F457635

General Info

Members Datasets Scaffolds Average Seq Length
513 267 1026 218

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0130785|Ga0496125_0130785_551_1348
Length 256
Sequence MVATSPIDYLNPNLPAGLRSVVMPVVDATPAALKGYGCLVDDPEDCRIEIVQWPAQGSRPVDADTGAEGGTTEGVFVSAWHGDILYGSNDAVGGNYILAYGQAPELARTDHTNAPRRMLLWHANYHPDGGQLFFPQQREPFYVPLALPGDDVMPERFVCFRFDGRQGLYIHPNIWHEGVFALRGTQRFFDRQGAVHARVSVDFAREFGCLLARGADSGLVEYPGYGRRGPRDLDFGEAPLIIRNISQYFEINNERQ

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
259 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
260 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
261 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
262 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
263 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
264 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
265 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
266 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
267 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0.78
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0.19
Rhizoplane 5.65
Rhizosphere 88.69
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0130785 3300048928 Unclassified 1768
2 JGI25156J39149_1000677 3300002705 Bacteria 18399
3 JGI25156J39149_1000900 3300002705 Bacteria 14593
4 rootH2_10127174 3300003320 Bacteria 4107
5 rootL2_10101363 3300003322 Bacteria 5316
6 Ga0070658_10077072 3300005327 Bacteria 2735
7 Ga0070676_10001759 3300005328 Bacteria 11014
8 Ga0070676_10010810 3300005328 Bacteria 4952
9 Ga0070676_10046520 3300005328 Bacteria 2531
10 Ga0070683_100015869 3300005329 Bacteria 6626
11 Ga0070670_100004422 3300005331 Bacteria 11772
12 Ga0070670_100031832 3300005331 Bacteria 4542
13 Ga0070670_100122162 3300005331 Bacteria 2246
14 Ga0070677_10000541 3300005333 Bacteria 12912
15 Ga0068869_100000291 3300005334 Bacteria 26709
16 Ga0068869_100103064 3300005334 Bacteria 2161
17 Ga0068869_100338295 3300005334 Unclassified 1224
18 Ga0070666_10016213 3300005335 Bacteria 4765
19 Ga0068868_100013006 3300005338 Bacteria 6091
20 Ga0068868_100039568 3300005338 Bacteria 3664
21 Ga0068868_100107696 3300005338 Bacteria 2262
22 Ga0068868_100780612 3300005338 Bacteria 860
23 Ga0070687_100009699 3300005343 Bacteria 4135
24 Ga0070661_100026465 3300005344 Bacteria 4172
25 Ga0070661_100341109 3300005344 Unclassified 1174
26 Ga0070668_100026733 3300005347 Bacteria 4381
27 Ga0070668_100060997 3300005347 Bacteria 2921
28 Ga0070668_100272086 3300005347 Bacteria 1412
29 Ga0070668_100286733 3300005347 Bacteria 1377
30 Ga0070669_100027430 3300005353 Bacteria 4098
31 Ga0070675_100003135 3300005354 Bacteria 12502
32 Ga0070675_100008482 3300005354 Bacteria 7977
33 Ga0070675_100010746 3300005354 Bacteria 7160
34 Ga0070675_100018925 3300005354 Bacteria 5485
35 Ga0070671_100000272 3300005355 Bacteria 34885
36 Ga0070671_100013923 3300005355 Bacteria 6490
37 Ga0070671_100378279 3300005355 Unclassified 1210
38 Ga0070671_100403273 3300005355 Bacteria 1170
39 Ga0070674_100005791 3300005356 Bacteria 7175
40 Ga0070674_100067394 3300005356 Bacteria 2517
41 Ga0070674_100132443 3300005356 Bacteria 1860
42 Ga0070673_100005269 3300005364 Bacteria 8261
43 Ga0070673_100009603 3300005364 Bacteria 6504
44 Ga0070673_100220486 3300005364 Bacteria 1641
45 Ga0070673_100495487 3300005364 Bacteria 1104
46 Ga0070688_100033153 3300005365 Bacteria 3120
47 Ga0070688_100124980 3300005365 Bacteria 1728
48 Ga0070688_100323035 3300005365 Bacteria 1122
49 Ga0070659_100032855 3300005366 Bacteria 4029
50 Ga0070667_100004099 3300005367 Bacteria 12335
51 Ga0070667_100004363 3300005367 Bacteria 11936
52 Ga0070667_100047150 3300005367 Bacteria 3626
53 Ga0070667_100259020 3300005367 Bacteria 1557
54 Ga0070667_100269149 3300005367 Bacteria 1527
55 Ga0070667_100671294 3300005367 Bacteria 958
56 Ga0070710_10044432 3300005437 Bacteria 2465
57 Ga0070710_10601821 3300005437 Bacteria 765
58 Ga0070700_100359869 3300005441 Bacteria 1082
59 Ga0070700_100780245 3300005441 Bacteria 768
60 Ga0070663_100079231 3300005455 Bacteria 2410
61 Ga0070663_100087950 3300005455 Bacteria 2297
62 Ga0070678_100001322 3300005456 Bacteria 13159
63 Ga0070678_100342196 3300005456 Bacteria 1283
64 Ga0070662_100013420 3300005457 Bacteria 5452
65 Ga0070662_100131932 3300005457 Bacteria 1927
66 Ga0068867_100003031 3300005459 Bacteria 11844
67 Ga0068867_100005132 3300005459 Bacteria 9252
68 Ga0068867_100024352 3300005459 Bacteria 4336
69 Ga0068867_100101973 3300005459 Unclassified 2193
70 Ga0070707_100060262 3300005468 Bacteria 3640
71 Ga0070698_100040919 3300005471 Bacteria 4760
72 Ga0070699_100830021 3300005518 Bacteria 846
73 Ga0070679_100259614 3300005530 Bacteria 1693
74 Ga0068853_100014214 3300005539 Bacteria 6513
75 Ga0068853_100017518 3300005539 Bacteria 5911
76 Ga0068853_100040625 3300005539 Bacteria 3970
77 Ga0070672_100000362 3300005543 Bacteria 26134
78 Ga0070672_100008818 3300005543 Bacteria 6925
