F457651

General Info

Members Datasets Scaffolds Average Seq Length
513 313 489 156

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221628|2644162437
Length 180
Sequence RGILAFRVASRQIGRIIFRMITTQSHVNPIRVGLISDTHGLLRPQAVAALQGSDFIVHGGDIGDAGILDALQAIAPLTVVRGNNDREPWAARIPETDFLQVAGVLVYAIHDLSQIDIDPAAAGVRVVVSGHSHKPKVEERGGVLYVNPGSAGPRRFKLPIAVAELIVMDDAVTARIVELA

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
6 2643221683 Variovorax sp. Root473 Isolate Unclassified
7 2738543013 Variovorax sp. BT01 Isolate Unclassified
8 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
9 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
10 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
11 2899924645 Variovorax sp. 369 Isolate Unclassified
12 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
13 2904456579 Variovorax sp. 2002 Isolate Unclassified
14 2928037797 Variovorax sp. 1126 Isolate Unclassified
15 2928044640 Variovorax sp. 1128 Isolate Unclassified
16 2928051484 Variovorax sp. 1133 Isolate Unclassified
17 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
18 2928070936 Variovorax gossypii 1167 Isolate Unclassified
19 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
20 2929520902 Variovorax beijingensis 502 Isolate Unclassified
21 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
22 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
23 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
24 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
25 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
220 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
221 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
253 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
287 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
288 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0.58
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.71
Nodule 0.58
Rhizoplane 2.92
Rhizosphere 64.72
Stem 0
Stem Tuber 0
Unclassified 5.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1009816 3300002739 Bacteria 1305
2 JGI25152J39213_1029597 3300002773 Bacteria 859
3 JGI25151J46595_10003197 3300003187 Bacteria 9174
4 JGI25151J46595_10012847 3300003187 Bacteria 3792
5 JGI25151J46595_10014111 3300003187 Bacteria 3574
6 JGI25153J46596_10010005 3300003215 Bacteria 4332
7 JGI25153J46596_10023608 3300003215 Bacteria 2237
8 JGI25160J50197_1007653 3300003354 Bacteria 4206
9 JGI25161J50226_1003587 3300003374 Bacteria 3495
10 Ga0006562J51391_1041595 3300003578 Bacteria 3249
11 Ga0006562J51391_1041597 3300003578 Bacteria 2430
12 Ga0006562J51391_1080260 3300003578 Bacteria 5534
13 Ga0055535_1000936 3300003761 Bacteria 19481
14 Ga0055542_1000009 3300003762 Bacteria 416550
15 Ga0055526_1002633 3300003771 Bacteria 11991
16 Ga0055537_1000803 3300003773 Bacteria 15557
17 Ga0055537_1008860 3300003773 Bacteria 2275
18 Ga0055524_1001750 3300003775 Bacteria 11990
19 Ga0055536_1010243 3300003781 Bacteria 3747
20 Ga0055536_1010753 3300003781 Bacteria 3587
21 Ga0055534_1000464 3300003784 Bacteria 23141
22 Ga0055534_1000737 3300003784 Bacteria 15756
23 Ga0055534_1008718 3300003784 Bacteria 2270
24 Ga0055528_1002614 3300003790 Bacteria 9534
25 Ga0055528_1018969 3300003790 Bacteria 2305
26 Ga0055528_1025333 3300003790 Bacteria 1745
27 Ga0055530_10004760 3300003791 Bacteria 6825
28 Ga0055540_1008394 3300003792 Bacteria 3726
29 Ga0055540_1008794 3300003792 Bacteria 3583
30 Ga0055540_1037072 3300003792 Bacteria 1077
31 Ga0055531_10013379 3300003794 Bacteria 3784
32 Ga0055543_1016694 3300004625 Bacteria 1392
33 Ga0065165_1031179 3300005262 Bacteria 1688
34 Ga0070658_10020447 3300005327 Bacteria 5306
35 Ga0070658_10057949 3300005327 Bacteria 3151
36 Ga0070683_100077767 3300005329 Bacteria 3103
37 Ga0070690_100000646 3300005330 Bacteria 17735
38 Ga0068869_100001009 3300005334 Bacteria 16373
39 Ga0070666_10048250 3300005335 Bacteria 2861
40 Ga0070666_10251600 3300005335 Bacteria 1251
41 Ga0070666_10388744 3300005335 Bacteria 1002
42 Ga0070680_100000674 3300005336 Bacteria 23749
43 Ga0070682_100006371 3300005337 Bacteria 6626
44 Ga0068868_100258025 3300005338 Bacteria 1469
45 Ga0070689_100000268 3300005340 Bacteria 30093
46 Ga0070691_10001428 3300005341 Bacteria 10200
47 Ga0070687_100000048 3300005343 Bacteria 38178
48 Ga0070687_100371503 3300005343 Bacteria 929
49 Ga0070661_100011317 3300005344 Bacteria 6216
50 Ga0070692_10046425 3300005345 Bacteria 2245
51 Ga0070668_100721999 3300005347 Bacteria 880
52 Ga0070669_100509330 3300005353 Bacteria 999
53 Ga0070669_100987037 3300005353 Bacteria 722
54 Ga0070675_100654407 3300005354 Bacteria 955
55 Ga0070671_100117818 3300005355 Bacteria 2233
56 Ga0070674_100704024 3300005356 Bacteria 864
57 Ga0070674_100849256 3300005356 Bacteria 792
58 Ga0070688_100058558 3300005365 Bacteria 2426
59 Ga0070659_100041646 3300005366 Bacteria 3591
60 Ga0070659_100571590 3300005366 Unclassified 969
61 Ga0070703_10026136 3300005406 Bacteria 1734
62 Ga0070701_10000195 3300005438 Bacteria 18860
63 Ga0070705_100007293 3300005440 Bacteria 5439
64 Ga0070700_100000690 3300005441 Bacteria 16656
65 Ga0070694_100000087 3300005444 Bacteria 43937
66 Ga0070708_100175028 3300005445 Bacteria 2005
67 Ga0070678_100045763 3300005456 Bacteria 3133
68 Ga0070678_100165061 3300005456 Bacteria 1798
69 Ga0070678_100459805 3300005456 Bacteria 1116
70 Ga0070662_100156903 3300005457 Bacteria 1777
71 Ga0070662_100419932 3300005457 Bacteria 1106
72 Ga0070681_10021312 3300005458 Bacteria 6497
73 Ga0068867_100000743 3300005459 Bacteria 21865
74 Ga0068867_100494419 3300005459 Bacteria 1050
75 Ga0068867_100653559 3300005459 Bacteria 923
76 Ga0070706_100007766 3300005467 Bacteria 10034
77 Ga0070707_100015148 3300005468 Bacteria 7238
78 Ga0070698_100560917 3300005471 Unclassified 1082
79 Ga0070679_100028709 3300005530 Bacteria 5487
80 Ga0070679_100260823 3300005530 Bacteria 1688
81 Ga0070697_100240960 3300005536 Bacteria 1544
82 Ga0068853_100478226 3300005539 Bacteria 1174
83 Ga0070686_100000674 3300005544 Bacteria 19947
84 Ga0070695_100004962 3300005545 Bacteria 7847
85 Ga0070696_100000013 3300005546 Bacteria 78718
86 Ga0070696_100034489 3300005546 Bacteria 3481
87 Ga0070696_100182176 3300005546 Unclassified 1559
88 Ga0070693_100000251 3300005547 Bacteria 24991
89 Ga0070704_100000029 3300005549 Bacteria 47486
90 Ga0068855_100017210 3300005563 Bacteria 8698
91 Ga0068855_100064296 3300005563 Bacteria 4279
92 Ga0070664_100181175 3300005564 Bacteria 1872
93 Ga0070664_101428686 3300005564 Bacteria 654
94 Ga0068857_100102100 3300005577 Bacteria 2574
95 Ga0068854_100005685 3300005578 Bacteria 7884
96 Ga0068854_100036071 3300005578 Bacteria 3464
97 Ga0068854_100156364 3300005578 Bacteria 1762
98 Ga0068854_100547046 3300005578 Bacteria 981
99 Ga0068856_100005419 3300005614 Bacteria 12571
100 Ga0070702_100000067 3300005615 Bacteria 29275
101 Ga0068852_100002793 3300005616 Bacteria 12096
102 Ga0068852_100055815 3300005616 Bacteria 3410
103 Ga0068852_100562461 3300005616 Bacteria 1142
104 Ga0068859_100000991 3300005617 Bacteria 29049
105 Ga0068859_100241953 3300005617 Bacteria 1894
106 Ga0068859_101291340 3300005617 Unclassified 804
107 Ga0068864_101160527 3300005618 Bacteria 770
108 Ga0068866_10000090 3300005718 Bacteria 37774
