F457725

General Info

Members Datasets Scaffolds Average Seq Length
514 217 512 403

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10089766|Ga0207647_100897662
Length 482
Sequence MPPSPIRKLVPFAEAAKKKGIRVFHLNIGQPDIETPPAILDAVRKADIKVLEYSHSAGNESYRRKLVTYYKKVGIDVNYDQIIITTGGSEAIQFGFFTCFDQGDEVIIPEPFYANYNGFAVTAGVKVIPITSHIENGFALPPIEDFEKLVTAKTRAIIICSPNNPTGYLYSRSEMEALKKICLKHNLYLFSDEAYREFCYDGDYVSAMHLQGMEENVVLMDTISKRYSACGARIGAFVTKNKAVYDAAMKFAQARLSPPGLAQILGEAAVDLPEHYFDEPKAEYMARRDLLVSRLNKMPGVFCPNPGGAFYAMAKLPIDDSDKFCQWLLESFSYKDQTVMLAPATGFYGTTGLGKNEVRLAYVLNLEAINAAMDCLERALQQYPGKQEKNFAASIPATSDSPRWPRRAALSHCHPAAVAVNTPSRRSALSSSTVSYGLPDVCGSITSARSADVAGSACSISATMVIVTDTGRLANRRSRTPG

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
203 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
204 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
215 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0.39
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10003888 3300002077 Unclassified 3082
2 JGI24751J29686_10000595 3300002459 Bacteria 9653
3 JGI25406J46586_10004319 3300003203 Bacteria 6630
4 rootH2_10061340 3300003320 Bacteria 1404
5 rootH1_10008460 3300003323 Bacteria 4625
6 rootH1_10013358 3300003323 Bacteria 34288
7 Ga0065714_10116121 3300005288 Bacteria 1407
8 Ga0065712_10009565 3300005290 Bacteria 2070
9 Ga0065712_10099703 3300005290 Bacteria 2083
10 Ga0070658_10021091 3300005327 Bacteria 5219
11 Ga0070658_10092425 3300005327 Bacteria 2495
12 Ga0070676_10029274 3300005328 Unclassified 3132
13 Ga0070676_10037407 3300005328 Bacteria 2799
14 Ga0070683_100004056 3300005329 Bacteria 11997
15 Ga0070683_100004434 3300005329 Bacteria 11572
16 Ga0070683_100008664 3300005329 Bacteria 8645
17 Ga0070683_100036815 3300005329 Bacteria 4478
18 Ga0070683_100064447 3300005329 Bacteria 3411
19 Ga0070683_100298268 3300005329 Bacteria 1533
20 Ga0070690_100078066 3300005330 Bacteria 2163
21 Ga0070670_100043860 3300005331 Bacteria 3845
22 Ga0070670_100064850 3300005331 Bacteria 3134
23 Ga0070677_10006364 3300005333 Bacteria 3920
24 Ga0070677_10013186 3300005333 Bacteria 2885
25 Ga0068869_100043081 3300005334 Bacteria 3240
26 Ga0068869_100056825 3300005334 Bacteria 2855
27 Ga0068869_100092188 3300005334 Bacteria 2280
28 Ga0070666_10033791 3300005335 Bacteria 3387
29 Ga0070666_10187589 3300005335 Bacteria 1452
30 Ga0070680_100032119 3300005336 Bacteria 4223
31 Ga0070680_100221540 3300005336 Bacteria 1597
32 Ga0070682_100000005 3300005337 Bacteria 386439
33 Ga0068868_100001233 3300005338 Bacteria 17574
34 Ga0068868_100004427 3300005338 Bacteria 9853
35 Ga0068868_100145768 3300005338 Bacteria 1947
36 Ga0070660_100003190 3300005339 Bacteria 11272
37 Ga0070660_100028768 3300005339 Bacteria 4160
38 Ga0070660_100053692 3300005339 Bacteria 3109
39 Ga0070689_100005525 3300005340 Bacteria 8644
40 Ga0070689_100012064 3300005340 Bacteria 6212
41 Ga0070689_100280175 3300005340 Bacteria 1383
42 Ga0070687_100046307 3300005343 Bacteria 2226
43 Ga0070687_100064622 3300005343 Bacteria 1945
44 Ga0070661_100009940 3300005344 Bacteria 6600
45 Ga0070661_100025550 3300005344 Unclassified 4246
46 Ga0070668_100005681 3300005347 Bacteria 9248
47 Ga0070668_100013041 3300005347 Bacteria 6191
48 Ga0070668_100174707 3300005347 Bacteria 1751
49 Ga0070669_100005411 3300005353 Bacteria 9210
50 Ga0070669_100011966 3300005353 Bacteria 6158
51 Ga0070675_100013715 3300005354 Bacteria 6378
52 Ga0070675_100032271 3300005354 Bacteria 4237
53 Ga0070675_100068608 3300005354 Bacteria 2936
54 Ga0070675_100099007 3300005354 Bacteria 2453
55 Ga0070675_100120983 3300005354 Bacteria 2224
56 Ga0070671_100002355 3300005355 Bacteria 14592
57 Ga0070671_100005620 3300005355 Bacteria 9985
58 Ga0070671_100129027 3300005355 Bacteria 2129
59 Ga0070674_100008043 3300005356 Bacteria 6252
60 Ga0070674_100053427 3300005356 Bacteria 2789
61 Ga0070673_100039500 3300005364 Bacteria 3612
62 Ga0070673_100057787 3300005364 Bacteria 3066
63 Ga0070673_100076705 3300005364 Bacteria 2700
64 Ga0070673_100150713 3300005364 Bacteria 1969
65 Ga0070688_100002521 3300005365 Bacteria 9268
66 Ga0070688_100006462 3300005365 Bacteria 6269
67 Ga0070688_100007694 3300005365 Bacteria 5820
68 Ga0070688_100083122 3300005365 Bacteria 2077
69 Ga0070659_100033965 3300005366 Bacteria 3966
70 Ga0070659_100037708 3300005366 Bacteria 3768
71 Ga0070659_100090787 3300005366 Bacteria 2448
72 Ga0070659_100271933 3300005366 Bacteria 1408
73 Ga0070667_100009285 3300005367 Bacteria 8149
74 Ga0070667_100128472 3300005367 Bacteria 2210
75 Ga0070701_10116470 3300005438 Bacteria 1500
76 Ga0070700_100021636 3300005441 Bacteria 3740
77 Ga0070663_100093552 3300005455 Bacteria 2230
78 Ga0070663_100122668 3300005455 Bacteria 1964
79 Ga0070662_100061111 3300005457 Bacteria 2750
80 Ga0070662_100079573 3300005457 Bacteria 2438
81 Ga0070681_10018694 3300005458 Bacteria 6931
82 Ga0070681_10021396 3300005458 Bacteria 6486
83 Ga0070681_10159403 3300005458 Bacteria 2180