79 Ga0070672_100031672 3300005543 Bacteria 3983
80 Ga0070672_100169261 3300005543 Bacteria 1816
81 Ga0070695_100032399 3300005545 Bacteria 3267
82 Ga0070696_100222664 3300005546 Bacteria 1416
83 Ga0070693_100048972 3300005547 Bacteria 2409
84 Ga0070665_100001632 3300005548 Bacteria 25847
85 Ga0070665_100031841 3300005548 Bacteria 5308
86 Ga0070665_100365651 3300005548 Bacteria 1449
87 Ga0068855_100008017 3300005563 Bacteria 12759
88 Ga0068855_100016712 3300005563 Bacteria 8825
89 Ga0068855_100158962 3300005563 Bacteria 2566
90 Ga0068855_100252876 3300005563 Unclassified 1965
91 Ga0070664_100010290 3300005564 Bacteria 7590
92 Ga0070664_100227414 3300005564 Bacteria 1671
93 Ga0068857_100111955 3300005577 Bacteria 2454
94 Ga0068857_100248913 3300005577 Bacteria 1629
95 Ga0068854_100016198 3300005578 Bacteria 4963
96 Ga0068854_100052829 3300005578 Bacteria 2916
97 Ga0068854_100158306 3300005578 Bacteria 1752
98 Ga0068856_100131774 3300005614 Unclassified 2505
99 Ga0070702_100019938 3300005615 Bacteria 3506
100 Ga0070702_100180573 3300005615 Bacteria 1380
101 Ga0068852_100002156 3300005616 Bacteria 13522
102 Ga0068852_100037063 3300005616 Bacteria 4086
103 Ga0068852_100779289 3300005616 Bacteria 969
104 Ga0068859_100003826 3300005617 Bacteria 15371
105 Ga0068859_100206182 3300005617 Bacteria 2051
106 Ga0068859_100287232 3300005617 Bacteria 1738
107 Ga0068864_100001417 3300005618 Bacteria 19812
108 Ga0068864_100020549 3300005618 Bacteria 5525
109 Ga0068864_100109779 3300005618 Bacteria 2456
110 Ga0068866_10057798 3300005718 Bacteria 2000
111 Ga0068866_10074687 3300005718 Bacteria 1803
112 Ga0068861_100000440 3300005719 Bacteria 24159
113 Ga0068861_100003420 3300005719 Bacteria 10536
114 Ga0068861_100023817 3300005719 Bacteria 4421
115 Ga0068861_100033587 3300005719 Bacteria 3787
116 Ga0068851_10017770 3300005834 Bacteria 3421
117 Ga0068851_10018601 3300005834 Bacteria 3349
118 Ga0068851_10033895 3300005834 Bacteria 2546
119 Ga0068863_100000706 3300005841 Bacteria 33628
120 Ga0068863_100042551 3300005841 Bacteria 4316
121 Ga0068863_100063759 3300005841 Bacteria 3485
122 Ga0068863_100074060 3300005841 Bacteria 3221
123 Ga0068863_100126402 3300005841 Bacteria 2439
124 Ga0068863_101119572 3300005841 Bacteria 792
125 Ga0068858_100004090 3300005842 Bacteria 14370
126 Ga0068858_100041662 3300005842 Bacteria 4258
127 Ga0068858_100100519 3300005842 Bacteria 2697
128 Ga0068858_100179296 3300005842 Unclassified 2000
129 Ga0068860_100001246 3300005843 Bacteria 27761
130 Ga0068860_100020741 3300005843 Bacteria 6365
131 Ga0068862_100005052 3300005844 Bacteria 11098
132 Ga0068862_100012680 3300005844 Bacteria 6975
133 Ga0068862_100053347 3300005844 Unclassified 3461
134 Ga0097621_100001441 3300006237 Bacteria 16326
135 Ga0097621_100003222 3300006237 Bacteria 11214
136 Ga0097621_100019037 3300006237 Bacteria 5262
137 Ga0097621_100088408 3300006237 Bacteria 2589
138 Ga0068871_100023954 3300006358 Bacteria 4730
139 Ga0068871_100024673 3300006358 Bacteria 4665
140 Ga0068871_100569178 3300006358 Bacteria 1028
141 Ga0075428_100073933 3300006844 Bacteria 3723
142 Ga0075428_101375507 3300006844 Bacteria 741
143 Ga0075431_100489934 3300006847 Bacteria 1221
144 Ga0075434_100866802 3300006871 Bacteria 918
145 Ga0068865_100003716 3300006881 Bacteria 9165
146 Ga0097620_100003826 3300006931 Bacteria 15371
147 Ga0097620_100206212 3300006931 Bacteria 2051
148 Ga0097620_100287249 3300006931 Bacteria 1738
149 Ga0105240_10036433 3300009093 Bacteria 6328
150 Ga0105240_10582916 3300009093 Bacteria 1234
151 Ga0111539_11515402 3300009094 Bacteria 778
152 Ga0105245_10018106 3300009098 Bacteria 6157
153 Ga0105245_10569034 3300009098 Bacteria 1157
154 Ga0105247_10016563 3300009101 Bacteria 4419
155 Ga0114129_10049380 3300009147 Bacteria 5912
156 Ga0105243_10052275 3300009148 Bacteria 3235
157 Ga0105243_10670281 3300009148 Bacteria 1007
158 Ga0105241_10068232 3300009174 Unclassified 2755
159 Ga0105242_10909940 3300009176 Bacteria 880
160 Ga0105242_10978568 3300009176 Bacteria 852
161 Ga0105248_10004611 3300009177 Bacteria 15248
162 Ga0105248_10018222 3300009177 Bacteria 7755
163 Ga0105248_10026961 3300009177 Bacteria 6390
164 Ga0105248_10334419 3300009177 Bacteria 1705
165 Ga0105248_11093275 3300009177 Bacteria 901
166 Ga0105238_10024047 3300009551 Bacteria 6212
167 Ga0105249_10689582 3300009553 Bacteria 1081
168 Ga0105249_10751515 3300009553 Bacteria 1037
169 Ga0105246_10056699 3300011119 Bacteria 2709
170 Ga0157371_10039138 3300013102 Bacteria 3391
171 Ga0157370_10224379 3300013104 Bacteria 1740
172 Ga0157369_10093926 3300013105 Bacteria 3202
173 Ga0157369_10125355 3300013105 Bacteria 2723
174 Ga0157374_10012883 3300013296 Bacteria 7285
175 Ga0157374_10026386 3300013296 Bacteria 5227
176 Ga0157374_10586949 3300013296 Bacteria 1124
177 Ga0157378_10007388 3300013297 Bacteria 9598
178 Ga0163162_10000726 3300013306 Bacteria 30564
179 Ga0163162_10017334 3300013306 Bacteria 7047
180 Ga0163162_10026559 3300013306 Bacteria 5723