109 Ga0068866_10162030 3300005718 Bacteria 1305
110 Ga0068861_100000135 3300005719 Bacteria 38189
111 Ga0068861_100787126 3300005719 Unclassified 891
112 Ga0068851_10002702 3300005834 Bacteria 7818
113 Ga0068851_10126399 3300005834 Bacteria 1379
114 Ga0068870_10006289 3300005840 Bacteria 5231
115 Ga0068870_11044935 3300005840 Bacteria 585
116 Ga0068863_100649431 3300005841 Bacteria 1046
117 Ga0068858_100001862 3300005842 Bacteria 21519
118 Ga0068860_100000929 3300005843 Bacteria 32389
119 Ga0068862_100000755 3300005844 Bacteria 32331
120 Ga0068862_100031163 3300005844 Bacteria 4499
121 Ga0068862_100040816 3300005844 Unclassified 3946
122 Ga0068862_100071485 3300005844 Bacteria 2996
123 Ga0081539_10201219 3300005985 Unclassified 920
124 Ga0075365_10083453 3300006038 Bacteria 2167
125 Ga0075363_100025864 3300006048 Bacteria 2998
126 Ga0075363_100181498 3300006048 Unclassified 1198
127 Ga0075363_100493171 3300006048 Bacteria 727
128 Ga0075364_10059750 3300006051 Bacteria 2499
129 Ga0075364_10291262 3300006051 Unclassified 1111
130 Ga0075432_10022678 3300006058 Bacteria 2147
131 Ga0075362_10032639 3300006177 Bacteria 2261
132 Ga0075362_10033706 3300006177 Bacteria 2228
133 Ga0075362_10046786 3300006177 Bacteria 1925
134 Ga0075362_10094050 3300006177 Bacteria 1394
135 Ga0075367_10077015 3300006178 Bacteria 2013
136 Ga0075367_10083192 3300006178 Bacteria 1938
137 Ga0075369_10098976 3300006186 Unclassified 1307
138 Ga0075369_10194802 3300006186 Bacteria 934
139 Ga0075366_10007074 3300006195 Bacteria 6176
140 Ga0075366_10021049 3300006195 Bacteria 3790
141 Ga0075366_10026840 3300006195 Bacteria 3375
142 Ga0075366_10039155 3300006195 Bacteria 2801
143 Ga0075366_10101191 3300006195 Bacteria 1729
144 Ga0075366_10322708 3300006195 Bacteria 946
145 Ga0097621_100000024 3300006237 Bacteria 81390
146 Ga0097621_100120450 3300006237 Bacteria 2225
147 Ga0097621_100222044 3300006237 Bacteria 1647
148 Ga0075370_10018029 3300006353 Bacteria 3824
149 Ga0075370_10022330 3300006353 Bacteria 3474
150 Ga0075370_10028347 3300006353 Bacteria 3112
151 Ga0075370_10091848 3300006353 Bacteria 1752
152 Ga0075370_10092832 3300006353 Bacteria 1742
153 Ga0075370_10113636 3300006353 Bacteria 1573
154 Ga0075370_10253741 3300006353 Bacteria 1042
155 Ga0075370_10350823 3300006353 Bacteria 881
156 Ga0068871_100001646 3300006358 Bacteria 15031
157 Ga0068871_100131217 3300006358 Bacteria 2124
158 Ga0075428_100503250 3300006844 Bacteria 1296
159 Ga0075431_100567515 3300006847 Bacteria 1121
160 Ga0075429_101402731 3300006880 Bacteria 608
161 Ga0097620_100000991 3300006931 Bacteria 29049
162 Ga0097620_100241950 3300006931 Bacteria 1894
163 Ga0097620_101291696 3300006931 Unclassified 804
164 Ga0099826_10036978 3300006948 Bacteria 3446
165 Ga0105244_10069982 3300009036 Bacteria 1751
166 Ga0105250_10120620 3300009092 Bacteria 1078
167 Ga0105240_10138320 3300009093 Bacteria 2914
168 Ga0105240_10219220 3300009093 Bacteria 2218
169 Ga0105240_10335186 3300009093 Bacteria 1720
170 Ga0111539_11802153 3300009094 Bacteria 710
171 Ga0105245_10001679 3300009098 Bacteria 20141
172 Ga0105245_10029116 3300009098 Bacteria 4877
173 Ga0105245_10527449 3300009098 Bacteria 1200
174 Ga0114129_10086883 3300009147 Bacteria 4337
175 Ga0114129_10603779 3300009147 Bacteria 1421
176 Ga0114129_10770314 3300009147 Bacteria 1230
177 Ga0105243_10000727 3300009148 Bacteria 31570
178 Ga0105243_10003205 3300009148 Bacteria 13388
179 Ga0105243_10045095 3300009148 Bacteria 3463
180 Ga0105243_10091179 3300009148 Bacteria 2509
181 Ga0105243_11817283 3300009148 Bacteria 641
182 Ga0105241_10014245 3300009174 Bacteria 5824
183 Ga0105241_10401147 3300009174 Bacteria 1203
184 Ga0105241_11322101 3300009174 Bacteria 687
185 Ga0105242_10000416 3300009176 Bacteria 33943
186 Ga0105248_10073765 3300009177 Bacteria 3835
187 Ga0105248_10163232 3300009177 Bacteria 2512
188 Ga0105237_10015889 3300009545 Bacteria 7827
189 Ga0105237_10065829 3300009545 Bacteria 3619
190 Ga0105237_11378951 3300009545 Unclassified 711
191 Ga0105238_10173158 3300009551 Bacteria 2135
192 Ga0105249_10041364 3300009553 Bacteria 4190
193 Ga0105239_10020652 3300010375 Bacteria 7266
194 Ga0105239_10023015 3300010375 Bacteria 6869
195 Ga0105239_10204971 3300010375 Bacteria 2210
196 Ga0105239_10256810 3300010375 Bacteria 1963
197 Ga0105239_12302826 3300010375 Bacteria 627
198 Ga0105246_10037944 3300011119 Bacteria 3236
199 Ga0105246_10204552 3300011119 Bacteria 1537
200 Ga0105246_10321099 3300011119 Bacteria 1258
201 Ga0157373_10248270 3300013100 Bacteria 1258
202 Ga0157371_10233827 3300013102 Bacteria 1321
203 Ga0157370_10027764 3300013104 Bacteria 5579
204 Ga0157370_11101435 3300013104 Bacteria 718
205 Ga0157370_11395746 3300013104 Bacteria 630
206 Ga0157369_10001553 3300013105 Bacteria 28084
207 Ga0157374_10049346 3300013296 Bacteria 3910
208 Ga0157378_10019175 3300013297 Bacteria 6012
209 Ga0163162_10947657 3300013306 Unclassified 972
210 Ga0157372_10164514 3300013307 Bacteria 2565
211 Ga0157380_10010589 3300014326 Bacteria 6634
212 Ga0182008_10001772 3300014497 Bacteria 14134
213 Ga0182008_10041789 3300014497 Bacteria 2286
214 Ga0182008_10049539 3300014497 Bacteria 2085
215 Ga0182008_10123703 3300014497 Bacteria 1287
216 Ga0157376_10000935 3300014969 Bacteria 18979
217 Ga0157376_10123539 3300014969 Bacteria 2298
218 Ga0157376_10190003 3300014969 Bacteria 1883
219 Ga0182007_10000714 3300015262 Bacteria 18864
220 Ga0163161_10000874 3300017792 Bacteria 23486
221 Ga0163161_10021800 3300017792 Bacteria 4505
222 Ga0163161_10024220 3300017792 Bacteria 4287
223 Ga0209436_111189 3300025208 Bacteria 1591
224 Ga0209672_100898 3300025228 Bacteria 13542
225 Ga0209147_100876 3300025229 Bacteria 13853
226 Ga0209258_100009 3300025242 Bacteria 996276
227 Ga0207425_1003371 3300025245 Bacteria 5140
228 Ga0209148_1000007 3300025254 Bacteria 1592273
229 Ga0209129_1002572 3300025258 Bacteria 8726
230 Ga0209129_1006372 3300025258 Bacteria 3838
231 Ga0209565_1000058 3300025263 Bacteria 194126
232 Ga0209565_1001206 3300025263 Bacteria 12290
233 Ga0209673_1000053 3300025273 Bacteria 279449
234 Ga0209673_1000245 3300025273 Bacteria 103315
235 Ga0209673_1004074 3300025273 Bacteria 8061
236 Ga0209130_1000806 3300025284 Bacteria 26515
237 Ga0209130_1001044 3300025284 Bacteria 21022
238 Ga0209130_1022794 3300025284 Bacteria 1390
239 Ga0209675_1000010 3300025291 Bacteria 541927
240 Ga0209675_1003105 3300025291 Bacteria 8108
241 Ga0209676_1000108 3300025292 Bacteria 221168
242 Ga0209676_1001763 3300025292 Bacteria 18368
243 Ga0209676_1011115 3300025292 Bacteria 3667
244 Ga0209025_1000129 3300025294 Bacteria 198847
245 Ga0209025_1018749 3300025294 Bacteria 3896
246 Ga0209025_1019026 3300025294 Bacteria 3844
247 Ga0209025_1020184 3300025294 Bacteria 3658
248 Ga0209564_1000926 3300025295 Bacteria 38156
249 Ga0209758_1004323 3300025297 Bacteria 11943
250 Ga0209050_1000002 3300025298 Bacteria 1792849
251 Ga0209050_1026573 3300025298 Bacteria 1932
252 Ga0209256_1000077 3300025299 Bacteria 230410
253 Ga0207426_1000129 3300025302 Bacteria 210930
254 Ga0209051_1000002 3300025303 Bacteria 1631846
255 Ga0209051_1000880 3300025303 Bacteria 30225
256 Ga0209051_1000956 3300025303 Bacteria 28350