84 Ga0068867_100051909 3300005459 Bacteria 3025
85 Ga0068867_100132870 3300005459 Bacteria 1936
86 Ga0070685_10006227 3300005466 Bacteria 6075
87 Ga0070685_10027437 3300005466 Bacteria 3146
88 Ga0070685_10060982 3300005466 Bacteria 2207
89 Ga0070698_100002852 3300005471 Bacteria 19022
90 Ga0070698_100028579 3300005471 Bacteria 5791
91 Ga0070679_100003030 3300005530 Bacteria 15347
92 Ga0070679_100117057 3300005530 Bacteria 2650
93 Ga0070679_100134616 3300005530 Bacteria 2452
94 Ga0070684_100000726 3300005535 Bacteria 22852
95 Ga0070684_100001044 3300005535 Bacteria 19807
96 Ga0070684_100027802 3300005535 Bacteria 4777
97 Ga0070684_100162345 3300005535 Bacteria 2027
98 Ga0070684_100250256 3300005535 Bacteria 1620
99 Ga0068853_100001205 3300005539 Bacteria 18440
100 Ga0068853_100008440 3300005539 Bacteria 8279
101 Ga0068853_100009253 3300005539 Bacteria 7941
102 Ga0068853_100075607 3300005539 Bacteria 2939
103 Ga0070672_100030618 3300005543 Bacteria 4044
104 Ga0070672_100033229 3300005543 Unclassified 3904
105 Ga0070672_100169813 3300005543 Bacteria 1813
106 Ga0070665_100011972 3300005548 Bacteria 8757
107 Ga0068855_100002469 3300005563 Bacteria 22826
108 Ga0068855_100005780 3300005563 Bacteria 15095
109 Ga0068855_100006990 3300005563 Bacteria 13700
110 Ga0068855_100046212 3300005563 Bacteria 5147
111 Ga0068855_100068088 3300005563 Bacteria 4145
112 Ga0068855_100133989 3300005563 Bacteria 2827
113 Ga0070664_100001643 3300005564 Bacteria 17902
114 Ga0070664_100006069 3300005564 Bacteria 9764
115 Ga0070664_100008145 3300005564 Bacteria 8475
116 Ga0068857_100001310 3300005577 Bacteria 19574
117 Ga0068857_100001481 3300005577 Bacteria 18690
118 Ga0068857_100036584 3300005577 Bacteria 4349
119 Ga0068857_100218301 3300005577 Bacteria 1741
120 Ga0068854_100129233 3300005578 Bacteria 1927
121 Ga0068856_100020192 3300005614 Bacteria 6470
122 Ga0068852_100005753 3300005616 Bacteria 8898
123 Ga0068852_100010804 3300005616 Bacteria 6840
124 Ga0068852_100028654 3300005616 Unclassified 4563
125 Ga0068852_100047433 3300005616 Bacteria 3665
126 Ga0068852_100427448 3300005616 Unclassified 1307
127 Ga0068859_100000522 3300005617 Bacteria 38186
128 Ga0068859_100057082 3300005617 Bacteria 3932
129 Ga0068859_100076441 3300005617 Bacteria 3389
130 Ga0068859_100153297 3300005617 Unclassified 2380
131 Ga0068864_100022103 3300005618 Bacteria 5332
132 Ga0068864_100148946 3300005618 Bacteria 2118
133 Ga0068866_10025960 3300005718 Bacteria 2761
134 Ga0068866_10073999 3300005718 Bacteria 1810
135 Ga0068861_100021374 3300005719 Bacteria 4650
136 Ga0068861_100080533 3300005719 Bacteria 2548
137 Ga0068870_10092344 3300005840 Bacteria 1695
138 Ga0068863_100087279 3300005841 Unclassified 2956
139 Ga0068858_100029705 3300005842 Bacteria 5077
140 Ga0068860_100004078 3300005843 Bacteria 14988
141 Ga0068860_100004452 3300005843 Bacteria 14296
142 Ga0068860_100029331 3300005843 Bacteria 5291
143 Ga0068860_100042128 3300005843 Bacteria 4363
144 Ga0068860_100122753 3300005843 Bacteria 2488
145 Ga0068860_100413786 3300005843 Bacteria 1336
146 Ga0068862_100042116 3300005844 Bacteria 3889
147 Ga0068862_100067363 3300005844 Bacteria 3086
148 Ga0068862_100166644 3300005844 Bacteria 1970
149 Ga0081539_10001653 3300005985 Bacteria 36134
150 Ga0070715_10007504 3300006163 Bacteria 3758
151 Ga0075366_10036071 3300006195 Bacteria 2915
152 Ga0075366_10057295 3300006195 Bacteria 2316
153 Ga0097621_100000167 3300006237 Bacteria 41215
154 Ga0097621_100093913 3300006237 Bacteria 2514
155 Ga0068871_100010795 3300006358 Bacteria 6684
156 Ga0068871_100040312 3300006358 Bacteria 3740
157 Ga0068871_100042044 3300006358 Bacteria 3667
158 Ga0068871_100113515 3300006358 Bacteria 2282
159 Ga0068871_100145696 3300006358 Bacteria 2016
160 Ga0068871_100272760 3300006358 Bacteria 1478
161 Ga0075429_100120141 3300006880 Bacteria 2297
162 Ga0068865_100093809 3300006881 Bacteria 2183
163 Ga0097620_100000522 3300006931 Bacteria 38186
164 Ga0097620_100041528 3300006931 Bacteria 4619
165 Ga0097620_100057080 3300006931 Bacteria 3932
166 Ga0097620_100076441 3300006931 Bacteria 3389
167 Ga0097620_100153307 3300006931 Unclassified 2380
168 Ga0105240_10000273 3300009093 Bacteria 102198
169 Ga0105240_10000646 3300009093 Bacteria 64342
170 Ga0105240_10000699 3300009093 Bacteria 61665
171 Ga0105240_10044485 3300009093 Bacteria 5641
172 Ga0111539_10007178 3300009094 Bacteria 14282
173 Ga0114129_10011317 3300009147 Bacteria 12711
174 Ga0114129_10025228 3300009147 Bacteria 8422
175 Ga0105241_10010330 3300009174 Bacteria 6855
176 Ga0105241_10063659 3300009174 Bacteria 2847
177 Ga0105242_10005646 3300009176 Bacteria 9658
178 Ga0105242_10336258 3300009176 Bacteria 1390
179 Ga0105248_10060002 3300009177 Bacteria 4271
180 Ga0105248_10235265 3300009177 Bacteria 2062
181 Ga0105237_10003692 3300009545 Bacteria 18044
182 Ga0105237_10134737 3300009545 Bacteria 2465