181 Ga0163162_10084225 3300013306 Bacteria 3254
182 Ga0163162_10085740 3300013306 Bacteria 3227
183 Ga0163162_10324263 3300013306 Bacteria 1673
184 Ga0157372_10119812 3300013307 Bacteria 3021
185 Ga0157372_10161923 3300013307 Unclassified 2586
186 Ga0157375_10004477 3300013308 Bacteria 12138
187 Ga0157375_10007078 3300013308 Bacteria 9796
188 Ga0157375_10044856 3300013308 Bacteria 4300
189 Ga0157375_10104620 3300013308 Bacteria 2920
190 Ga0157375_10169619 3300013308 Bacteria 2329
191 Ga0157375_11058001 3300013308 Bacteria 949
192 Ga0163163_10015144 3300014325 Bacteria 7120
193 Ga0163163_10168537 3300014325 Bacteria 2236
194 Ga0163163_10235237 3300014325 Bacteria 1881
195 Ga0157380_10019105 3300014326 Bacteria 5103
196 Ga0157380_10505234 3300014326 Bacteria 1175
197 Ga0157377_10005898 3300014745 Bacteria 5797
198 Ga0157377_10269858 3300014745 Bacteria 1111
199 Ga0157379_10000063 3300014968 Bacteria 68139
200 Ga0157379_10024233 3300014968 Bacteria 5386
201 Ga0157379_10060353 3300014968 Bacteria 3390
202 Ga0157379_10169293 3300014968 Bacteria 1972
203 Ga0157376_10021699 3300014969 Bacteria 4991
204 Ga0157376_10022000 3300014969 Bacteria 4961
205 Ga0157376_10074293 3300014969 Bacteria 2898
206 Ga0157376_10133434 3300014969 Bacteria 2219
207 Ga0157376_10176766 3300014969 Bacteria 1948
208 Ga0182007_10018020 3300015262 Bacteria 2568
209 Ga0163161_10015069 3300017792 Bacteria 5389
210 Ga0209759_1000531 3300025256 Bacteria 40446
211 Ga0209257_1032442 3300025304 Bacteria 1656
212 Ga0207697_10066727 3300025315 Unclassified 1504
213 Ga0207656_10003106 3300025321 Bacteria 5686
214 Ga0207656_10206865 3300025321 Bacteria 950
215 Ga0207682_10000198 3300025893 Bacteria 27362
216 Ga0207642_10285056 3300025899 Bacteria 952
217 Ga0207688_10013095 3300025901 Bacteria 4508
218 Ga0207688_10078623 3300025901 Bacteria 1880
219 Ga0207680_10015746 3300025903 Bacteria 3953
220 Ga0207680_10167667 3300025903 Bacteria 1477
221 Ga0207645_10000676 3300025907 Bacteria 28210
222 Ga0207645_10010422 3300025907 Bacteria 6379
223 Ga0207645_10037414 3300025907 Bacteria 3114
224 Ga0207643_10036091 3300025908 Bacteria 2772
225 Ga0207705_10124902 3300025909 Bacteria 1912
226 Ga0207684_10128907 3300025910 Bacteria 2171
227 Ga0207695_10557025 3300025913 Bacteria 1028
228 Ga0207662_10171123 3300025918 Bacteria 1393
229 Ga0207649_10002109 3300025920 Bacteria 11282
230 Ga0207649_10283934 3300025920 Unclassified 1204
231 Ga0207652_10334742 3300025921 Bacteria 1367
232 Ga0207681_10050470 3300025923 Unclassified 2815
233 Ga0207694_10016506 3300025924 Bacteria 5576
234 Ga0207650_10010077 3300025925 Bacteria 6475
235 Ga0207650_10048983 3300025925 Bacteria 3118
236 Ga0207650_10050104 3300025925 Bacteria 3086
237 Ga0207650_10135495 3300025925 Bacteria 1931
238 Ga0207650_10342266 3300025925 Bacteria 1228
239 Ga0207659_10006321 3300025926 Bacteria 7249
240 Ga0207659_10007030 3300025926 Bacteria 6912
241 Ga0207659_10022796 3300025926 Bacteria 4172
242 Ga0207687_10035095 3300025927 Bacteria 3410
243 Ga0207644_10009674 3300025931 Bacteria 6336
244 Ga0207644_10013318 3300025931 Bacteria 5481
245 Ga0207644_10163374 3300025931 Bacteria 1733
246 Ga0207644_10683311 3300025931 Bacteria 855
247 Ga0207690_10066250 3300025932 Unclassified 2473
248 Ga0207706_10009861 3300025933 Bacteria 8763
249 Ga0207706_10153231 3300025933 Bacteria 2027
250 Ga0207686_10027150 3300025934 Bacteria 3350
251 Ga0207709_10055753 3300025935 Bacteria 2443
252 Ga0207670_10313473 3300025936 Bacteria 1232
253 Ga0207669_10019213 3300025937 Bacteria 3552
254 Ga0207704_10000810 3300025938 Bacteria 13815
255 Ga0207704_10197152 3300025938 Bacteria 1470
256 Ga0207691_10000243 3300025940 Bacteria 53649
257 Ga0207691_10000390 3300025940 Bacteria 43939
258 Ga0207691_10000781 3300025940 Bacteria 31581
259 Ga0207691_10099086 3300025940 Bacteria 2603
260 Ga0207711_10003395 3300025941 Bacteria 13790
261 Ga0207711_10015432 3300025941 Bacteria 6339
262 Ga0207711_10086881 3300025941 Bacteria 2743
263 Ga0207711_10228953 3300025941 Bacteria 1702
264 Ga0207711_10257138 3300025941 Bacteria 1604
265 Ga0207689_10000116 3300025942 Bacteria 65521
266 Ga0207689_10000150 3300025942 Bacteria 60037
267 Ga0207689_10046401 3300025942 Bacteria 3591
268 Ga0207689_10173057 3300025942 Bacteria 1780
269 Ga0207679_10071128 3300025945 Bacteria 2623
270 Ga0207679_10147752 3300025945 Bacteria 1909
271 Ga0207679_10154909 3300025945 Bacteria 1870
272 Ga0207679_10414834 3300025945 Bacteria 1187
273 Ga0207667_10037308 3300025949 Bacteria 5196
274 Ga0207667_10062947 3300025949 Bacteria 3878
275 Ga0207651_10007004 3300025960 Bacteria 5972
276 Ga0207651_10105376 3300025960 Bacteria 2103
277 Ga0207651_10140719 3300025960 Bacteria 1863
278 Ga0207712_10615861 3300025961 Bacteria 940
279 Ga0207668_10004568 3300025972 Bacteria 8145
280 Ga0207668_10006199 3300025972 Bacteria 7060
281 Ga0207668_10038811 3300025972 Bacteria 3200
282 Ga0207668_10059886 3300025972 Bacteria 2670