257 Ga0209051_1007087 3300025303 Bacteria 6199
258 Ga0209257_1000002 3300025304 Bacteria 1767052
259 Ga0209257_1009481 3300025304 Bacteria 5194
260 Ga0209257_1013005 3300025304 Bacteria 3758
261 Ga0207656_10045285 3300025321 Bacteria 1882
262 Ga0207656_10172538 3300025321 Bacteria 1034
263 Ga0207653_10004459 3300025885 Bacteria 4389
264 Ga0207688_10702356 3300025901 Bacteria 640
265 Ga0207680_10211839 3300025903 Unclassified 1325
266 Ga0207647_10048131 3300025904 Bacteria 2649
267 Ga0207645_10754422 3300025907 Bacteria 662
268 Ga0207705_10019231 3300025909 Bacteria 4885
269 Ga0207705_10217461 3300025909 Bacteria 1450
270 Ga0207707_10028528 3300025912 Bacteria 4879
271 Ga0207695_10157790 3300025913 Bacteria 2203
272 Ga0207695_10261071 3300025913 Bacteria 1630
273 Ga0207671_10037204 3300025914 Bacteria 3610
274 Ga0207671_10069967 3300025914 Bacteria 2615
275 Ga0207660_10001515 3300025917 Bacteria 15623
276 Ga0207662_10000034 3300025918 Bacteria 60878
277 Ga0207649_10036387 3300025920 Bacteria 2964
278 Ga0207652_10002453 3300025921 Bacteria 15646
279 Ga0207652_10395593 3300025921 Bacteria 1247
280 Ga0207681_11128599 3300025923 Bacteria 658
281 Ga0207650_10018410 3300025925 Bacteria 4902
282 Ga0207687_10000943 3300025927 Bacteria 19839
283 Ga0207644_10002881 3300025931 Bacteria 11083
284 Ga0207644_10083002 3300025931 Bacteria 2372
285 Ga0207690_10539978 3300025932 Unclassified 947
286 Ga0207690_10585125 3300025932 Bacteria 910
287 Ga0207706_10051296 3300025933 Bacteria 3643
288 Ga0207706_10527293 3300025933 Bacteria 1018
289 Ga0207706_10855666 3300025933 Bacteria 770
290 Ga0207686_10000316 3300025934 Bacteria 34945
291 Ga0207709_10000388 3300025935 Bacteria 43643
292 Ga0207709_10000553 3300025935 Bacteria 31971
293 Ga0207709_10002648 3300025935 Bacteria 11129
294 Ga0207709_10016441 3300025935 Bacteria 4113
295 Ga0207709_10317025 3300025935 Bacteria 1165
296 Ga0207670_10000402 3300025936 Bacteria 24919
297 Ga0207704_10226195 3300025938 Bacteria 1388
298 Ga0207691_10259339 3300025940 Bacteria 1499
299 Ga0207711_10021332 3300025941 Bacteria 5412
300 Ga0207711_10040696 3300025941 Unclassified 3955
301 Ga0207689_10000336 3300025942 Bacteria 43682
302 Ga0207689_10037650 3300025942 Unclassified 4011
303 Ga0207661_10753263 3300025944 Bacteria 896
304 Ga0207679_10067242 3300025945 Bacteria 2688
305 Ga0207667_10030708 3300025949 Bacteria 5808
306 Ga0207667_10040911 3300025949 Bacteria 4933
307 Ga0207651_10387881 3300025960 Bacteria 1185
308 Ga0207712_10021577 3300025961 Bacteria 4230
309 Ga0207668_10859651 3300025972 Bacteria 806
310 Ga0207668_11119821 3300025972 Bacteria 706
311 Ga0207640_10000724 3300025981 Bacteria 19011
312 Ga0207640_10116657 3300025981 Bacteria 1904
313 Ga0207640_10498090 3300025981 Bacteria 1014
314 Ga0207658_10133548 3300025986 Unclassified 1998
315 Ga0207677_10301961 3300026023 Bacteria 1323
316 Ga0207703_10002469 3300026035 Bacteria 16036
317 Ga0207678_10325980 3300026067 Bacteria 1322
318 Ga0207678_10719712 3300026067 Bacteria 879
319 Ga0207708_10000048 3300026075 Bacteria 114754
320 Ga0207702_10175021 3300026078 Bacteria 1971
321 Ga0207641_10074700 3300026088 Bacteria 2925
322 Ga0207648_10000519 3300026089 Bacteria 43028
323 Ga0207648_10178672 3300026089 Bacteria 1878
324 Ga0207648_10578088 3300026089 Bacteria 1034
325 Ga0207676_11019957 3300026095 Bacteria 816
326 Ga0207674_10070275 3300026116 Bacteria 3520
327 Ga0207675_100000464 3300026118 Bacteria 39538
328 Ga0207675_100755525 3300026118 Unclassified 984
329 Ga0207683_10020182 3300026121 Bacteria 5696
330 Ga0207683_11023832 3300026121 Bacteria 766
331 Ga0207698_10080991 3300026142 Bacteria 2618
332 Ga0209982_1029699 3300027552 Bacteria 858
333 Ga0209282_1011618 3300027666 Bacteria 5591
334 Ga0268265_10012498 3300028380 Bacteria 5752
335 Ga0268265_10017606 3300028380 Bacteria 4936
336 Ga0268265_10152692 3300028380 Bacteria 1950
337 Ga0268265_10170422 3300028380 Unclassified 1860
338 Ga0268264_10000423 3300028381 Bacteria 59146
339 Ga0316183_1067836 3300030742 Bacteria 1630
340 Ga0316181_1216941 3300030744 Bacteria 1198
341 Ga0316182_1142928 3300030745 Bacteria 4102
342 Ga0316182_1290173 3300030745 Bacteria 3814
343 Ga0265327_10202795 3300031251 Bacteria 897
344 Ga0307408_100097584 3300031548 Bacteria 2232
345 Ga0307408_100231861 3300031548 Bacteria 1512
346 Ga0307408_100297981 3300031548 Bacteria 1349
347 Ga0307408_100350941 3300031548 Bacteria 1252
348 Ga0307408_100434285 3300031548 Bacteria 1135
349 Ga0307408_100535007 3300031548 Bacteria 1031
350 Ga0307408_100571668 3300031548 Bacteria 1000
351 Ga0307408_100797892 3300031548 Bacteria 857
352 Ga0307514_10025411 3300031649 Bacteria 4791
353 Ga0307405_10048587 3300031731 Bacteria 2617
354 Ga0307405_10076432 3300031731 Bacteria 2172
355 Ga0307405_10142011 3300031731 Bacteria 1676
356 Ga0307405_10245240 3300031731 Bacteria 1329
357 Ga0307405_10568207 3300031731 Bacteria 920
358 Ga0307413_10065151 3300031824 Bacteria 2267
359 Ga0307413_10885742 3300031824 Bacteria 757
360 Ga0307410_10284539 3300031852 Bacteria 1299
361 Ga0307410_10450347 3300031852 Bacteria 1050
362 Ga0307406_10002795 3300031901 Bacteria 9521
363 Ga0307406_10072488 3300031901 Bacteria 2261
364 Ga0307406_10853443 3300031901 Bacteria 772
365 Ga0307407_10019655 3300031903 Bacteria 3444
366 Ga0307412_10002721 3300031911 Bacteria 9826
367 Ga0307412_10039833 3300031911 Bacteria 3036
368 Ga0307412_10304320 3300031911 Bacteria 1261
369 Ga0307412_10432289 3300031911 Bacteria 1080
370 Ga0307412_10573295 3300031911 Bacteria 951
371 Ga0307412_10624380 3300031911 Bacteria 916
372 Ga0307416_100065798 3300032002 Bacteria 2981
373 Ga0307416_100311767 3300032002 Bacteria 1570
374 Ga0307416_103539710 3300032002 Bacteria 523
375 Ga0307414_10065139 3300032004 Bacteria 2598
376 Ga0307414_10505005 3300032004 Bacteria 1070
377 Ga0307414_11069656 3300032004 Bacteria 744
378 Ga0307411_10058037 3300032005 Bacteria 2559
379 Ga0307411_11058557 3300032005 Bacteria 729
380 Ga0373926_0120476 3300035083 Bacteria 989
381 Ga0373940_0190594 3300035088 Bacteria 670
382 Ga0373943_0071078 3300035170 Bacteria 1762
383 Ga0373943_0308915 3300035170 Bacteria 899
384 Ga0373946_0210252 3300035171 Bacteria 935
385 Ga0373931_0029909 3300035691 Bacteria 2800
386 Ga0373931_0324145 3300035691 Bacteria 958
387 Ga0373935_0287981 3300035692 Bacteria 1158
388 Ga0373927_0317132 3300035695 Bacteria 1026
389 Ga0373947_0090114 3300035725 Bacteria 1911
390 Ga0373937_0945247 3300036401 Bacteria 811
391 Ga0373925_0042247 3300037068 Bacteria 3382
392 Ga0373925_0444950 3300037068 Bacteria 1061
393 Ga0395900_0154502 3300037418 Bacteria 2344
394 Ga0395905_0106865 3300037471 Bacteria 2628
395 Ga0395905_0908702 3300037471 Bacteria 783
396 Ga0395901_0100040 3300038443 Bacteria 3041
397 Ga0436365_1016022 3300039437 Bacteria 3902
398 Ga0436360_0709777 3300039438 Bacteria 955
399 Ga0439466_0172015 3300041411 Bacteria 661
400 Ga0451800_1030749 3300041459 Bacteria 852
401 Ga0451807_1045108 3300041486 Unclassified 1339
402 Ga0451807_1136509 3300041486 Bacteria 515
403 Ga0450894_010472 3300042131 Bacteria 1204
404 Ga0450906_001486 3300042145 Bacteria 5114
405 Ga0451576_0451760 3300045051 Bacteria 1349
406 Ga0495629_0285871 3300046459 Bacteria 1131
407 Ga0495638_0012398 3300046460 Bacteria 5845