183 Ga0105238_10136503 3300009551 Bacteria 2430
184 Ga0105249_10000198 3300009553 Bacteria 68849
185 Ga0105249_10002904 3300009553 Bacteria 14783
186 Ga0105249_10040197 3300009553 Bacteria 4247
187 Ga0105249_10041864 3300009553 Bacteria 4165
188 Ga0105249_10046850 3300009553 Bacteria 3936
189 Ga0105249_10049850 3300009553 Bacteria 3818
190 Ga0105249_10067986 3300009553 Bacteria 3284
191 Ga0105249_10085370 3300009553 Bacteria 2942
192 Ga0105249_10110797 3300009553 Bacteria 2594
193 Ga0105249_10211995 3300009553 Bacteria 1901
194 Ga0105239_10001021 3300010375 Bacteria 39112
195 Ga0105239_10001040 3300010375 Bacteria 38650
196 Ga0105239_10192161 3300010375 Bacteria 2285
197 Ga0105246_10086405 3300011119 Bacteria 2248
198 Ga0105246_10277977 3300011119 Bacteria 1342
199 Ga0157373_10015477 3300013100 Bacteria 5577
200 Ga0157373_10045138 3300013100 Bacteria 3146
201 Ga0157373_10224415 3300013100 Bacteria 1326
202 Ga0157371_10000322 3300013102 Bacteria 62104
203 Ga0157371_10002526 3300013102 Bacteria 17367
204 Ga0157371_10017412 3300013102 Bacteria 5338
205 Ga0157371_10047222 3300013102 Bacteria 3061
206 Ga0157371_10053204 3300013102 Bacteria 2875
207 Ga0157371_10060155 3300013102 Bacteria 2694
208 Ga0157371_10066229 3300013102 Bacteria 2558
209 Ga0157370_10002037 3300013104 Bacteria 24829
210 Ga0157370_10005483 3300013104 Bacteria 14228
211 Ga0157370_10017154 3300013104 Bacteria 7309
212 Ga0157370_10028184 3300013104 Bacteria 5528
213 Ga0157370_10032183 3300013104 Bacteria 5122
214 Ga0157370_10136776 3300013104 Bacteria 2283
215 Ga0157369_10034965 3300013105 Bacteria 5510
216 Ga0157369_10129300 3300013105 Bacteria 2677
217 Ga0157374_10001517 3300013296 Bacteria 19566
218 Ga0157374_10027117 3300013296 Bacteria 5163
219 Ga0157374_10036463 3300013296 Bacteria 4504
220 Ga0157374_10061977 3300013296 Bacteria 3504
221 Ga0157374_10081940 3300013296 Unclassified 3063
222 Ga0157374_10107255 3300013296 Bacteria 2684
223 Ga0157378_10003777 3300013297 Bacteria 13417
224 Ga0157378_10004582 3300013297 Bacteria 12120
225 Ga0157378_10016242 3300013297 Bacteria 6519
226 Ga0157378_10051291 3300013297 Bacteria 3671
227 Ga0157378_10093037 3300013297 Bacteria 2744
228 Ga0163162_10000114 3300013306 Bacteria 71183
229 Ga0163162_10002721 3300013306 Bacteria 16775
230 Ga0163162_10005360 3300013306 Bacteria 12381
231 Ga0163162_10015313 3300013306 Bacteria 7491
232 Ga0163162_10031917 3300013306 Bacteria 5227
233 Ga0163162_10033109 3300013306 Bacteria 5134
234 Ga0163162_10034871 3300013306 Bacteria 5009
235 Ga0163162_10139594 3300013306 Bacteria 2536
236 Ga0163162_10252090 3300013306 Bacteria 1897
237 Ga0163162_10361411 3300013306 Bacteria 1585
238 Ga0157372_10014774 3300013307 Bacteria 8358
239 Ga0157372_10048957 3300013307 Bacteria 4698
240 Ga0157372_10059218 3300013307 Bacteria 4283
241 Ga0157372_10071457 3300013307 Bacteria 3908
242 Ga0157372_10074998 3300013307 Bacteria 3815
243 Ga0157372_10119197 3300013307 Bacteria 3029
244 Ga0157372_10166098 3300013307 Bacteria 2552
245 Ga0157372_10204187 3300013307 Bacteria 2290
246 Ga0157375_10000569 3300013308 Bacteria 33134
247 Ga0157375_10114911 3300013308 Bacteria 2794
248 Ga0163163_10000479 3300014325 Bacteria 36308
249 Ga0163163_10001561 3300014325 Bacteria 19328
250 Ga0163163_10002419 3300014325 Bacteria 15790
251 Ga0163163_10197996 3300014325 Bacteria 2057
252 Ga0157380_10002872 3300014326 Bacteria 11693
253 Ga0157380_10006580 3300014326 Bacteria 8195
254 Ga0157377_10007148 3300014745 Bacteria 5372
255 Ga0157377_10007287 3300014745 Bacteria 5331
256 Ga0157377_10007381 3300014745 Bacteria 5305
257 Ga0157379_10123342 3300014968 Bacteria 2331
258 Ga0157379_10234616 3300014968 Bacteria 1663
259 Ga0157376_10001971 3300014969 Bacteria 13729
260 Ga0157376_10003130 3300014969 Bacteria 11372
261 Ga0157376_10075279 3300014969 Bacteria 2880
262 Ga0157376_10077866 3300014969 Bacteria 2837
263 Ga0157376_10243876 3300014969 Bacteria 1675
264 Ga0163161_10007512 3300017792 Bacteria 7533
265 Ga0163161_10035193 3300017792 Bacteria 3584
266 Ga0163161_10135929 3300017792 Bacteria 1858
267 Ga0213876_10017458 3300021384 Bacteria 3789
268 Ga0213876_10079695 3300021384 Bacteria 1731
269 Ga0209646_1000834 3300025246 Bacteria 10376
270 Ga0209026_1001516 3300025250 Bacteria 10142
271 Ga0207697_10085015 3300025315 Bacteria 1336
272 Ga0207680_10074395 3300025903 Bacteria 2115
273 Ga0207647_10019556 3300025904 Bacteria 4553
274 Ga0207647_10089766 3300025904 Bacteria 1834
275 Ga0207645_10000278 3300025907 Bacteria 42507
276 Ga0207645_10013504 3300025907 Bacteria 5501
277 Ga0207645_10017937 3300025907 Bacteria 4667
278 Ga0207643_10002562 3300025908 Bacteria 9845
279 Ga0207643_10054849 3300025908 Bacteria 2266
280 Ga0207643_10060488 3300025908 Bacteria 2162
281 Ga0207705_10079054 3300025909 Bacteria 2395
282 Ga0207705_10105558 3300025909 Bacteria 2077
283 Ga0207654_10128446 3300025911 Bacteria 1601
284 Ga0207707_10031191 3300025912 Bacteria 4663