283 Ga0207640_10046604 3300025981 Bacteria 2791
284 Ga0207640_10192661 3300025981 Bacteria 1538
285 Ga0207658_10001108 3300025986 Bacteria 21730
286 Ga0207658_10033317 3300025986 Bacteria 3674
287 Ga0207658_10036620 3300025986 Bacteria 3519
288 Ga0207658_10303504 3300025986 Unclassified 1376
289 Ga0207677_10003603 3300026023 Bacteria 8208
290 Ga0207677_10009086 3300026023 Bacteria 5580
291 Ga0207677_10013987 3300026023 Bacteria 4669
292 Ga0207677_10076457 3300026023 Bacteria 2384
293 Ga0207677_10494273 3300026023 Bacteria 1056
294 Ga0207677_10803050 3300026023 Unclassified 842
295 Ga0207703_10000526 3300026035 Bacteria 39358
296 Ga0207703_10015423 3300026035 Bacteria 5958
297 Ga0207703_10093131 3300026035 Bacteria 2537
298 Ga0207703_10102957 3300026035 Bacteria 2423
299 Ga0207639_10003407 3300026041 Bacteria 10693
300 Ga0207639_10638801 3300026041 Bacteria 984
301 Ga0207678_10066938 3300026067 Bacteria 3083
302 Ga0207708_10169793 3300026075 Bacteria 1727
303 Ga0207708_10828519 3300026075 Bacteria 798
304 Ga0207702_10032466 3300026078 Bacteria 4356
305 Ga0207641_10001558 3300026088 Bacteria 22463
306 Ga0207641_10003163 3300026088 Bacteria 14750
307 Ga0207641_10023373 3300026088 Bacteria 5093
308 Ga0207641_10035918 3300026088 Bacteria 4133
309 Ga0207641_10251035 3300026088 Bacteria 1652
310 Ga0207641_11100086 3300026088 Bacteria 793
311 Ga0207648_10002770 3300026089 Bacteria 18599
312 Ga0207648_10004731 3300026089 Bacteria 13902
313 Ga0207648_10009673 3300026089 Bacteria 9222
314 Ga0207648_10271285 3300026089 Bacteria 1516
315 Ga0207676_10056361 3300026095 Bacteria 3089
316 Ga0207676_10057772 3300026095 Bacteria 3057
317 Ga0207676_10635595 3300026095 Bacteria 1029
318 Ga0207674_10014415 3300026116 Bacteria 8731
319 Ga0207674_10707027 3300026116 Bacteria 973
320 Ga0207675_100000429 3300026118 Bacteria 40687
321 Ga0207675_100005107 3300026118 Bacteria 12631
322 Ga0207675_100009101 3300026118 Bacteria 9319
323 Ga0207675_100040884 3300026118 Bacteria 4331
324 Ga0207675_100320850 3300026118 Bacteria 1512
325 Ga0207683_10000308 3300026121 Bacteria 44216
326 Ga0207683_10064364 3300026121 Bacteria 3232
327 Ga0207683_10115918 3300026121 Bacteria 2401
328 Ga0207683_10341987 3300026121 Bacteria 1372
329 Ga0265354_1001459 3300028016 Bacteria 3370
330 Ga0268266_10030714 3300028379 Bacteria 4563
331 Ga0268266_10039966 3300028379 Bacteria 3997
332 Ga0268266_10130210 3300028379 Bacteria 2250
333 Ga0268266_10294610 3300028379 Bacteria 1512
334 Ga0268265_10009532 3300028380 Bacteria 6557
335 Ga0268265_10085939 3300028380 Bacteria 2498
336 Ga0268265_10711203 3300028380 Bacteria 971
337 Ga0268264_10002349 3300028381 Bacteria 16720
338 Ga0268264_10060220 3300028381 Bacteria 3182
339 Ga0268264_10607339 3300028381 Bacteria 1078
340 Ga0268264_10909599 3300028381 Bacteria 883
341 Ga0307515_10015620 3300028794 Bacteria 13972
342 Ga0265338_10026522 3300028800 Bacteria 5841
343 Ga0265770_1000981 3300030878 Bacteria 3949
344 Ga0265765_1001673 3300030879 Bacteria 2061
345 Ga0265771_1002561 3300031010 Bacteria 981
346 Ga0265760_10000397 3300031090 Bacteria 12182
347 Ga0265332_10034783 3300031238 Bacteria 2189
348 Ga0307513_10178377 3300031456 Bacteria 1991
349 Ga0307413_10110508 3300031824 Bacteria 1839
350 Ga0307410_10050664 3300031852 Bacteria 2794
351 Ga0307410_10153397 3300031852 Bacteria 1717
352 Ga0307407_10019990 3300031903 Bacteria 3420
353 Ga0307412_10017807 3300031911 Bacteria 4258
354 Ga0307412_10027299 3300031911 Bacteria 3558
355 Ga0307409_100014027 3300031995 Bacteria 5190
356 Ga0307409_100151064 3300031995 Bacteria 2016
357 Ga0307416_100050889 3300032002 Bacteria 3305
358 Ga0307414_10042221 3300032004 Bacteria 3097
359 Ga0307411_10034840 3300032005 Bacteria 3137
360 Ga0307411_10056068 3300032005 Bacteria 2595
361 Ga0307415_100000821 3300032126 Bacteria 14198
362 Ga0307415_100086205 3300032126 Bacteria 2259
363 Ga0307510_10003727 3300033180 Bacteria 17811
364 Ga0373928_0031119 3300035084 Bacteria 1183
365 Ga0373946_0084921 3300035171 Bacteria 1393
366 Ga0373955_0055915 3300035172 Unclassified 2163
367 Ga0373955_0074567 3300035172 Bacteria 1905
368 Ga0373924_0070392 3300035410 Unclassified 1475
369 Ga0373935_0243542 3300035692 Bacteria 1256
370 Ga0373927_0019824 3300035695 Bacteria 4409
371 Ga0373933_0335117 3300035724 Unclassified 982
372 Ga0373937_0055086 3300036401 Bacteria 3650
373 Ga0373937_0063706 3300036401 Bacteria 3391
374 Ga0373937_0190105 3300036401 Bacteria 1929
375 Ga0373925_0001366 3300037068 Bacteria 21279
376 Ga0373925_0088568 3300037068 Bacteria 2364
377 Ga0373925_0351715 3300037068 Bacteria 1196
378 Ga0436360_0025358 3300039438 Unclassified 1050
379 Ga0451793_1603956 3300041452 Bacteria 1062
380 Ga0439444_0026969 3300042437 Bacteria 1055
381 Ga0451577_0032356 3300042876 Bacteria 4712
382 Ga0453684_0131640 3300044712 Bacteria 3000
383 Ga0451576_0007359 3300045051 Bacteria 13193
384 Ga0495603_0064611 3300046455 Bacteria 2157