408 Ga0495616_0001362 3300046513 Bacteria 17026
409 Ga0495620_0118593 3300046515 Bacteria 1044
410 Ga0495631_0000088 3300046518 Bacteria 59630
411 Ga0495663_0219769 3300046525 Bacteria 668
412 Ga0495666_0048323 3300046526 Bacteria 2049
413 Ga0495654_0011502 3300046530 Bacteria 4786
414 Ga0495609_0425599 3300046538 Bacteria 529
415 Ga0495621_0020600 3300046539 Bacteria 2166
416 Ga0495625_0000411 3300046660 Bacteria 64917
417 Ga0495588_0020757 3300046674 Bacteria 3232
418 Ga0495588_0043028 3300046674 Bacteria 2310
419 Ga0495669_0091877 3300046684 Bacteria 1402
420 Ga0495670_0221100 3300046691 Bacteria 1006
421 Ga0495614_0161695 3300048089 Bacteria 1002
422 Ga0496102_0122430 3300048905 Bacteria 2430
423 Ga0496102_0631552 3300048905 Bacteria 994
424 Ga0496103_0205390 3300048906 Bacteria 1267
425 Ga0496104_0014858 3300048907 Bacteria 7039
426 Ga0496105_0014980 3300048908 Bacteria 6171
427 Ga0496106_0244652 3300048909 Bacteria 1433
428 Ga0496108_1265489 3300048911 Bacteria 622
429 Ga0496113_0256483 3300048916 Bacteria 1397
430 Ga0496115_0506038 3300048918 Bacteria 970
431 Ga0496117_0102284 3300048920 Bacteria 1809
432 Ga0496118_0019588 3300048921 Bacteria 6041
433 Ga0496118_0162685 3300048921 Bacteria 1377
434 Ga0496121_0160478 3300048924 Bacteria 1644
435 Ga0496121_0503077 3300048924 Bacteria 769
436 Ga0496123_0076828 3300048926 Bacteria 2054
437 Ga0496123_0454887 3300048926 Bacteria 569
438 Ga0496124_0079241 3300048927 Bacteria 2705
439 Ga0496124_0091532 3300048927 Bacteria 2478
440 Ga0501036_1461768 3300049572 Bacteria 553
441 Ga0501067_0470568 3300049583 Unclassified 702
442 Ga0501070_0325148 3300049586 Unclassified 1250
443 Ga0501217_118731 3300049661 Bacteria 766
444 Ga0501270_015525 3300049767 Bacteria 1089
445 Ga0501283_011468 3300049779 Bacteria 1319
446 nmdc:mga03683_32511_c1 3300050489 Bacteria 2099
447 nmdc:mga03683_4015_c1 3300050489 Bacteria 3100
448 nmdc:mga03683_5230_c2 3300050489 Bacteria 3593
449 nmdc:mga03683_66314_c1 3300050489 Bacteria 1535
450 nmdc:mga03n38_10906_c1 3300050490 Bacteria 3366
451 nmdc:mga03n38_316960_c1 3300050490 Bacteria 841
452 nmdc:mga03n38_3580_c1 3300050490 Bacteria 5015
453 nmdc:mga00v17_14438_c1 3300050491 Bacteria 4407
454 nmdc:mga00v17_355643_c1 3300050491 Bacteria 952
455 nmdc:mga0yw44_22052_c1 3300050492 Bacteria 3564
456 nmdc:mga0k408_120526_c1 3300050493 Bacteria 1553
457 nmdc:mga0k408_36530_c1 3300050493 Bacteria 2820
458 nmdc:mga0k408_36926_c1 3300050493 Bacteria 2804
459 nmdc:mga0k408_40048_c2 3300050493 Bacteria 2482
460 nmdc:mga0k408_40196_c1 3300050493 Bacteria 2690
461 nmdc:mga06z11_539743_c1 3300050494 Unclassified 708
462 nmdc:mga04h51_481625_c1 3300050495 Bacteria 528
463 nmdc:mga07m45_176889_c1 3300050496 Bacteria 1241
464 nmdc:mga07m45_18238_c1 3300050496 Bacteria 3784
465 nmdc:mga07m45_310634_c1 3300050496 Bacteria 916
466 nmdc:mga07m45_4813_c2 3300050496 Bacteria 6437
467 nmdc:mga07m45_6246_c1 3300050496 Bacteria 6016
468 nmdc:mga07m45_772_c2 3300050496 Bacteria 11645
469 nmdc:mga07m45_87343_c1 3300050496 Bacteria 1785
470 nmdc:mga07m45_94642_c1 3300050496 Bacteria 1713
471 nmdc:mga05p37_836115_c1 3300050507 Bacteria 1002
472 nmdc:mga0sz30_114525_c1 3300050516 Unclassified 1183
473 nmdc:mga0sz30_216175_c1 3300050516 Bacteria 852
474 nmdc:mga0sz30_82388_c1 3300050516 Bacteria 1393
475 Ga0500562_011450 3300053108 Bacteria 2253
476 Ga0500594_0000826 3300053118 Bacteria 6604
477 Ga0500607_004247 3300053121 Bacteria 9969
478 Ga0500608_003303 3300053122 Bacteria 6021
479 Ga0500626_057781 3300053128 Bacteria 1738
480 Ga0500642_0233543 3300053130 Bacteria 849
481 Ga0500658_0037737 3300053134 Bacteria 1922
482 Ga0500559_0221759 3300053136 Bacteria 891
483 Ga0500568_0061919 3300053139 Bacteria 1446
484 Ga0500574_071825 3300053141 Bacteria 1014
485 Ga0500616_0006416 3300053153 Bacteria 7708
486 Ga0500627_0002538 3300053158 Bacteria 5442
487 Ga0501084_0473942 3300054114 Bacteria 1058
488 Ga0590071_009838 3300059421 Bacteria 2242
489 Ga0590075_015247 3300059424 Unclassified 1885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_10016441 Ga0207709_100164413 124
2 iso_pu_bacteria 2904449895 2904450478 146
3 iso_pu_bacteria 2904456579 2904456699 146
4 iso_pu_bacteria 2929520902 2929521193 146
5 iso_pu_bacteria 2945972063 2945973258 146
6 iso_pu_bacteria 2945909444 2945913605 148
7 iso_pu_bacteria 2945945610 2945949214 148
8 iso_pu_bacteria 2945984333 2945991000 148
9 iso_pu_bacteria 2599185214 2599626871 149
10 iso_pu_bacteria 2599185226 2599676117 149
11 iso_pu_bacteria 2599185227 2599684429 149
12 iso_pu_bacteria 2599185229 2599696422 149
13 iso_pu_bacteria 2643221683 2644464488 149
14 iso_pu_bacteria 2831265667 2831271217 149
15 iso_pu_bacteria 2838054893 2838055810 149
16 iso_pu_bacteria 2899924645 2899925752 149
17 iso_pu_bacteria 2928037797 2928041859 149
18 iso_pu_bacteria 2928044640 2928049423 149
19 iso_pu_bacteria 2928051484 2928051902 149
20 iso_pu_bacteria 2928064002 2928065406 149
21 iso_pu_bacteria 2928070936 2928076493 149
22 iso_pu_bacteria 2928084124 2928089395 149
23 3300003578 Ga0006562J51391_1080260 Ga0006562J51391_10802602 150
24 3300003792 Ga0055540_1037072 Ga0055540_10370722 150
25 3300005456 Ga0070678_100045763 Ga0070678_1000457631 150
26 3300006186 Ga0075369_10194802 Ga0075369_101948022 150
27 3300006353 Ga0075370_10350823 Ga0075370_103508232 150
28 3300013100 Ga0157373_10248270 Ga0157373_102482703 150
29 3300014497 Ga0182008_10001772 Ga0182008_1000177217 150
30 3300014497 Ga0182008_10041789 Ga0182008_100417893 150
31 3300015262 Ga0182007_10000714 Ga0182007_1000071420 150
32 3300025303 Ga0209051_1000880 Ga0209051_10008806 150
33 3300026121 Ga0207683_10020182 Ga0207683_100201822 150
34 3300031251 Ga0265327_10202795 Ga0265327_102027952 150
35 3300031548 Ga0307408_100231861 Ga0307408_1002318612 150
36 3300031548 Ga0307408_100297981 Ga0307408_1002979811 150
37 3300031649 Ga0307514_10025411 Ga0307514_100254113 150
38 3300031731 Ga0307405_10076432 Ga0307405_100764322 150
39 3300031901 Ga0307406_10002795 Ga0307406_100027959 150
40 3300031911 Ga0307412_10304320 Ga0307412_103043202 150
41 3300032004 Ga0307414_10505005 Ga0307414_105050052 150
42 3300041411 Ga0439466_0172015 Ga0439466_0172015_73_525 150
43 3300048924 Ga0496121_0503077 Ga0496121_0503077_261_713 150
44 3300050516 nmdc:mga0sz30_216175_c1 nmdc:mga0sz30_216175_c1_260_712 150
45 3300050516 nmdc:mga0sz30_82388_c1 nmdc:mga0sz30_82388_c1_67_519 150
46 iso_pu_bacteria 2738543013 2739247335 150
47 iso_pu_bacteria 2894510363 2894512176 150
48 3300005335 Ga0070666_10251600 Ga0070666_102516002 151
49 3300005366 Ga0070659_100571590 Ga0070659_1005715901 151
50 3300005457 Ga0070662_100156903 Ga0070662_1001569032 151
51 3300005578 Ga0068854_100156364 Ga0068854_1001563642 151
52 3300005617 Ga0068859_100241953 Ga0068859_1002419533 151
53 3300005840 Ga0068870_11044935 Ga0068870_110449351 151
54 3300006048 Ga0075363_100181498 Ga0075363_1001814982 151
55 3300006051 Ga0075364_10291262 Ga0075364_102912622 151
56 3300006177 Ga0075362_10094050 Ga0075362_100940502 151
57 3300006178 Ga0075367_10077015 Ga0075367_100770154 151
58 3300006178 Ga0075367_10083192 Ga0075367_100831922 151
59 3300006186 Ga0075369_10098976 Ga0075369_100989762 151