285 Ga0207707_10103198 3300025912 Bacteria 2492
286 Ga0207707_10200546 3300025912 Bacteria 1740
287 Ga0207695_10000130 3300025913 Bacteria 224214
288 Ga0207695_10000170 3300025913 Bacteria 192469
289 Ga0207695_10000682 3300025913 Bacteria 66574
290 Ga0207671_10011204 3300025914 Bacteria 7318
291 Ga0207671_10099563 3300025914 Bacteria 2200
292 Ga0207660_10078586 3300025917 Bacteria 2418
293 Ga0207662_10024530 3300025918 Bacteria 3469
294 Ga0207662_10057096 3300025918 Bacteria 2332
295 Ga0207657_10015465 3300025919 Bacteria 7392
296 Ga0207657_10040440 3300025919 Bacteria 4131
297 Ga0207649_10073682 3300025920 Bacteria 2188
298 Ga0207652_10000328 3300025921 Bacteria 49143
299 Ga0207652_10000643 3300025921 Bacteria 34526
300 Ga0207652_10001773 3300025921 Bacteria 18792
301 Ga0207652_10111690 3300025921 Bacteria 2424
302 Ga0207652_10169621 3300025921 Bacteria 1958
303 Ga0207681_10002188 3300025923 Bacteria 12454
304 Ga0207681_10010587 3300025923 Bacteria 5653
305 Ga0207650_10000839 3300025925 Bacteria 23292
306 Ga0207650_10025751 3300025925 Bacteria 4192
307 Ga0207650_10067225 3300025925 Bacteria 2689
308 Ga0207659_10068043 3300025926 Bacteria 2589
309 Ga0207659_10222776 3300025926 Bacteria 1517
310 Ga0207644_10010232 3300025931 Bacteria 6182
311 Ga0207644_10019944 3300025931 Bacteria 4553
312 Ga0207644_10159974 3300025931 Bacteria 1750
313 Ga0207644_10238815 3300025931 Bacteria 1446
314 Ga0207690_10067353 3300025932 Bacteria 2456
315 Ga0207706_10001784 3300025933 Bacteria 21146
316 Ga0207706_10050232 3300025933 Bacteria 3686
317 Ga0207706_10116385 3300025933 Bacteria 2351
318 Ga0207706_10155168 3300025933 Bacteria 2014
319 Ga0207686_10157475 3300025934 Unclassified 1588
320 Ga0207670_10001421 3300025936 Bacteria 12581
321 Ga0207670_10009852 3300025936 Bacteria 5472
322 Ga0207670_10045101 3300025936 Bacteria 2921
323 Ga0207669_10086661 3300025937 Bacteria 2026
324 Ga0207669_10100285 3300025937 Bacteria 1912
325 Ga0207704_10170808 3300025938 Bacteria 1559
326 Ga0207704_10172341 3300025938 Bacteria 1554
327 Ga0207691_10005034 3300025940 Bacteria 12750
328 Ga0207691_10016200 3300025940 Bacteria 7078
329 Ga0207691_10077269 3300025940 Bacteria 2999
330 Ga0207689_10010843 3300025942 Bacteria 7840
331 Ga0207689_10012613 3300025942 Bacteria 7219
332 Ga0207689_10020486 3300025942 Bacteria 5565
333 Ga0207689_10034663 3300025942 Bacteria 4191
334 Ga0207689_10048012 3300025942 Bacteria 3522
335 Ga0207689_10069745 3300025942 Bacteria 2888
336 Ga0207661_10000258 3300025944 Bacteria 34274
337 Ga0207661_10004201 3300025944 Bacteria 10073
338 Ga0207661_10027517 3300025944 Bacteria 4344
339 Ga0207661_10061768 3300025944 Bacteria 3028
340 Ga0207679_10002552 3300025945 Bacteria 11226
341 Ga0207679_10006277 3300025945 Bacteria 7500
342 Ga0207679_10013132 3300025945 Bacteria 5425
343 Ga0207679_10068609 3300025945 Bacteria 2664
344 Ga0207679_10238211 3300025945 Bacteria 1540
345 Ga0207667_10000131 3300025949 Bacteria 115088
346 Ga0207667_10022777 3300025949 Bacteria 6910
347 Ga0207667_10024209 3300025949 Bacteria 6671
348 Ga0207667_10058278 3300025949 Bacteria 4051
349 Ga0207667_10262810 3300025949 Bacteria 1765
350 Ga0207651_10043755 3300025960 Bacteria 2991
351 Ga0207712_10002127 3300025961 Bacteria 12946
352 Ga0207712_10002648 3300025961 Bacteria 11461
353 Ga0207712_10010033 3300025961 Bacteria 6002
354 Ga0207712_10023569 3300025961 Bacteria 4064
355 Ga0207712_10251224 3300025961 Bacteria 1429
356 Ga0207668_10145039 3300025972 Bacteria 1831
357 Ga0207668_10161422 3300025972 Bacteria 1747
358 Ga0207668_10305673 3300025972 Bacteria 1314
359 Ga0207640_10198689 3300025981 Bacteria 1518
360 Ga0207658_10009260 3300025986 Bacteria 6680
361 Ga0207658_10034174 3300025986 Bacteria 3632
362 Ga0207677_10011124 3300026023 Bacteria 5117
363 Ga0207677_10031336 3300026023 Bacteria 3405
364 Ga0207677_10125633 3300026023 Bacteria 1938
365 Ga0207703_10049363 3300026035 Bacteria 3402
366 Ga0207639_10007674 3300026041 Bacteria 7364
367 Ga0207639_10014902 3300026041 Bacteria 5476
368 Ga0207639_10033112 3300026041 Unclassified 3810
369 Ga0207639_10055431 3300026041 Bacteria 3034
370 Ga0207639_10083007 3300026041 Bacteria 2542
371 Ga0207639_10153767 3300026041 Bacteria 1930
372 Ga0207639_10324819 3300026041 Bacteria 1367
373 Ga0207678_10181657 3300026067 Bacteria 1796
374 Ga0207708_10079699 3300026075 Bacteria 2516
375 Ga0207702_10075133 3300026078 Bacteria 2918
376 Ga0207702_10313370 3300026078 Bacteria 1492
377 Ga0207641_10018892 3300026088 Bacteria 5653
378 Ga0207641_10033636 3300026088 Bacteria 4258
379 Ga0207641_10101467 3300026088 Bacteria 2536
380 Ga0207648_10013863 3300026089 Bacteria 7477
381 Ga0207648_10014152 3300026089 Bacteria 7377
382 Ga0207648_10066677 3300026089 Bacteria 3139
383 Ga0207648_10068106 3300026089 Bacteria 3102
384 Ga0207648_10258171 3300026089 Bacteria 1554
385 Ga0207676_10000458 3300026095 Bacteria 34139