385 Ga0495590_0012361 3300046457 Bacteria 3168
386 Ga0495629_0009410 3300046459 Bacteria 7144
387 Ga0495638_0004496 3300046460 Bacteria 10565
388 Ga0495650_0003755 3300046471 Bacteria 10848
389 Ga0495650_0065619 3300046471 Bacteria 1439
390 Ga0495580_0014042 3300046472 Bacteria 6091
391 Ga0495580_0079315 3300046472 Bacteria 2289
392 Ga0495580_0220062 3300046472 Bacteria 1305
393 Ga0495582_0001281 3300046473 Bacteria 14121
394 Ga0495605_0001981 3300046474 Bacteria 12978
395 Ga0495605_0010848 3300046474 Bacteria 5089
396 Ga0495639_0100266 3300046475 Bacteria 1367
397 Ga0495664_0004970 3300046477 Bacteria 7278
398 Ga0495585_0060361 3300046492 Bacteria 2087
399 Ga0495596_0020326 3300046500 Bacteria 2720
400 Ga0495583_0009286 3300046506 Bacteria 5891
401 Ga0495583_0019655 3300046506 Bacteria 3519
402 Ga0495606_0019356 3300046507 Bacteria 5068
403 Ga0495608_0223040 3300046511 Unclassified 1182
404 Ga0495620_0005444 3300046515 Bacteria 7098
405 Ga0495628_0061422 3300046516 Unclassified 2947
406 Ga0495628_0157574 3300046516 Bacteria 1726
407 Ga0495630_0009318 3300046517 Bacteria 7060
408 Ga0495630_0016866 3300046517 Bacteria 5343
409 Ga0495648_0005414 3300046524 Bacteria 10612
410 Ga0495648_0030302 3300046524 Bacteria 3578
411 Ga0495666_0002292 3300046526 Bacteria 9530
412 Ga0495652_0031407 3300046529 Bacteria 4651
413 Ga0495665_0081216 3300046531 Bacteria 1704
414 Ga0495640_0031901 3300046533 Bacteria 3757
415 Ga0495586_0176531 3300046535 Bacteria 1208
416 Ga0495586_0211876 3300046535 Bacteria 1099
417 Ga0495621_0140635 3300046539 Bacteria 944
418 Ga0495645_0206321 3300046543 Bacteria 1329
419 Ga0495645_0281179 3300046543 Bacteria 1094
420 Ga0495611_0079210 3300046648 Bacteria 1509
421 Ga0495661_0010587 3300046665 Bacteria 6288
422 Ga0495661_0057239 3300046665 Bacteria 2328
423 Ga0495599_0393167 3300046678 Bacteria 826
424 Ga0495646_0006632 3300046680 Bacteria 7341
425 Ga0495647_0003593 3300046681 Bacteria 4973
426 Ga0495658_0073518 3300046683 Unclassified 1990
427 Ga0495669_0120411 3300046684 Bacteria 1229
428 Ga0495613_0018911 3300046689 Bacteria 5132
429 Ga0495613_0204240 3300046689 Bacteria 1392
430 Ga0495624_0024024 3300046690 Bacteria 4013
431 Ga0495624_0378900 3300046690 Bacteria 850
432 Ga0495671_0026946 3300046692 Bacteria 2973
433 Ga0495671_0054380 3300046692 Bacteria 1985
434 Ga0495649_0042600 3300046694 Bacteria 2479
435 Ga0495649_0086987 3300046694 Bacteria 1668
436 Ga0495589_0000653 3300046794 Bacteria 22725
437 Ga0495581_0009049 3300047315 Bacteria 5761
438 Ga0495674_0005397 3300047319 Bacteria 12273
439 Ga0495674_0012959 3300047319 Bacteria 7848
440 Ga0495674_0269771 3300047319 Bacteria 1396
441 Ga0495672_0015182 3300047320 Bacteria 5240
442 Ga0495676_0017782 3300047321 Bacteria 6278
443 Ga0495676_0099499 3300047321 Bacteria 2155
444 Ga0495680_0120705 3300047322 Bacteria 1935
445 Ga0495680_0237085 3300047322 Unclassified 1297
446 Ga0495683_0038495 3300047323 Bacteria 2421
447 Ga0495679_000329 3300047446 Bacteria 37430
448 Ga0495679_002075 3300047446 Bacteria 10577
449 Ga0495673_0032182 3300047469 Bacteria 2448
450 Ga0495684_0043895 3300047471 Bacteria 3423
451 Ga0495686_0029557 3300047472 Bacteria 3564
452 Ga0495593_0012293 3300047673 Bacteria 4892
453 Ga0495602_0019978 3300048088 Bacteria 6631
454 Ga0495602_0571419 3300048088 Bacteria 781
455 Ga0495614_0013816 3300048089 Bacteria 3541
456 Ga0495626_0012145 3300048091 Bacteria 4528
457 Ga0496100_0017426 3300048903 Bacteria 4240
458 Ga0496100_0163064 3300048903 Bacteria 1599
459 Ga0496101_0343502 3300048904 Bacteria 1172
460 Ga0496102_0001515 3300048905 Bacteria 20505
461 Ga0496102_0013896 3300048905 Bacteria 6985
462 Ga0496102_0177172 3300048905 Bacteria 2008
463 Ga0496102_0463309 3300048905 Bacteria 1188
464 Ga0496103_0005013 3300048906 Bacteria 7988
465 Ga0496103_0010820 3300048906 Bacteria 5401
466 Ga0496103_0249795 3300048906 Bacteria 1141
467 Ga0496105_0129231 3300048908 Bacteria 2083
468 Ga0496106_0006474 3300048909 Bacteria 8675
469 Ga0496106_0042963 3300048909 Bacteria 3390
470 Ga0496106_0086387 3300048909 Bacteria 2416
471 Ga0496107_0149023 3300048910 Bacteria 1730
472 Ga0496108_0003424 3300048911 Bacteria 12729
473 Ga0496108_0096120 3300048911 Bacteria 2523
474 Ga0496109_0014773 3300048912 Bacteria 6794
475 Ga0496110_0098438 3300048913 Bacteria 2621
476 Ga0496110_0661987 3300048913 Bacteria 944
477 Ga0496111_0041215 3300048914 Bacteria 3313
478 Ga0496112_0003968 3300048915 Bacteria 12392
479 Ga0496112_0336106 3300048915 Bacteria 1454
480 Ga0496112_0482527 3300048915 Bacteria 1176
481 Ga0496113_0032612 3300048916 Bacteria 3786
482 Ga0496113_0037515 3300048916 Bacteria 3557
483 Ga0496114_0135272 3300048917 Bacteria 2131
484 Ga0496115_0053489 3300048918 Bacteria 3240
485 Ga0496117_0007965 3300048920 Bacteria 10177
486 Ga0496117_0084668 3300048920 Bacteria 2067
487 Ga0496118_0002995 3300048921 Bacteria 21828
488 Ga0496118_0009616 3300048921 Bacteria 9731
489 Ga0496118_0027875 3300048921 Bacteria 4770