60 3300006195 Ga0075366_10101191 Ga0075366_101011912 151
61 3300006353 Ga0075370_10018029 Ga0075370_100180294 151
62 3300006353 Ga0075370_10092832 Ga0075370_100928322 151
63 3300006931 Ga0097620_100241950 Ga0097620_1002419502 151
64 3300009093 Ga0105240_10219220 Ga0105240_102192203 151
65 3300009147 Ga0114129_10603779 Ga0114129_106037792 151
66 3300009148 Ga0105243_10091179 Ga0105243_100911793 151
67 3300009174 Ga0105241_10401147 Ga0105241_104011472 151
68 3300009545 Ga0105237_10065829 Ga0105237_100658292 151
69 3300025903 Ga0207680_10211839 Ga0207680_102118392 151
70 3300025907 Ga0207645_10754422 Ga0207645_107544222 151
71 3300025913 Ga0207695_10157790 Ga0207695_101577902 151
72 3300025914 Ga0207671_10037204 Ga0207671_100372044 151
73 3300025932 Ga0207690_10539978 Ga0207690_105399782 151
74 3300025933 Ga0207706_10051296 Ga0207706_100512964 151
75 3300025935 Ga0207709_10317025 Ga0207709_103170252 151
76 3300026067 Ga0207678_10325980 Ga0207678_103259802 151
77 3300026116 Ga0207674_10070275 Ga0207674_100702755 151
78 3300039437 Ga0436365_1016022 Ga0436365_1016022_2298_2837 151
79 3300046538 Ga0495609_0425599 Ga0495609_0425599_20_475 151
80 3300050489 nmdc:mga03683_5230_c2 nmdc:mga03683_5230_c2_3000_3455 151
81 3300050489 nmdc:mga03683_66314_c1 nmdc:mga03683_66314_c1_195_650 151
82 3300050490 nmdc:mga03n38_316960_c1 nmdc:mga03n38_316960_c1_208_663 151
83 3300050493 nmdc:mga0k408_40048_c2 nmdc:mga0k408_40048_c2_688_1143 151
84 3300050494 nmdc:mga06z11_539743_c1 nmdc:mga06z11_539743_c1_223_678 151
85 3300050495 nmdc:mga04h51_481625_c1 nmdc:mga04h51_481625_c1_49_504 151
86 3300050496 nmdc:mga07m45_4813_c2 nmdc:mga07m45_4813_c2_688_1143 151
87 3300050496 nmdc:mga07m45_6246_c1 nmdc:mga07m45_6246_c1_1228_1683 151
88 3300050507 nmdc:mga05p37_836115_c1 nmdc:mga05p37_836115_c1_74_529 151
89 3300050516 nmdc:mga0sz30_114525_c1 nmdc:mga0sz30_114525_c1_457_912 151
90 3300003187 JGI25151J46595_10003197 JGI25151J46595_100031973 152
91 3300003773 Ga0055537_1000803 Ga0055537_100080316 152
92 3300003784 Ga0055534_1000737 Ga0055534_100073716 152
93 3300003790 Ga0055528_1002614 Ga0055528_10026142 152
94 3300003790 Ga0055528_1018969 Ga0055528_10189693 152
95 3300005343 Ga0070687_100371503 Ga0070687_1003715031 152
96 3300005347 Ga0070668_100721999 Ga0070668_1007219991 152
97 3300005353 Ga0070669_100987037 Ga0070669_1009870371 152
98 3300005354 Ga0070675_100654407 Ga0070675_1006544072 152
99 3300005356 Ga0070674_100849256 Ga0070674_1008492562 152
100 3300005459 Ga0068867_100494419 Ga0068867_1004944191 152
101 3300005539 Ga0068853_100478226 Ga0068853_1004782262 152
102 3300005546 Ga0070696_100182176 Ga0070696_1001821762 152
103 3300005578 Ga0068854_100547046 Ga0068854_1005470462 152
104 3300005617 Ga0068859_101291340 Ga0068859_1012913401 152
105 3300005844 Ga0068862_100040816 Ga0068862_1000408165 152
106 3300005844 Ga0068862_100071485 Ga0068862_1000714852 152
107 3300006038 Ga0075365_10083453 Ga0075365_100834533 152
108 3300006048 Ga0075363_100025864 Ga0075363_1000258642 152
109 3300006048 Ga0075363_100493171 Ga0075363_1004931711 152
110 3300006051 Ga0075364_10059750 Ga0075364_100597503 152
111 3300006058 Ga0075432_10022678 Ga0075432_100226781 152
112 3300006177 Ga0075362_10033706 Ga0075362_100337062 152
113 3300006177 Ga0075362_10046786 Ga0075362_100467862 152
114 3300006195 Ga0075366_10021049 Ga0075366_100210495 152
115 3300006195 Ga0075366_10026840 Ga0075366_100268403 152
116 3300006237 Ga0097621_100222044 Ga0097621_1002220441 152
117 3300006353 Ga0075370_10022330 Ga0075370_100223302 152
118 3300006353 Ga0075370_10028347 Ga0075370_100283472 152
119 3300006353 Ga0075370_10091848 Ga0075370_100918482 152
120 3300006358 Ga0068871_100131217 Ga0068871_1001312172 152
121 3300006844 Ga0075428_100503250 Ga0075428_1005032502 152
122 3300006880 Ga0075429_101402731 Ga0075429_1014027311 152
123 3300006931 Ga0097620_101291696 Ga0097620_1012916961 152
124 3300006948 Ga0099826_10036978 Ga0099826_100369782 152
125 3300009098 Ga0105245_10029116 Ga0105245_100291163 152
126 3300009098 Ga0105245_10527449 Ga0105245_105274492 152
127 3300009147 Ga0114129_10086883 Ga0114129_100868831 152
128 3300009148 Ga0105243_10045095 Ga0105243_100450953 152
129 3300009148 Ga0105243_11817283 Ga0105243_118172831 152
130 3300009177 Ga0105248_10073765 Ga0105248_100737652 152
131 3300010375 Ga0105239_10020652 Ga0105239_100206522 152
132 3300010375 Ga0105239_10204971 Ga0105239_102049713 152
133 3300011119 Ga0105246_10321099 Ga0105246_103210993 152
134 3300013306 Ga0163162_10947657 Ga0163162_109476572 152
135 3300014497 Ga0182008_10123703 Ga0182008_101237032 152
136 3300014969 Ga0157376_10123539 Ga0157376_101235394 152
137 3300014969 Ga0157376_10190003 Ga0157376_101900033 152
138 3300017792 Ga0163161_10000874 Ga0163161_1000087412 152
139 3300017792 Ga0163161_10021800 Ga0163161_100218003 152
140 3300025263 Ga0209565_1000058 Ga0209565_10000582 152
141 3300025273 Ga0209673_1000053 Ga0209673_100005378 152
142 3300025273 Ga0209673_1004074 Ga0209673_10040742 152
143 3300025291 Ga0209675_1000010 Ga0209675_1000010359 152
144 3300025294 Ga0209025_1000129 Ga0209025_1000129195 152
145 3300025294 Ga0209025_1020184 Ga0209025_10201842 152
146 3300025923 Ga0207681_11128599 Ga0207681_111285991 152
147 3300025933 Ga0207706_10855666 Ga0207706_108556661 152
148 3300025940 Ga0207691_10259339 Ga0207691_102593392 152
149 3300025941 Ga0207711_10021332 Ga0207711_100213325 152
150 3300025941 Ga0207711_10040696 Ga0207711_100406962 152
151 3300025942 Ga0207689_10037650 Ga0207689_100376506 152
152 3300025981 Ga0207640_10498090 Ga0207640_104980902 152
153 3300025986 Ga0207658_10133548 Ga0207658_101335483 152
154 3300026118 Ga0207675_100755525 Ga0207675_1007555252 152
155 3300026121 Ga0207683_11023832 Ga0207683_110238322 152
156 3300027666 Ga0209282_1011618 Ga0209282_10116182 152
157 3300028380 Ga0268265_10017606 Ga0268265_100176063 152
158 3300028380 Ga0268265_10152692 Ga0268265_101526922 152
159 3300030744 Ga0316181_1216941 Ga0316181_12169412 152
160 3300031548 Ga0307408_100097584 Ga0307408_1000975842 152
161 3300031548 Ga0307408_100434285 Ga0307408_1004342851 152
162 3300031548 Ga0307408_100535007 Ga0307408_1005350073 152
163 3300031548 Ga0307408_100571668 Ga0307408_1005716682 152
164 3300031731 Ga0307405_10142011 Ga0307405_101420113 152
165 3300031731 Ga0307405_10245240 Ga0307405_102452401 152
166 3300031824 Ga0307413_10065151 Ga0307413_100651512 152
167 3300031852 Ga0307410_10284539 Ga0307410_102845393 152
168 3300031852 Ga0307410_10450347 Ga0307410_104503472 152
169 3300031901 Ga0307406_10072488 Ga0307406_100724882 152
170 3300031901 Ga0307406_10853443 Ga0307406_108534432 152
171 3300031903 Ga0307407_10019655 Ga0307407_100196553 152
172 3300031911 Ga0307412_10002721 Ga0307412_1000272110 152
173 3300031911 Ga0307412_10039833 Ga0307412_100398333 152
174 3300031911 Ga0307412_10573295 Ga0307412_105732952 152
175 3300032002 Ga0307416_100065798 Ga0307416_1000657983 152
176 3300032004 Ga0307414_10065139 Ga0307414_100651392 152
177 3300032004 Ga0307414_11069656 Ga0307414_110696561 152
178 3300032005 Ga0307411_10058037 Ga0307411_100580373 152
179 3300032005 Ga0307411_11058557 Ga0307411_110585572 152
180 3300035691 Ga0373931_0324145 Ga0373931_0324145_480_947 152