386 Ga0207676_10126357 3300026095 Bacteria 2166
387 Ga0207676_10127029 3300026095 Bacteria 2161
388 Ga0207674_10001674 3300026116 Bacteria 28491
389 Ga0207674_10004327 3300026116 Bacteria 17122
390 Ga0207675_100006204 3300026118 Bacteria 11350
391 Ga0207675_100024526 3300026118 Bacteria 5607
392 Ga0207675_100067127 3300026118 Bacteria 3353
393 Ga0207675_100118358 3300026118 Bacteria 2505
394 Ga0207675_100170334 3300026118 Bacteria 2081
395 Ga0207675_100190278 3300026118 Bacteria 1968
396 Ga0207675_100205453 3300026118 Bacteria 1893
397 Ga0207683_10001371 3300026121 Bacteria 22015
398 Ga0207683_10076209 3300026121 Bacteria 2969
399 Ga0207683_10100025 3300026121 Bacteria 2588
400 Ga0207683_10107256 3300026121 Unclassified 2499
401 Ga0207683_10261660 3300026121 Bacteria 1580
402 Ga0207698_10005988 3300026142 Bacteria 7558
403 Ga0207698_10108942 3300026142 Bacteria 2316
404 Ga0207428_10012535 3300027907 Bacteria 7443
405 Ga0268266_10084758 3300028379 Bacteria 2768
406 Ga0268265_10135599 3300028380 Bacteria 2053
407 Ga0268264_10004211 3300028381 Bacteria 12279
408 Ga0268264_10031142 3300028381 Bacteria 4374
409 Ga0268264_10083598 3300028381 Bacteria 2735
410 Ga0307515_10000010 3300028794 Bacteria 651586
411 Ga0307515_10002904 3300028794 Bacteria 36409
412 Ga0265327_10000239 3300031251 Bacteria 109804
413 Ga0307513_10035887 3300031456 Bacteria 5541
414 Ga0307508_10143803 3300031616 Bacteria 1989
415 Ga0316576_10026196 3300031727 Bacteria 4090
416 Ga0307516_10027091 3300031730 Bacteria 5815
417 Ga0307414_10272022 3300032004 Unclassified 1419
418 Ga0307510_10145108 3300033180 Bacteria 2008
419 Ga0373943_0139529 3300035170 Bacteria 1305
420 Ga0373937_0017116 3300036401 Bacteria 6448
421 Ga0316582_0011833 3300036647 Bacteria 4842
422 Ga0395899_0008330 3300037312 Bacteria 7982
423 Ga0395899_0013077 3300037312 Bacteria 6347
424 Ga0395900_0000203 3300037418 Bacteria 93536
425 Ga0395900_0014371 3300037418 Bacteria 8082
426 Ga0395900_0028385 3300037418 Bacteria 5730
427 Ga0395900_0035703 3300037418 Bacteria 5121
428 Ga0395900_0072797 3300037418 Bacteria 3532
429 Ga0395898_0002505 3300037466 Bacteria 21597
430 Ga0395898_0040279 3300037466 Bacteria 4620
431 Ga0395898_0072000 3300037466 Bacteria 3339
432 Ga0395898_0185546 3300037466 Bacteria 1987
433 Ga0395905_0010903 3300037471 Bacteria 8801
434 Ga0395905_0083190 3300037471 Bacteria 2999
435 Ga0395901_0002145 3300038443 Bacteria 20164
436 Ga0395901_0014861 3300038443 Bacteria 7909
437 Ga0436365_0767388 3300039437 Bacteria 3250
438 Ga0436365_1590236 3300039437 Bacteria 15011
439 Ga0439465_0013735 3300041413 Bacteria 2521
440 Ga0451853_2165360 3300041512 Bacteria 1685
441 Ga0439445_0008317 3300042004 Bacteria 2427
442 Ga0439449_0037056 3300042007 Bacteria 1814
443 Ga0439457_000312 3300042014 Bacteria 13374
444 Ga0450923_003592 3300042125 Bacteria 2359
445 Ga0451577_0005222 3300042876 Bacteria 13366
446 Ga0451577_0072162 3300042876 Bacteria 3079
447 Ga0451577_0347599 3300042876 Bacteria 1345
448 Ga0466969_0000438 3300044656 Bacteria 22799
449 Ga0453683_0000387 3300044673 Bacteria 52470
450 Ga0453684_0038878 3300044712 Bacteria 6493
451 Ga0453684_0109100 3300044712 Bacteria 3367
452 Ga0466957_0003221 3300044842 Bacteria 8929
453 Ga0466957_0159894 3300044842 Bacteria 1462
454 Ga0466959_0014856 3300045049 Bacteria 5668
455 Ga0451576_0000403 3300045051 Bacteria 100887
456 Ga0451576_0002382 3300045051 Bacteria 28289
457 Ga0451576_0154565 3300045051 Bacteria 2393
458 Ga0495606_0010035 3300046507 Bacteria 7914
459 Ga0495628_0008538 3300046516 Bacteria 8777
460 Ga0495643_0011954 3300046522 Bacteria 5257
461 Ga0495668_0000301 3300046616 Bacteria 68097
462 Ga0495668_0000513 3300046616 Bacteria 48303
463 Ga0495635_0054344 3300046663 Bacteria 2759
464 Ga0495674_0074931 3300047319 Bacteria 2913
465 Ga0495672_0003054 3300047320 Bacteria 14663
466 Ga0495676_0139742 3300047321 Bacteria 1737
467 Ga0495686_0024663 3300047472 Bacteria 3948
468 Ga0495686_0157867 3300047472 Bacteria 1327
469 Ga0496111_0134218 3300048914 Bacteria 1833
470 Ga0496114_0031538 3300048917 Bacteria 4361
471 Ga0501031_0104292 3300049568 Unclassified 1850
472 Ga0501033_0067375 3300049570 Bacteria 2632
473 Ga0501034_0000002 3300049571 Bacteria 565510
474 Ga0501034_0011813 3300049571 Bacteria 9039
475 Ga0501034_0187119 3300049571 Unclassified 2033
476 Ga0501034_0189931 3300049571 Bacteria 2017
477 Ga0501034_0219677 3300049571 Bacteria 1853
478 Ga0501037_0021632 3300049573 Bacteria 4755
479 Ga0501037_0074530 3300049573 Bacteria 2466
480 Ga0501038_0013934 3300049574 Bacteria 7328
481 Ga0501038_0203973 3300049574 Unclassified 1585
482 Ga0501039_0009925 3300049575 Bacteria 7260
483 Ga0501043_0075452 3300049579 Bacteria 2648
484 Ga0501043_0121302 3300049579 Unclassified 2050
485 Ga0501047_0008703 3300049581 Bacteria 9579
486 Ga0501047_0079732 3300049581 Unclassified 3148
487 Ga0501047_0090179 3300049581 Unclassified 2943