490 Ga0496121_0056289 3300048924 Bacteria 3267
491 Ga0496123_0101652 3300048926 Bacteria 1671
492 Ga0496126_0000274 3300048929 Bacteria 109129
493 Ga0496126_0007494 3300048929 Bacteria 11953
494 Ga0495678_030764 3300049459 Bacteria 2243
495 Ga0495682_0030673 3300049460 Bacteria 1988
496 Ga0501045_0173542 3300049824 Bacteria 1606
497 nmdc:mga05p37_176230_c1 3300050507 Bacteria 2605
498 nmdc:mga05p37_826590_c1 3300050507 Bacteria 1009
499 nmdc:mga09592_10055_c1 3300050508 Bacteria 7692
500 nmdc:mga09592_455576_c1 3300050508 Bacteria 1103
501 nmdc:mga06r32_6409_c1 3300050510 Bacteria 10571
502 nmdc:mga0n895_907753_c1 3300050512 Bacteria 866
503 Ga0495601_0055939 3300053077 Bacteria 2498
504 Ga0500586_031773 3300053145 Bacteria 1745
505 2501073844 2501025501 Bacteria 7768574
506 2501407684 2501025504 Bacteria 8008976
507 2511097558 2510917014 Bacteria 8296963
508 2511105495 2510917015 Bacteria 7950052
509 2516022580 2515154189 Bacteria 9629850
510 2883089773 2883087390 Bacteria 9532701
511 2900634969 2900634093 Bacteria 10263517
512 2921645390 2921643360 Bacteria 11448031
513 642621448 642555113 Bacteria 8214658
514 Ga0496125_0130785
515 JGI25156J39149_1000677
516 JGI25156J39149_1000900
517 rootH2_10127174
518 rootL2_10101363
519 Ga0070658_10077072
520 Ga0070676_10001759
521 Ga0070676_10010810
522 Ga0070676_10046520
523 Ga0070683_100015869
524 Ga0070670_100004422
525 Ga0070670_100031832
526 Ga0070670_100122162
527 Ga0070677_10000541
528 Ga0068869_100000291
529 Ga0068869_100103064
530 Ga0068869_100338295
531 Ga0070666_10016213
532 Ga0068868_100013006
533 Ga0068868_100039568
534 Ga0068868_100107696
535 Ga0068868_100780612
536 Ga0070687_100009699
537 Ga0070661_100026465
538 Ga0070661_100341109
539 Ga0070668_100026733
540 Ga0070668_100060997
541 Ga0070668_100272086
542 Ga0070668_100286733
543 Ga0070669_100027430
544 Ga0070675_100003135
545 Ga0070675_100008482
546 Ga0070675_100010746
547 Ga0070675_100018925
548 Ga0070671_100000272
549 Ga0070671_100013923
550 Ga0070671_100378279
551 Ga0070671_100403273
552 Ga0070674_100005791
553 Ga0070674_100067394
554 Ga0070674_100132443
555 Ga0070673_100005269
556 Ga0070673_100009603
557 Ga0070673_100220486
558 Ga0070673_100495487
559 Ga0070688_100033153
560 Ga0070688_100124980
561 Ga0070688_100323035
562 Ga0070659_100032855
563 Ga0070667_100004099
564 Ga0070667_100004363
565 Ga0070667_100047150
566 Ga0070667_100259020
567 Ga0070667_100269149
568 Ga0070667_100671294
569 Ga0070710_10044432
570 Ga0070710_10601821
571 Ga0070700_100359869
572 Ga0070700_100780245
573 Ga0070663_100079231
574 Ga0070663_100087950
575 Ga0070678_100001322
576 Ga0070678_100342196
577 Ga0070662_100013420
578 Ga0070662_100131932
579 Ga0068867_100003031
580 Ga0068867_100005132
581 Ga0068867_100024352
582 Ga0068867_100101973
583 Ga0070707_100060262
584 Ga0070698_100040919
585 Ga0070699_100830021
586 Ga0070679_100259614
587 Ga0068853_100014214
588 Ga0068853_100017518
589 Ga0068853_100040625
590 Ga0070672_100000362
591 Ga0070672_100008818
592 Ga0070672_100031672
593 Ga0070672_100169261
594 Ga0070695_100032399
595 Ga0070696_100222664
596 Ga0070693_100048972
597 Ga0070665_100001632
598 Ga0070665_100031841
599 Ga0070665_100365651
600 Ga0068855_100008017
601 Ga0068855_100016712
602 Ga0068855_100158962
603 Ga0068855_100252876
604 Ga0070664_100010290
605 Ga0070664_100227414
606 Ga0068857_100111955
607 Ga0068857_100248913
608 Ga0068854_100016198
609 Ga0068854_100052829
610 Ga0068854_100158306
611 Ga0068856_100131774
612 Ga0070702_100019938
613 Ga0070702_100180573
614 Ga0068852_100002156
615 Ga0068852_100037063
616 Ga0068852_100779289
617 Ga0068859_100003826
618 Ga0068859_100206182
619 Ga0068859_100287232
620 Ga0068864_100001417
621 Ga0068864_100020549
622 Ga0068864_100109779
623 Ga0068866_10057798
624 Ga0068866_10074687
625 Ga0068861_100000440
626 Ga0068861_100003420
627 Ga0068861_100023817
628 Ga0068861_100033587
629 Ga0068851_10017770
630 Ga0068851_10018601
631 Ga0068851_10033895
632 Ga0068863_100000706
633 Ga0068863_100042551
634 Ga0068863_100063759
635 Ga0068863_100074060
636 Ga0068863_100126402
637 Ga0068863_101119572
638 Ga0068858_100004090
639 Ga0068858_100041662
640 Ga0068858_100100519
641 Ga0068858_100179296
642 Ga0068860_100001246
643 Ga0068860_100020741
644 Ga0068862_100005052
645 Ga0068862_100012680
646 Ga0068862_100053347
647 Ga0097621_100001441
648 Ga0097621_100003222
649 Ga0097621_100019037
650 Ga0097621_100088408
651 Ga0068871_100023954
652 Ga0068871_100024673
653 Ga0068871_100569178
654 Ga0075428_100073933
655 Ga0075428_101375507
656 Ga0075431_100489934
657 Ga0075434_100866802
658 Ga0068865_100003716
659 Ga0097620_100003826
660 Ga0097620_100206212
661 Ga0097620_100287249
662 Ga0105240_10036433
663 Ga0105240_10582916
664 Ga0111539_11515402
665 Ga0105245_10018106
666 Ga0105245_10569034
667 Ga0105247_10016563
668 Ga0114129_10049380
669 Ga0105243_10052275
670 Ga0105243_10670281
671 Ga0105241_10068232
672 Ga0105242_10909940
673 Ga0105242_10978568