181 3300041459 Ga0451800_1030749 Ga0451800_1030749_197_655 152
182 3300041486 Ga0451807_1136509 Ga0451807_1136509_31_489 152
183 3300042131 Ga0450894_010472 Ga0450894_010472_95_580 152
184 3300042145 Ga0450906_001486 Ga0450906_001486_3392_3877 152
185 3300045051 Ga0451576_0451760 Ga0451576_0451760_286_753 152
186 3300046459 Ga0495629_0285871 Ga0495629_0285871_597_1082 152
187 3300046515 Ga0495620_0118593 Ga0495620_0118593_446_931 152
188 3300046660 Ga0495625_0000411 Ga0495625_0000411_48245_48703 152
189 3300046674 Ga0495588_0020757 Ga0495588_0020757_1207_1692 152
190 3300046674 Ga0495588_0043028 Ga0495588_0043028_1533_1991 152
191 3300046684 Ga0495669_0091877 Ga0495669_0091877_565_1023 152
192 3300048089 Ga0495614_0161695 Ga0495614_0161695_334_819 152
193 3300048905 Ga0496102_0122430 Ga0496102_0122430_1590_2051 152
194 3300048906 Ga0496103_0205390 Ga0496103_0205390_584_1045 152
195 3300048909 Ga0496106_0244652 Ga0496106_0244652_207_668 152
196 3300048911 Ga0496108_1265489 Ga0496108_1265489_123_584 152
197 3300048916 Ga0496113_0256483 Ga0496113_0256483_396_857 152
198 3300049583 Ga0501067_0470568 Ga0501067_0470568_177_638 152
199 3300049661 Ga0501217_118731 Ga0501217_118731_226_711 152
200 3300050489 nmdc:mga03683_32511_c1 nmdc:mga03683_32511_c1_1020_1505 152
201 3300050489 nmdc:mga03683_4015_c1 nmdc:mga03683_4015_c1_2572_3030 152
202 3300050490 nmdc:mga03n38_10906_c1 nmdc:mga03n38_10906_c1_1616_2101 152
203 3300050490 nmdc:mga03n38_3580_c1 nmdc:mga03n38_3580_c1_3894_4352 152
204 3300050491 nmdc:mga00v17_14438_c1 nmdc:mga00v17_14438_c1_3026_3484 152
205 3300050491 nmdc:mga00v17_355643_c1 nmdc:mga00v17_355643_c1_252_710 152
206 3300050492 nmdc:mga0yw44_22052_c1 nmdc:mga0yw44_22052_c1_1050_1508 152
207 3300050493 nmdc:mga0k408_36530_c1 nmdc:mga0k408_36530_c1_650_1108 152
208 3300050493 nmdc:mga0k408_36926_c1 nmdc:mga0k408_36926_c1_506_964 152
209 3300050496 nmdc:mga07m45_18238_c1 nmdc:mga07m45_18238_c1_742_1200 152
210 3300050496 nmdc:mga07m45_772_c2 nmdc:mga07m45_772_c2_3371_3829 152
211 3300050496 nmdc:mga07m45_94642_c1 nmdc:mga07m45_94642_c1_1003_1488 152
212 3300053121 Ga0500607_004247 Ga0500607_004247_2066_2551 152
213 3300053122 Ga0500608_003303 Ga0500608_003303_788_1246 152
214 3300053158 Ga0500627_0002538 Ga0500627_0002538_2528_3013 152
215 3300054114 Ga0501084_0473942 Ga0501084_0473942_492_953 152
216 iso_pu_bacteria 2643221628 2644162437 152
217 3300002739 JGI25158J39367_1009816 JGI25158J39367_10098162 153
218 3300002773 JGI25152J39213_1029597 JGI25152J39213_10295971 153
219 3300003187 JGI25151J46595_10012847 JGI25151J46595_100128474 153
220 3300003187 JGI25151J46595_10014111 JGI25151J46595_100141114 153
221 3300003215 JGI25153J46596_10010005 JGI25153J46596_100100054 153
222 3300003215 JGI25153J46596_10023608 JGI25153J46596_100236081 153
223 3300003354 JGI25160J50197_1007653 JGI25160J50197_10076532 153
224 3300003374 JGI25161J50226_1003587 JGI25161J50226_10035874 153
225 3300003578 Ga0006562J51391_1041595 Ga0006562J51391_10415952 153
226 3300003578 Ga0006562J51391_1041597 Ga0006562J51391_10415973 153
227 3300003761 Ga0055535_1000936 Ga0055535_100093610 153
228 3300003762 Ga0055542_1000009 Ga0055542_100000910 153
229 3300003771 Ga0055526_1002633 Ga0055526_10026337 153
230 3300003773 Ga0055537_1008860 Ga0055537_10088602 153
231 3300003775 Ga0055524_1001750 Ga0055524_10017505 153
232 3300003781 Ga0055536_1010243 Ga0055536_10102432 153
233 3300003781 Ga0055536_1010753 Ga0055536_10107532 153
234 3300003784 Ga0055534_1000464 Ga0055534_100046414 153
235 3300003784 Ga0055534_1008718 Ga0055534_10087182 153
236 3300003790 Ga0055528_1025333 Ga0055528_10253332 153
237 3300003791 Ga0055530_10004760 Ga0055530_100047607 153
238 3300003792 Ga0055540_1008394 Ga0055540_10083944 153
239 3300003792 Ga0055540_1008794 Ga0055540_10087944 153
240 3300003794 Ga0055531_10013379 Ga0055531_100133794 153
241 3300004625 Ga0055543_1016694 Ga0055543_10166941 153
242 3300005262 Ga0065165_1031179 Ga0065165_10311792 153
243 3300005327 Ga0070658_10020447 Ga0070658_100204473 153
244 3300005327 Ga0070658_10057949 Ga0070658_100579491 153
245 3300005329 Ga0070683_100077767 Ga0070683_1000777675 153
246 3300005330 Ga0070690_100000646 Ga0070690_1000006466 153
247 3300005334 Ga0068869_100001009 Ga0068869_10000100918 153
248 3300005335 Ga0070666_10048250 Ga0070666_100482504 153
249 3300005335 Ga0070666_10388744 Ga0070666_103887442 153
250 3300005336 Ga0070680_100000674 Ga0070680_1000006749 153
251 3300005337 Ga0070682_100006371 Ga0070682_1000063714 153
252 3300005338 Ga0068868_100258025 Ga0068868_1002580252 153
253 3300005340 Ga0070689_100000268 Ga0070689_10000026830 153
254 3300005341 Ga0070691_10001428 Ga0070691_100014284 153
255 3300005343 Ga0070687_100000048 Ga0070687_10000004818 153
256 3300005344 Ga0070661_100011317 Ga0070661_10001131710 153
257 3300005345 Ga0070692_10046425 Ga0070692_100464252 153
258 3300005353 Ga0070669_100509330 Ga0070669_1005093302 153
259 3300005355 Ga0070671_100117818 Ga0070671_1001178182 153
260 3300005356 Ga0070674_100704024 Ga0070674_1007040241 153
261 3300005365 Ga0070688_100058558 Ga0070688_1000585584 153
262 3300005366 Ga0070659_100041646 Ga0070659_1000416462 153
263 3300005406 Ga0070703_10026136 Ga0070703_100261364 153
264 3300005438 Ga0070701_10000195 Ga0070701_1000019517 153
265 3300005440 Ga0070705_100007293 Ga0070705_1000072932 153
266 3300005441 Ga0070700_100000690 Ga0070700_1000006902 153
267 3300005444 Ga0070694_100000087 Ga0070694_10000008718 153
268 3300005445 Ga0070708_100175028 Ga0070708_1001750282 153
269 3300005456 Ga0070678_100165061 Ga0070678_1001650614 153
270 3300005456 Ga0070678_100459805 Ga0070678_1004598051 153
271 3300005457 Ga0070662_100419932 Ga0070662_1004199323 153
272 3300005458 Ga0070681_10021312 Ga0070681_100213124 153
273 3300005459 Ga0068867_100000743 Ga0068867_10000074320 153
274 3300005459 Ga0068867_100653559 Ga0068867_1006535592 153
275 3300005467 Ga0070706_100007766 Ga0070706_1000077665 153
276 3300005468 Ga0070707_100015148 Ga0070707_1000151488 153
277 3300005471 Ga0070698_100560917 Ga0070698_1005609171 153
278 3300005530 Ga0070679_100028709 Ga0070679_1000287095 153
279 3300005530 Ga0070679_100260823 Ga0070679_1002608232 153
280 3300005536 Ga0070697_100240960 Ga0070697_1002409604 153
281 3300005544 Ga0070686_100000674 Ga0070686_1000006744 153
282 3300005545 Ga0070695_100004962 Ga0070695_1000049622 153
283 3300005546 Ga0070696_100000013 Ga0070696_10000001353 153
284 3300005546 Ga0070696_100034489 Ga0070696_1000344892 153
285 3300005547 Ga0070693_100000251 Ga0070693_10000025123 153
286 3300005549 Ga0070704_100000029 Ga0070704_10000002918 153
287 3300005563 Ga0068855_100017210 Ga0068855_1000172105 153
288 3300005563 Ga0068855_100064296 Ga0068855_1000642962 153
289 3300005564 Ga0070664_100181175 Ga0070664_1001811752 153
290 3300005564 Ga0070664_101428686 Ga0070664_1014286861 153
291 3300005577 Ga0068857_100102100 Ga0068857_1001021005 153
292 3300005578 Ga0068854_100005685 Ga0068854_1000056857 153
293 3300005578 Ga0068854_100036071 Ga0068854_1000360715 153
294 3300005614 Ga0068856_100005419 Ga0068856_1000054194 153
295 3300005615 Ga0070702_100000067 Ga0070702_10000006729 153
296 3300005616 Ga0068852_100002793 Ga0068852_10000279311 153