488 Ga0501067_0080588 3300049583 Bacteria 1805
489 Ga0501070_0049940 3300049586 Bacteria 3473
490 Ga0501198_007524 3300049649 Bacteria 1567
491 Ga0501219_000092 3300049703 Bacteria 15390
492 Ga0501225_0000312 3300049705 Bacteria 15216
493 Ga0501080_0164545 3300049742 Bacteria 2048
494 Ga0501266_002135 3300049763 Bacteria 2492
495 Ga0501035_0022130 3300049822 Bacteria 5839
496 Ga0501035_0057261 3300049822 Bacteria 3475
497 Ga0501044_0012032 3300049823 Bacteria 9374
498 Ga0501044_0014086 3300049823 Bacteria 8634
499 Ga0501044_0031915 3300049823 Bacteria 5539
500 Ga0501044_0085495 3300049823 Bacteria 3187
501 Ga0501044_0204923 3300049823 Bacteria 1929
502 Ga0501284_00016 3300050005 Bacteria 97390
503 nmdc:mga0k408_101808_c1 3300050493 Bacteria 1694
504 nmdc:mga0k408_143178_c1 3300050493 Bacteria 1422
505 nmdc:mga05p37_24046_c1 3300050507 Bacteria 7400
506 nmdc:mga08y16_8251_c1 3300050511 Bacteria 10895
507 Ga0500578_0000131 3300053086 Bacteria 89434
508 Ga0500578_0018971 3300053086 Bacteria 4415
509 Ga0500583_0000049 3300053092 Bacteria 77456
510 Ga0500594_0023289 3300053118 Bacteria 1569
511 Ga0500559_0025713 3300053136 Bacteria 2506
512 Ga0466962_0049114 3300061719 Bacteria 2017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100271933 Ga0070659_1002719331 377
2 3300013307 Ga0157372_10071457 Ga0157372_100714573 377
3 3300042876 Ga0451577_0005222 Ga0451577_0005222_8331_9527 377
4 3300005327 Ga0070658_10021091 Ga0070658_100210913 378
5 3300025909 Ga0207705_10105558 Ga0207705_101055582 378
6 3300049574 Ga0501038_0013934 Ga0501038_0013934_3074_4234 386
7 3300049575 Ga0501039_0009925 Ga0501039_0009925_4693_5883 386
8 3300049579 Ga0501043_0075452 Ga0501043_0075452_915_2075 386
9 3300049581 Ga0501047_0008703 Ga0501047_0008703_3561_4721 386
10 3300049823 Ga0501044_0014086 Ga0501044_0014086_3082_4272 386
11 iso_pu_bacteria 2914759650 2914760920 386
12 3300003203 JGI25406J46586_10004319 JGI25406J46586_100043192 387
13 3300003323 rootH1_10013358 rootH1_1001335818 387
14 3300005337 Ga0070682_100000005 Ga0070682_100000005139 387
15 3300005339 Ga0070660_100003190 Ga0070660_10000319010 387
16 3300005340 Ga0070689_100280175 Ga0070689_1002801751 387
17 3300005458 Ga0070681_10018694 Ga0070681_100186946 387
18 3300005535 Ga0070684_100027802 Ga0070684_1000278025 387
19 3300005616 Ga0068852_100427448 Ga0068852_1004274481 387
20 3300005617 Ga0068859_100000522 Ga0068859_10000052219 387
21 3300005843 Ga0068860_100042128 Ga0068860_1000421282 387
22 3300005985 Ga0081539_10001653 Ga0081539_100016532 387
23 3300006358 Ga0068871_100113515 Ga0068871_1001135152 387
24 3300006931 Ga0097620_100000522 Ga0097620_10000052219 387
25 3300013104 Ga0157370_10028184 Ga0157370_100281844 387
26 3300013296 Ga0157374_10061977 Ga0157374_100619774 387
27 3300014745 Ga0157377_10007287 Ga0157377_100072876 387
28 3300021384 Ga0213876_10079695 Ga0213876_100796951 387
29 3300025246 Ga0209646_1000834 Ga0209646_10008348 387
30 3300025912 Ga0207707_10031191 Ga0207707_100311912 387
31 3300025926 Ga0207659_10068043 Ga0207659_100680431 387
32 3300025933 Ga0207706_10001784 Ga0207706_100017847 387
33 3300025938 Ga0207704_10170808 Ga0207704_101708082 387
34 3300025945 Ga0207679_10238211 Ga0207679_102382111 387
35 3300026078 Ga0207702_10313370 Ga0207702_103133701 387
36 3300026118 Ga0207675_100170334 Ga0207675_1001703343 387
37 3300028381 Ga0268264_10031142 Ga0268264_100311425 387
38 3300031251 Ga0265327_10000239 Ga0265327_1000023952 387
39 3300031456 Ga0307513_10035887 Ga0307513_100358875 387
40 3300031727 Ga0316576_10026196 Ga0316576_100261963 387
41 3300039437 Ga0436365_0767388 Ga0436365_0767388_504_1697 387
42 3300041512 Ga0451853_2165360 Ga0451853_2165360_32_1225 387
43 3300042007 Ga0439449_0037056 Ga0439449_0037056_15_1178 387
44 3300042014 Ga0439457_000312 Ga0439457_000312_10781_11974 387
45 3300042876 Ga0451577_0072162 Ga0451577_0072162_402_1601 387
46 3300042876 Ga0451577_0347599 Ga0451577_0347599_86_1279 387
47 3300044673 Ga0453683_0000387 Ga0453683_0000387_22704_23900 387
48 3300044712 Ga0453684_0038878 Ga0453684_0038878_456_1652 387
49 3300044712 Ga0453684_0109100 Ga0453684_0109100_353_1549 387
50 3300044842 Ga0466957_0159894 Ga0466957_0159894_22_1215 387
51 3300045051 Ga0451576_0000403 Ga0451576_0000403_71121_72317 387
52 3300045051 Ga0451576_0002382 Ga0451576_0002382_526_1722 387
53 3300046616 Ga0495668_0000301 Ga0495668_0000301_53848_55041 387
54 3300049571 Ga0501034_0189931 Ga0501034_0189931_254_1483 387
55 3300049705 Ga0501225_0000312 Ga0501225_0000312_3049_4212 387
56 3300049823 Ga0501044_0012032 Ga0501044_0012032_683_1912 387
57 3300053086 Ga0500578_0000131 Ga0500578_0000131_57539_58702 387
58 3300053086 Ga0500578_0018971 Ga0500578_0018971_569_1732 387
59 3300053092 Ga0500583_0000049 Ga0500583_0000049_9124_10317 387
60 iso_pu_bacteria 2738541278 2738726990 387
61 3300003320 rootH2_10061340 rootH2_100613401 388
62 3300003323 rootH1_10008460 rootH1_100084605 388