674 Ga0105248_10004611
675 Ga0105248_10018222
676 Ga0105248_10026961
677 Ga0105248_10334419
678 Ga0105248_11093275
679 Ga0105238_10024047
680 Ga0105249_10689582
681 Ga0105249_10751515
682 Ga0105246_10056699
683 Ga0157371_10039138
684 Ga0157370_10224379
685 Ga0157369_10093926
686 Ga0157369_10125355
687 Ga0157374_10012883
688 Ga0157374_10026386
689 Ga0157374_10586949
690 Ga0157378_10007388
691 Ga0163162_10000726
692 Ga0163162_10017334
693 Ga0163162_10026559
694 Ga0163162_10084225
695 Ga0163162_10085740
696 Ga0163162_10324263
697 Ga0157372_10119812
698 Ga0157372_10161923
699 Ga0157375_10004477
700 Ga0157375_10007078
701 Ga0157375_10044856
702 Ga0157375_10104620
703 Ga0157375_10169619
704 Ga0157375_11058001
705 Ga0163163_10015144
706 Ga0163163_10168537
707 Ga0163163_10235237
708 Ga0157380_10019105
709 Ga0157380_10505234
710 Ga0157377_10005898
711 Ga0157377_10269858
712 Ga0157379_10000063
713 Ga0157379_10024233
714 Ga0157379_10060353
715 Ga0157379_10169293
716 Ga0157376_10021699
717 Ga0157376_10022000
718 Ga0157376_10074293
719 Ga0157376_10133434
720 Ga0157376_10176766
721 Ga0182007_10018020
722 Ga0163161_10015069
723 Ga0209759_1000531
724 Ga0209257_1032442
725 Ga0207697_10066727
726 Ga0207656_10003106
727 Ga0207656_10206865
728 Ga0207682_10000198
729 Ga0207642_10285056
730 Ga0207688_10013095
731 Ga0207688_10078623
732 Ga0207680_10015746
733 Ga0207680_10167667
734 Ga0207645_10000676
735 Ga0207645_10010422
736 Ga0207645_10037414
737 Ga0207643_10036091
738 Ga0207705_10124902
739 Ga0207684_10128907
740 Ga0207695_10557025
741 Ga0207662_10171123
742 Ga0207649_10002109
743 Ga0207649_10283934
744 Ga0207652_10334742
745 Ga0207681_10050470
746 Ga0207694_10016506
747 Ga0207650_10010077
748 Ga0207650_10048983
749 Ga0207650_10050104
750 Ga0207650_10135495
751 Ga0207650_10342266
752 Ga0207659_10006321
753 Ga0207659_10007030
754 Ga0207659_10022796
755 Ga0207687_10035095
756 Ga0207644_10009674
757 Ga0207644_10013318
758 Ga0207644_10163374
759 Ga0207644_10683311
760 Ga0207690_10066250
761 Ga0207706_10009861
762 Ga0207706_10153231
763 Ga0207686_10027150
764 Ga0207709_10055753
765 Ga0207670_10313473
766 Ga0207669_10019213
767 Ga0207704_10000810
768 Ga0207704_10197152
769 Ga0207691_10000243
770 Ga0207691_10000390
771 Ga0207691_10000781
772 Ga0207691_10099086
773 Ga0207711_10003395
774 Ga0207711_10015432
775 Ga0207711_10086881
776 Ga0207711_10228953
777 Ga0207711_10257138
778 Ga0207689_10000116
779 Ga0207689_10000150
780 Ga0207689_10046401
781 Ga0207689_10173057
782 Ga0207679_10071128
783 Ga0207679_10147752
784 Ga0207679_10154909
785 Ga0207679_10414834
786 Ga0207667_10037308
787 Ga0207667_10062947
788 Ga0207651_10007004
789 Ga0207651_10105376
790 Ga0207651_10140719
791 Ga0207712_10615861
792 Ga0207668_10004568
793 Ga0207668_10006199
794 Ga0207668_10038811
795 Ga0207668_10059886
796 Ga0207640_10046604
797 Ga0207640_10192661
798 Ga0207658_10001108
799 Ga0207658_10033317
800 Ga0207658_10036620
801 Ga0207658_10303504
802 Ga0207677_10003603
803 Ga0207677_10009086
804 Ga0207677_10013987
805 Ga0207677_10076457
806 Ga0207677_10494273
807 Ga0207677_10803050
808 Ga0207703_10000526
809 Ga0207703_10015423
810 Ga0207703_10093131
811 Ga0207703_10102957
812 Ga0207639_10003407
813 Ga0207639_10638801
814 Ga0207678_10066938
815 Ga0207708_10169793
816 Ga0207708_10828519
817 Ga0207702_10032466
818 Ga0207641_10001558
819 Ga0207641_10003163
820 Ga0207641_10023373
821 Ga0207641_10035918
822 Ga0207641_10251035
823 Ga0207641_11100086
824 Ga0207648_10002770
825 Ga0207648_10004731
826 Ga0207648_10009673
827 Ga0207648_10271285
828 Ga0207676_10056361
829 Ga0207676_10057772
830 Ga0207676_10635595
831 Ga0207674_10014415
832 Ga0207674_10707027
833 Ga0207675_100000429
834 Ga0207675_100005107
835 Ga0207675_100009101
836 Ga0207675_100040884
837 Ga0207675_100320850
838 Ga0207683_10000308
839 Ga0207683_10064364
840 Ga0207683_10115918
841 Ga0207683_10341987
842 Ga0265354_1001459
843 Ga0268266_10030714
844 Ga0268266_10039966
845 Ga0268266_10130210
846 Ga0268266_10294610
847 Ga0268265_10009532
848 Ga0268265_10085939
849 Ga0268265_10711203
850 Ga0268264_10002349
851 Ga0268264_10060220
852 Ga0268264_10607339
853 Ga0268264_10909599
854 Ga0307515_10015620
855 Ga0265338_10026522
856 Ga0265770_1000981
857 Ga0265765_1001673
858 Ga0265771_1002561
859 Ga0265760_10000397
860 Ga0265332_10034783
861 Ga0307513_10178377
862 Ga0307413_10110508
863 Ga0307410_10050664
864 Ga0307410_10153397
865 Ga0307407_10019990
866 Ga0307412_10017807
867 Ga0307412_10027299
868 Ga0307409_100014027
869 Ga0307409_100151064
870 Ga0307416_100050889
871 Ga0307414_10042221
872 Ga0307411_10034840
873 Ga0307411_10056068
874 Ga0307415_100000821
875 Ga0307415_100086205
876 Ga0307510_10003727
877 Ga0373928_0031119
878 Ga0373946_0084921
879 Ga0373955_0055915
880 Ga0373955_0074567
881 Ga0373924_0070392
882 Ga0373935_0243542
883 Ga0373927_0019824
884 Ga0373933_0335117
885 Ga0373937_0055086
886 Ga0373937_0063706
887 Ga0373937_0190105
888 Ga0373925_0001366
