6L4-F1-model_v4 Type-4 fimbrial pilin related signal peptide protein 0.9628 52 188 GO:0005886
GO:0015627
GO:0015628
AF-A0A7W8NTD3-F1-model_v4 Type II secretion system protein H (General secretion pathway protein H) 0.9385 13 181 GO:0005886
GO:0015627
GO:0015628
AF-A0A4Q3KFE4-F1-model_v4 deleted 0.9256 67 188
AF-A0A4R3US07-F1-model_v4 deleted 0.9198 49 186
AF-A0A4P6L6S5-F1-model_v4 Type II secretion system protein H (General secretion pathway protein H) 0.918 12 182 GO:0005886
GO:0015627
GO:0015628

Map