63 3300005329 Ga0070683_100004434 Ga0070683_1000044347 388
64 3300005329 Ga0070683_100036815 Ga0070683_1000368152 388
65 3300005329 Ga0070683_100298268 Ga0070683_1002982681 388
66 3300005336 Ga0070680_100032119 Ga0070680_1000321193 388
67 3300005336 Ga0070680_100221540 Ga0070680_1002215401 388
68 3300005339 Ga0070660_100053692 Ga0070660_1000536923 388
69 3300005455 Ga0070663_100093552 Ga0070663_1000935521 388
70 3300005455 Ga0070663_100122668 Ga0070663_1001226681 388
71 3300005458 Ga0070681_10021396 Ga0070681_100213963 388
72 3300005530 Ga0070679_100117057 Ga0070679_1001170572 388
73 3300005535 Ga0070684_100250256 Ga0070684_1002502562 388
74 3300005539 Ga0068853_100001205 Ga0068853_10000120517 388
75 3300005563 Ga0068855_100002469 Ga0068855_1000024693 388
76 3300005563 Ga0068855_100005780 Ga0068855_10000578016 388
77 3300005563 Ga0068855_100046212 Ga0068855_1000462123 388
78 3300005563 Ga0068855_100133989 Ga0068855_1001339893 388
79 3300005577 Ga0068857_100036584 Ga0068857_1000365843 388
80 3300005614 Ga0068856_100020192 Ga0068856_1000201925 388
81 3300005616 Ga0068852_100010804 Ga0068852_1000108044 388
82 3300005616 Ga0068852_100047433 Ga0068852_1000474334 388
83 3300005718 Ga0068866_10025960 Ga0068866_100259602 388
84 3300005719 Ga0068861_100080533 Ga0068861_1000805334 388
85 3300006195 Ga0075366_10036071 Ga0075366_100360715 388
86 3300006358 Ga0068871_100042044 Ga0068871_1000420442 388
87 3300009093 Ga0105240_10000273 Ga0105240_1000027380 388
88 3300009093 Ga0105240_10000646 Ga0105240_1000064612 388
89 3300009093 Ga0105240_10000699 Ga0105240_1000069944 388
90 3300009093 Ga0105240_10044485 Ga0105240_100444855 388
91 3300009147 Ga0114129_10011317 Ga0114129_100113174 388
92 3300009174 Ga0105241_10010330 Ga0105241_100103306 388
93 3300009176 Ga0105242_10336258 Ga0105242_103362581 388
94 3300009545 Ga0105237_10134737 Ga0105237_101347373 388
95 3300009551 Ga0105238_10136503 Ga0105238_101365032 388
96 3300010375 Ga0105239_10001021 Ga0105239_1000102128 388
97 3300010375 Ga0105239_10001040 Ga0105239_1000104030 388
98 3300013100 Ga0157373_10224415 Ga0157373_102244151 388
99 3300013102 Ga0157371_10000322 Ga0157371_1000032217 388
100 3300013102 Ga0157371_10017412 Ga0157371_100174123 388
101 3300013102 Ga0157371_10047222 Ga0157371_100472222 388
102 3300013104 Ga0157370_10017154 Ga0157370_100171547 388
103 3300013104 Ga0157370_10032183 Ga0157370_100321833 388
104 3300013105 Ga0157369_10034965 Ga0157369_100349654 388
105 3300013296 Ga0157374_10027117 Ga0157374_100271174 388
106 3300013306 Ga0163162_10139594 Ga0163162_101395942 388
107 3300013307 Ga0157372_10119197 Ga0157372_101191972 388
108 3300013307 Ga0157372_10166098 Ga0157372_101660983 388
109 3300014969 Ga0157376_10003130 Ga0157376_100031303 388
110 3300014969 Ga0157376_10243876 Ga0157376_102438761 388
111 3300021384 Ga0213876_10017458 Ga0213876_100174582 388
112 3300025904 Ga0207647_10019556 Ga0207647_100195565 388
113 3300025909 Ga0207705_10079054 Ga0207705_100790542 388
114 3300025911 Ga0207654_10128446 Ga0207654_101284461 388
115 3300025912 Ga0207707_10103198 Ga0207707_101031983 388
116 3300025913 Ga0207695_10000130 Ga0207695_10000130101 388
117 3300025913 Ga0207695_10000170 Ga0207695_1000017059 388
118 3300025913 Ga0207695_10000682 Ga0207695_1000068216 388
119 3300025914 Ga0207671_10011204 Ga0207671_100112045 388
120 3300025914 Ga0207671_10099563 Ga0207671_100995631 388
121 3300025921 Ga0207652_10000328 Ga0207652_100003289 388
122 3300025921 Ga0207652_10001773 Ga0207652_100017737 388
123 3300025926 Ga0207659_10222776 Ga0207659_102227761 388
124 3300025937 Ga0207669_10086661 Ga0207669_100866612 388
125 3300025944 Ga0207661_10004201 Ga0207661_100042012 388
126 3300025944 Ga0207661_10027517 Ga0207661_100275172 388
127 3300025949 Ga0207667_10000131 Ga0207667_1000013164 388
128 3300025949 Ga0207667_10024209 Ga0207667_100242094 388
129 3300025949 Ga0207667_10262810 Ga0207667_102628101 388
130 3300025981 Ga0207640_10198689 Ga0207640_101986892 388
131 3300026041 Ga0207639_10007674 Ga0207639_100076742 388
132 3300026041 Ga0207639_10324819 Ga0207639_103248192 388
133 3300026067 Ga0207678_10181657 Ga0207678_101816572 388
134 3300026078 Ga0207702_10075133 Ga0207702_100751333 388
135 3300026142 Ga0207698_10108942 Ga0207698_101089422 388
136 3300028794 Ga0307515_10000010 Ga0307515_10000010254 388
137 3300028794 Ga0307515_10002904 Ga0307515_100029047 388
138 3300031616 Ga0307508_10143803 Ga0307508_101438032 388
139 3300031730 Ga0307516_10027091 Ga0307516_100270913 388
140 3300033180 Ga0307510_10145108 Ga0307510_101451081 388
141 3300037312 Ga0395899_0008330 Ga0395899_0008330_2032_3198 388
142 3300037312 Ga0395899_0013077 Ga0395899_0013077_3465_4661 388
143 3300037418 Ga0395900_0000203 Ga0395900_0000203_82256_83602 388
144 3300037418 Ga0395900_0072797 Ga0395900_0072797_893_2059 388
145 3300037466 Ga0395898_0002505 Ga0395898_0002505_9943_11289 388