297 3300005616 Ga0068852_100055815 Ga0068852_1000558154 153
298 3300005616 Ga0068852_100562461 Ga0068852_1005624612 153
299 3300005617 Ga0068859_100000991 Ga0068859_10000099130 153
300 3300005618 Ga0068864_101160527 Ga0068864_1011605272 153
301 3300005718 Ga0068866_10000090 Ga0068866_1000009035 153
302 3300005718 Ga0068866_10162030 Ga0068866_101620302 153
303 3300005719 Ga0068861_100000135 Ga0068861_10000013533 153
304 3300005719 Ga0068861_100787126 Ga0068861_1007871261 153
305 3300005834 Ga0068851_10002702 Ga0068851_100027023 153
306 3300005834 Ga0068851_10126399 Ga0068851_101263992 153
307 3300005840 Ga0068870_10006289 Ga0068870_100062895 153
308 3300005841 Ga0068863_100649431 Ga0068863_1006494312 153
309 3300005842 Ga0068858_100001862 Ga0068858_1000018625 153
310 3300005843 Ga0068860_100000929 Ga0068860_1000009295 153
311 3300005844 Ga0068862_100000755 Ga0068862_1000007554 153
312 3300005844 Ga0068862_100031163 Ga0068862_1000311634 153
313 3300005985 Ga0081539_10201219 Ga0081539_102012192 153
314 3300006177 Ga0075362_10032639 Ga0075362_100326392 153
315 3300006195 Ga0075366_10007074 Ga0075366_100070743 153
316 3300006195 Ga0075366_10039155 Ga0075366_100391553 153
317 3300006195 Ga0075366_10322708 Ga0075366_103227082 153
318 3300006237 Ga0097621_100000024 Ga0097621_10000002449 153
319 3300006237 Ga0097621_100120450 Ga0097621_1001204503 153
320 3300006353 Ga0075370_10113636 Ga0075370_101136362 153
321 3300006353 Ga0075370_10253741 Ga0075370_102537412 153
322 3300006358 Ga0068871_100001646 Ga0068871_1000016468 153
323 3300006847 Ga0075431_100567515 Ga0075431_1005675151 153
324 3300006931 Ga0097620_100000991 Ga0097620_10000099130 153
325 3300009036 Ga0105244_10069982 Ga0105244_100699822 153
326 3300009092 Ga0105250_10120620 Ga0105250_101206202 153
327 3300009093 Ga0105240_10138320 Ga0105240_101383202 153
328 3300009093 Ga0105240_10335186 Ga0105240_103351862 153
329 3300009094 Ga0111539_11802153 Ga0111539_118021531 153
330 3300009098 Ga0105245_10001679 Ga0105245_100016794 153
331 3300009147 Ga0114129_10770314 Ga0114129_107703142 153
332 3300009148 Ga0105243_10000727 Ga0105243_100007275 153
333 3300009148 Ga0105243_10003205 Ga0105243_1000320511 153
334 3300009174 Ga0105241_10014245 Ga0105241_100142454 153
335 3300009174 Ga0105241_11322101 Ga0105241_113221012 153
336 3300009176 Ga0105242_10000416 Ga0105242_1000041617 153
337 3300009177 Ga0105248_10163232 Ga0105248_101632324 153
338 3300009545 Ga0105237_10015889 Ga0105237_100158897 153
339 3300009545 Ga0105237_11378951 Ga0105237_113789511 153
340 3300009551 Ga0105238_10173158 Ga0105238_101731584 153
341 3300009553 Ga0105249_10041364 Ga0105249_100413642 153
342 3300010375 Ga0105239_10023015 Ga0105239_100230154 153
343 3300010375 Ga0105239_10256810 Ga0105239_102568102 153
344 3300010375 Ga0105239_12302826 Ga0105239_123028261 153
345 3300011119 Ga0105246_10037944 Ga0105246_100379444 153
346 3300011119 Ga0105246_10204552 Ga0105246_102045522 153
347 3300013102 Ga0157371_10233827 Ga0157371_102338272 153
348 3300013104 Ga0157370_10027764 Ga0157370_100277642 153
349 3300013104 Ga0157370_11101435 Ga0157370_111014351 153
350 3300013104 Ga0157370_11395746 Ga0157370_113957461 153
351 3300013105 Ga0157369_10001553 Ga0157369_100015533 153
352 3300013296 Ga0157374_10049346 Ga0157374_100493462 153
353 3300013297 Ga0157378_10019175 Ga0157378_100191755 153
354 3300013307 Ga0157372_10164514 Ga0157372_101645143 153
355 3300014326 Ga0157380_10010589 Ga0157380_100105896 153
356 3300014497 Ga0182008_10049539 Ga0182008_100495392 153
357 3300014969 Ga0157376_10000935 Ga0157376_100009354 153
358 3300017792 Ga0163161_10024220 Ga0163161_100242205 153
359 3300025208 Ga0209436_111189 Ga0209436_1111892 153
360 3300025228 Ga0209672_100898 Ga0209672_1008989 153
361 3300025229 Ga0209147_100876 Ga0209147_1008766 153
362 3300025242 Ga0209258_100009 Ga0209258_100009640 153
363 3300025245 Ga0207425_1003371 Ga0207425_10033712 153
364 3300025254 Ga0209148_1000007 Ga0209148_1000007640 153
365 3300025258 Ga0209129_1002572 Ga0209129_10025722 153
366 3300025258 Ga0209129_1006372 Ga0209129_10063724 153
367 3300025263 Ga0209565_1001206 Ga0209565_10012067 153
368 3300025273 Ga0209673_1000245 Ga0209673_100024574 153
369 3300025284 Ga0209130_1000806 Ga0209130_100080611 153
370 3300025284 Ga0209130_1001044 Ga0209130_10010447 153
371 3300025284 Ga0209130_1022794 Ga0209130_10227942 153
372 3300025291 Ga0209675_1003105 Ga0209675_10031056 153
373 3300025292 Ga0209676_1000108 Ga0209676_100010874 153
374 3300025292 Ga0209676_1001763 Ga0209676_10017634 153
375 3300025292 Ga0209676_1011115 Ga0209676_10111154 153
376 3300025294 Ga0209025_1018749 Ga0209025_10187494 153
377 3300025294 Ga0209025_1019026 Ga0209025_10190264 153
378 3300025295 Ga0209564_1000926 Ga0209564_100092612 153
379 3300025297 Ga0209758_1004323 Ga0209758_10043235 153
380 3300025298 Ga0209050_1000002 Ga0209050_1000002332 153
381 3300025298 Ga0209050_1026573 Ga0209050_10265733 153
382 3300025299 Ga0209256_1000077 Ga0209256_1000077233 153
383 3300025302 Ga0207426_1000129 Ga0207426_100012925 153
384 3300025303 Ga0209051_1000002 Ga0209051_1000002100 153
385 3300025303 Ga0209051_1000956 Ga0209051_10009569 153
386 3300025303 Ga0209051_1007087 Ga0209051_10070878 153
387 3300025304 Ga0209257_1000002 Ga0209257_1000002241 153
388 3300025304 Ga0209257_1009481 Ga0209257_10094812 153
389 3300025304 Ga0209257_1013005 Ga0209257_10130052 153
390 3300025321 Ga0207656_10045285 Ga0207656_100452852 153
391 3300025321 Ga0207656_10172538 Ga0207656_101725382 153
392 3300025885 Ga0207653_10004459 Ga0207653_100044591 153
393 3300025901 Ga0207688_10702356 Ga0207688_107023561 153
394 3300025904 Ga0207647_10048131 Ga0207647_100481312 153
395 3300025909 Ga0207705_10019231 Ga0207705_100192315 153
396 3300025909 Ga0207705_10217461 Ga0207705_102174612 153
397 3300025912 Ga0207707_10028528 Ga0207707_100285286 153
398 3300025913 Ga0207695_10261071 Ga0207695_102610712 153
399 3300025914 Ga0207671_10069967 Ga0207671_100699672 153
400 3300025917 Ga0207660_10001515 Ga0207660_100015157 153
401 3300025918 Ga0207662_10000034 Ga0207662_1000003440 153
402 3300025920 Ga0207649_10036387 Ga0207649_100363874 153
403 3300025921 Ga0207652_10002453 Ga0207652_100024534 153
404 3300025921 Ga0207652_10395593 Ga0207652_103955932 153
405 3300025925 Ga0207650_10018410 Ga0207650_100184104 153
406 3300025927 Ga0207687_10000943 Ga0207687_1000094320 153
407 3300025931 Ga0207644_10002881 Ga0207644_1000288122 153
408 3300025931 Ga0207644_10083002 Ga0207644_100830024 153
409 3300025932 Ga0207690_10585125 Ga0207690_105851252 153
410 3300025933 Ga0207706_10527293 Ga0207706_105272932 153
411 3300025934 Ga0207686_10000316 Ga0207686_100003164 153
412 3300025935 Ga0207709_10000388 Ga0207709_1000038832 153
413 3300025935 Ga0207709_10000553 Ga0207709_1000055311 153
414 3300025935 Ga0207709_10002648 Ga0207709_1000264813 153
415 3300025936 Ga0207670_10000402 Ga0207670_100004028 153
416 3300025938 Ga0207704_10226195 Ga0207704_102261951 153
417 3300025942 Ga0207689_10000336 Ga0207689_1000033629 153
418 3300025944 Ga0207661_10753263 Ga0207661_107532632 153
419 3300025945 Ga0207679_10067242 Ga0207679_100672421 153
420 3300025949 Ga0207667_10030708 Ga0207667_100307085 153