889 Ga0373925_0088568
890 Ga0373925_0351715
891 Ga0436360_0025358
892 Ga0451793_1603956
893 Ga0439444_0026969
894 Ga0451577_0032356
895 Ga0453684_0131640
896 Ga0451576_0007359
897 Ga0495603_0064611
898 Ga0495590_0012361
899 Ga0495629_0009410
900 Ga0495638_0004496
901 Ga0495650_0003755
902 Ga0495650_0065619
903 Ga0495580_0014042
904 Ga0495580_0079315
905 Ga0495580_0220062
906 Ga0495582_0001281
907 Ga0495605_0001981
908 Ga0495605_0010848
909 Ga0495639_0100266
910 Ga0495664_0004970
911 Ga0495585_0060361
912 Ga0495596_0020326
913 Ga0495583_0009286
914 Ga0495583_0019655
915 Ga0495606_0019356
916 Ga0495608_0223040
917 Ga0495620_0005444
918 Ga0495628_0061422
919 Ga0495628_0157574
920 Ga0495630_0009318
921 Ga0495630_0016866
922 Ga0495648_0005414
923 Ga0495648_0030302
924 Ga0495666_0002292
925 Ga0495652_0031407
926 Ga0495665_0081216
927 Ga0495640_0031901
928 Ga0495586_0176531
929 Ga0495586_0211876
930 Ga0495621_0140635
931 Ga0495645_0206321
932 Ga0495645_0281179
933 Ga0495611_0079210
934 Ga0495661_0010587
935 Ga0495661_0057239
936 Ga0495599_0393167
937 Ga0495646_0006632
938 Ga0495647_0003593
939 Ga0495658_0073518
940 Ga0495669_0120411
941 Ga0495613_0018911
942 Ga0495613_0204240
943 Ga0495624_0024024
944 Ga0495624_0378900
945 Ga0495671_0026946
946 Ga0495671_0054380
947 Ga0495649_0042600
948 Ga0495649_0086987
949 Ga0495589_0000653
950 Ga0495581_0009049
951 Ga0495674_0005397
952 Ga0495674_0012959
953 Ga0495674_0269771
954 Ga0495672_0015182
955 Ga0495676_0017782
956 Ga0495676_0099499
957 Ga0495680_0120705
958 Ga0495680_0237085
959 Ga0495683_0038495
960 Ga0495679_000329
961 Ga0495679_002075
962 Ga0495673_0032182
963 Ga0495684_0043895
964 Ga0495686_0029557
965 Ga0495593_0012293
966 Ga0495602_0019978
967 Ga0495602_0571419
968 Ga0495614_0013816
969 Ga0495626_0012145
970 Ga0496100_0017426
971 Ga0496100_0163064
972 Ga0496101_0343502
973 Ga0496102_0001515
974 Ga0496102_0013896
975 Ga0496102_0177172
976 Ga0496102_0463309
977 Ga0496103_0005013
978 Ga0496103_0010820
979 Ga0496103_0249795
980 Ga0496105_0129231
981 Ga0496106_0006474
982 Ga0496106_0042963
983 Ga0496106_0086387
984 Ga0496107_0149023
985 Ga0496108_0003424
986 Ga0496108_0096120
987 Ga0496109_0014773
988 Ga0496110_0098438
989 Ga0496110_0661987
990 Ga0496111_0041215
991 Ga0496112_0003968
992 Ga0496112_0336106
993 Ga0496112_0482527
994 Ga0496113_0032612
995 Ga0496113_0037515
996 Ga0496114_0135272
997 Ga0496115_0053489
998 Ga0496117_0007965
999 Ga0496117_0084668
1000 Ga0496118_0002995
1001 Ga0496118_0009616
1002 Ga0496118_0027875
1003 Ga0496121_0056289
1004 Ga0496123_0101652
1005 Ga0496126_0000274
1006 Ga0496126_0007494
1007 Ga0495678_030764
1008 Ga0495682_0030673
1009 Ga0501045_0173542
1010 nmdc:mga05p37_176230_c1
1011 nmdc:mga05p37_826590_c1
1012 nmdc:mga09592_10055_c1
1013 nmdc:mga09592_455576_c1
1014 nmdc:mga06r32_6409_c1
1015 nmdc:mga0n895_907753_c1
1016 Ga0495601_0055939
1017 Ga0500586_031773
1018 2501073844
1019 2501407684
1020 2511097558
1021 2511105495
1022 2516022580
1023 2883089773
1024 2900634969
1025 2921645390
1026 642621448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04115

Ureidogly_lyase

Ureidoglycolate lyase

108

202

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xsq-assembly1.cif.gz_A crystal structure of ureidoglycolate hydrolase from e.coli. northeast structural genomics consortium target et81. 0.7364 19 210
1xsq-assembly1.cif.gz_A crystal structure of ureidoglycolate hydrolase from e.coli. northeast structural genomics consortium target et81. 0.7149 19 210
5i93-assembly1.cif.gz_A structure of mouse acireductone dioxygenase with ni2+ and 2-ketopentanoic acid in the active site 0.7101 119 192
3dl3-assembly3.cif.gz_B crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.7047 120 191
3dl3-assembly4.cif.gz_I crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.7041 120 192
ID Description Score Start End Superfamily
af_Q4CVG3_87_274_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7874 120 189 2.60.120.10
af_Q09407_1_158_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7367 121 191 2.60.120.10
af_A0A0R0I5N9_6_193_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7223 119 189 2.60.120.10
1xsqA00 Mainly Beta;Sandwich;Jelly Rolls;Ureidoglycolate hydrolase 0.7193 21 214 2.60.120.480
af_O94286_1_176_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7137 119 189 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A355H533-F1-model_v4 Ureidoglycolate hydrolase 0.9906 111 212 GO:0000256
GO:0004848
GO:0006144
GO:0050385
AF-A0A7Z9LV21-F1-model_v4 Ureidoglycolate hydrolase 0.9799 118 215 GO:0000256
GO:0004848
GO:0006144
GO:0050385
AF-A0A3B0S246-F1-model_v4 Ureidoglycolate hydrolase 0.9769 74 215 GO:0000256
GO:0004848
GO:0006144
GO:0050385
AF-A0A846DCX1-F1-model_v4 Ureidoglycolate hydrolase 0.9716 114 212 GO:0000256
GO:0004848
GO:0006144
GO:0050385
AF-A0A7Z9LV21-F1-model_v4 Ureidoglycolate hydrolase 0.9701 118 215 GO:0000256
GO:0004848
GO:0006144
GO:0050385

Map