421 3300025949 Ga0207667_10040911 Ga0207667_100409114 153
422 3300025960 Ga0207651_10387881 Ga0207651_103878812 153
423 3300025961 Ga0207712_10021577 Ga0207712_100215774 153
424 3300025972 Ga0207668_10859651 Ga0207668_108596512 153
425 3300025972 Ga0207668_11119821 Ga0207668_111198212 153
426 3300025981 Ga0207640_10000724 Ga0207640_1000072418 153
427 3300025981 Ga0207640_10116657 Ga0207640_101166572 153
428 3300026023 Ga0207677_10301961 Ga0207677_103019612 153
429 3300026035 Ga0207703_10002469 Ga0207703_100024695 153
430 3300026067 Ga0207678_10719712 Ga0207678_107197122 153
431 3300026075 Ga0207708_10000048 Ga0207708_10000048119 153
432 3300026078 Ga0207702_10175021 Ga0207702_101750214 153
433 3300026088 Ga0207641_10074700 Ga0207641_100747004 153
434 3300026089 Ga0207648_10000519 Ga0207648_1000051920 153
435 3300026089 Ga0207648_10178672 Ga0207648_101786722 153
436 3300026089 Ga0207648_10578088 Ga0207648_105780882 153
437 3300026095 Ga0207676_11019957 Ga0207676_110199572 153
438 3300026118 Ga0207675_100000464 Ga0207675_10000046439 153
439 3300026142 Ga0207698_10080991 Ga0207698_100809913 153
440 3300027552 Ga0209982_1029699 Ga0209982_10296991 153
441 3300028380 Ga0268265_10012498 Ga0268265_100124985 153
442 3300028380 Ga0268265_10170422 Ga0268265_101704223 153
443 3300028381 Ga0268264_10000423 Ga0268264_1000042330 153
444 3300030742 Ga0316183_1067836 Ga0316183_10678362 153
445 3300030745 Ga0316182_1142928 Ga0316182_11429285 153
446 3300030745 Ga0316182_1290173 Ga0316182_12901732 153
447 3300031548 Ga0307408_100350941 Ga0307408_1003509412 153
448 3300031548 Ga0307408_100797892 Ga0307408_1007978922 153
449 3300031731 Ga0307405_10048587 Ga0307405_100485871 153
450 3300031731 Ga0307405_10568207 Ga0307405_105682072 153
451 3300031824 Ga0307413_10885742 Ga0307413_108857421 153
452 3300031911 Ga0307412_10432289 Ga0307412_104322891 153
453 3300031911 Ga0307412_10624380 Ga0307412_106243802 153
454 3300032002 Ga0307416_100311767 Ga0307416_1003117672 153
455 3300032002 Ga0307416_103539710 Ga0307416_1035397101 153
456 3300035083 Ga0373926_0120476 Ga0373926_0120476_240_713 153
457 3300035088 Ga0373940_0190594 Ga0373940_0190594_106_579 153
458 3300035170 Ga0373943_0071078 Ga0373943_0071078_731_1195 153
459 3300035170 Ga0373943_0308915 Ga0373943_0308915_196_669 153
460 3300035171 Ga0373946_0210252 Ga0373946_0210252_357_839 153
461 3300035691 Ga0373931_0029909 Ga0373931_0029909_198_671 153
462 3300035692 Ga0373935_0287981 Ga0373935_0287981_307_780 153
463 3300035695 Ga0373927_0317132 Ga0373927_0317132_26_499 153
464 3300035725 Ga0373947_0090114 Ga0373947_0090114_250_723 153
465 3300036401 Ga0373937_0945247 Ga0373937_0945247_149_631 153
466 3300037068 Ga0373925_0042247 Ga0373925_0042247_2776_3249 153
467 3300037068 Ga0373925_0444950 Ga0373925_0444950_263_730 153
468 3300037418 Ga0395900_0154502 Ga0395900_0154502_1352_1813 153
469 3300037471 Ga0395905_0106865 Ga0395905_0106865_1798_2307 153
470 3300037471 Ga0395905_0908702 Ga0395905_0908702_135_596 153
471 3300038443 Ga0395901_0100040 Ga0395901_0100040_199_660 153
472 3300039438 Ga0436360_0709777 Ga0436360_0709777_375_839 153
473 3300041486 Ga0451807_1045108 Ga0451807_1045108_799_1281 153
474 3300046460 Ga0495638_0012398 Ga0495638_0012398_3703_4197 153
475 3300046513 Ga0495616_0001362 Ga0495616_0001362_11997_12491 153
476 3300046518 Ga0495631_0000088 Ga0495631_0000088_49520_50014 153
477 3300046525 Ga0495663_0219769 Ga0495663_0219769_76_570 153
478 3300046526 Ga0495666_0048323 Ga0495666_0048323_1232_1696 153
479 3300046530 Ga0495654_0011502 Ga0495654_0011502_1811_2305 153
480 3300046539 Ga0495621_0020600 Ga0495621_0020600_640_1134 153
481 3300046691 Ga0495670_0221100 Ga0495670_0221100_273_767 153
482 3300048905 Ga0496102_0631552 Ga0496102_0631552_59_520 153
483 3300048907 Ga0496104_0014858 Ga0496104_0014858_2584_3066 153
484 3300048908 Ga0496105_0014980 Ga0496105_0014980_766_1248 153
485 3300048918 Ga0496115_0506038 Ga0496115_0506038_376_873 153
486 3300048920 Ga0496117_0102284 Ga0496117_0102284_1202_1666 153
487 3300048921 Ga0496118_0019588 Ga0496118_0019588_3476_3982 153
488 3300048921 Ga0496118_0162685 Ga0496118_0162685_251_715 153
489 3300048924 Ga0496121_0160478 Ga0496121_0160478_164_658 153
490 3300048926 Ga0496123_0076828 Ga0496123_0076828_892_1386 153
491 3300048926 Ga0496123_0454887 Ga0496123_0454887_20_526 153
492 3300048927 Ga0496124_0079241 Ga0496124_0079241_2104_2568 153
493 3300048927 Ga0496124_0091532 Ga0496124_0091532_1081_1542 153
494 3300049572 Ga0501036_1461768 Ga0501036_1461768_44_508 153
495 3300049586 Ga0501070_0325148 Ga0501070_0325148_669_1145 153
496 3300049767 Ga0501270_015525 Ga0501270_015525_519_986 153
497 3300049779 Ga0501283_011468 Ga0501283_011468_506_1000 153
498 3300050493 nmdc:mga0k408_120526_c1 nmdc:mga0k408_120526_c1_402_869 153
499 3300050493 nmdc:mga0k408_40196_c1 nmdc:mga0k408_40196_c1_511_975 153
500 3300050496 nmdc:mga07m45_176889_c1 nmdc:mga07m45_176889_c1_158_622 153
501 3300050496 nmdc:mga07m45_310634_c1 nmdc:mga07m45_310634_c1_345_839 153
502 3300050496 nmdc:mga07m45_87343_c1 nmdc:mga07m45_87343_c1_1012_1476 153
503 3300053108 Ga0500562_011450 Ga0500562_011450_513_1007 153
504 3300053118 Ga0500594_0000826 Ga0500594_0000826_3720_4214 153
505 3300053128 Ga0500626_057781 Ga0500626_057781_171_677 153
506 3300053130 Ga0500642_0233543 Ga0500642_0233543_315_779 153
507 3300053134 Ga0500658_0037737 Ga0500658_0037737_906_1400 153
508 3300053136 Ga0500559_0221759 Ga0500559_0221759_163_669 153
509 3300053139 Ga0500568_0061919 Ga0500568_0061919_833_1327 153
510 3300053141 Ga0500574_071825 Ga0500574_071825_247_753 153
511 3300053153 Ga0500616_0006416 Ga0500616_0006416_1909_2403 153
512 3300059421 Ga0590071_009838 Ga0590071_009838_1146_1619 153
513 3300059424 Ga0590075_015247 Ga0590075_015247_962_1435 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

30

170

0.9

PF00149

Metallophos

Calcineurin-like phosphoesterase

30

122

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.8393 2 152
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.8339 2 152
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.824 2 152
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.8187 2 152
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8172 2 149
ID Description Score Start End Superfamily
af_Q8IKJ1_766_1052_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.878 91 123 3.60.21.10
af_Q86D99_1_187_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8628 2 152 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8548 2 149 3.60.21.10
af_Q4DWH1_2_191_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8518 2 148 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8484 2 150 3.60.21.10
ID Description Score Start End GO Terms
AF-Q5H6H3-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 1.007 4 57
AF-A0A4Q3IZT0-F1-model_v4 deleted 1.004 1 74
AF-A0A0Q7CTK0-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9983 1 153 GO:0016787
GO:0046872
AF-A0A562QFC2-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9979 2 152 GO:0016787
GO:0046872
AF-A0A3D0DRH1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9962 2 153 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.8 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map