146 3300037466 Ga0395898_0040279 Ga0395898_0040279_2524_3720 388
147 3300037466 Ga0395898_0072000 Ga0395898_0072000_1120_2316 388
148 3300037466 Ga0395898_0185546 Ga0395898_0185546_495_1661 388
149 3300037471 Ga0395905_0010903 Ga0395905_0010903_6631_7827 388
150 3300038443 Ga0395901_0014861 Ga0395901_0014861_3733_5079 388
151 3300039437 Ga0436365_1590236 Ga0436365_1590236_4603_5805 388
152 3300044656 Ga0466969_0000438 Ga0466969_0000438_21167_22363 388
153 3300044842 Ga0466957_0003221 Ga0466957_0003221_41_1237 388
154 3300045049 Ga0466959_0014856 Ga0466959_0014856_3844_5040 388
155 3300046507 Ga0495606_0010035 Ga0495606_0010035_243_1475 388
156 3300046616 Ga0495668_0000513 Ga0495668_0000513_45546_46712 388
157 3300049573 Ga0501037_0074530 Ga0501037_0074530_1253_2455 388
158 3300049703 Ga0501219_000092 Ga0501219_000092_11199_12395 388
159 3300049823 Ga0501044_0031915 Ga0501044_0031915_3913_5115 388
160 3300050005 Ga0501284_00016 Ga0501284_00016_49220_50416 388
161 3300050507 nmdc:mga05p37_24046_c1 nmdc:mga05p37_24046_c1_2657_3823 388
162 3300053118 Ga0500594_0023289 Ga0500594_0023289_39_1235 388
163 3300053136 Ga0500559_0025713 Ga0500559_0025713_468_1664 388
164 3300061719 Ga0466962_0049114 Ga0466962_0049114_470_1666 388
165 3300013104 Ga0157370_10136776 Ga0157370_101367762 389
166 3300049570 Ga0501033_0067375 Ga0501033_0067375_109_1308 389
167 3300049571 Ga0501034_0011813 Ga0501034_0011813_2010_3209 389
168 3300049571 Ga0501034_0219677 Ga0501034_0219677_117_1316 389
169 3300049823 Ga0501044_0085495 Ga0501044_0085495_674_1873 389
170 3300049823 Ga0501044_0204923 Ga0501044_0204923_430_1629 389
171 3300005327 Ga0070658_10092425 Ga0070658_100924252 390
172 3300005339 Ga0070660_100028768 Ga0070660_1000287682 390
173 3300005530 Ga0070679_100003030 Ga0070679_10000303013 390
174 3300005563 Ga0068855_100006990 Ga0068855_1000069908 390
175 3300005843 Ga0068860_100004452 Ga0068860_10000445211 390
176 3300005844 Ga0068862_100042116 Ga0068862_1000421163 390
177 3300006931 Ga0097620_100041528 Ga0097620_1000415281 390
178 3300009174 Ga0105241_10063659 Ga0105241_100636593 390
179 3300011119 Ga0105246_10277977 Ga0105246_102779771 390
180 3300013102 Ga0157371_10002526 Ga0157371_1000252617 390
181 3300013102 Ga0157371_10060155 Ga0157371_100601553 390
182 3300013102 Ga0157371_10066229 Ga0157371_100662292 390
183 3300013104 Ga0157370_10005483 Ga0157370_100054833 390
184 3300013297 Ga0157378_10016242 Ga0157378_100162426 390
185 3300013307 Ga0157372_10074998 Ga0157372_100749983 390
186 3300025919 Ga0207657_10040440 Ga0207657_100404402 390
187 3300025921 Ga0207652_10000643 Ga0207652_1000064312 390
188 3300025921 Ga0207652_10169621 Ga0207652_101696212 390
189 3300025942 Ga0207689_10069745 Ga0207689_100697453 390
190 3300025949 Ga0207667_10022777 Ga0207667_100227775 390
191 3300025949 Ga0207667_10058278 Ga0207667_100582783 390
192 3300026041 Ga0207639_10055431 Ga0207639_100554311 390
193 3300028380 Ga0268265_10135599 Ga0268265_101355992 390
194 3300028381 Ga0268264_10004211 Ga0268264_100042113 390
195 3300037418 Ga0395900_0028385 Ga0395900_0028385_3644_4846 390
196 3300037418 Ga0395900_0035703 Ga0395900_0035703_290_1492 390
197 3300038443 Ga0395901_0002145 Ga0395901_0002145_6086_7288 390
198 3300005335 Ga0070666_10033791 Ga0070666_100337912 391
199 3300005366 Ga0070659_100090787 Ga0070659_1000907872 392
200 3300005458 Ga0070681_10159403 Ga0070681_101594033 392
201 3300005530 Ga0070679_100134616 Ga0070679_1001346162 392
202 3300005563 Ga0068855_100068088 Ga0068855_1000680883 392
203 3300013100 Ga0157373_10045138 Ga0157373_100451383 392
204 3300025912 Ga0207707_10200546 Ga0207707_102005461 392
205 3300025917 Ga0207660_10078586 Ga0207660_100785861 392
206 3300025919 Ga0207657_10015465 Ga0207657_100154653 392
207 3300025921 Ga0207652_10111690 Ga0207652_101116902 392
208 3300049586 Ga0501070_0049940 Ga0501070_0049940_471_1649 392
209 3300049822 Ga0501035_0022130 Ga0501035_0022130_4436_5614 392
210 3300025315 Ga0207697_10085015 Ga0207697_100850151 393
211 3300005616 Ga0068852_100028654 Ga0068852_1000286544 394
212 3300032004 Ga0307414_10272022 Ga0307414_102720221 394
213 3300042004 Ga0439445_0008317 Ga0439445_0008317_353_1573 394
214 3300005288 Ga0065714_10116121 Ga0065714_101161211 395
215 3300009545 Ga0105237_10003692 Ga0105237_1000369214 395
216 3300005335 Ga0070666_10187589 Ga0070666_101875891 396
217 3300005355 Ga0070671_100005620 Ga0070671_1000056207 396
218 3300005367 Ga0070667_100009285 Ga0070667_1000092858 396
219 3300005618 Ga0068864_100148946 Ga0068864_1001489462 396
220 3300005843 Ga0068860_100004078 Ga0068860_1000040789 396
221 3300006237 Ga0097621_100000167 Ga0097621_10000016736 396
222 3300006358 Ga0068871_100040312 Ga0068871_1000403124 396
223 3300006358 Ga0068871_100272760 Ga0068871_1002727601 396
224 3300009177 Ga0105248_10060002 Ga0105248_100600024 396
225 3300009553 Ga0105249_10041864 Ga0105249_100418642 396
226 3300013104 Ga0157370_10002037 Ga0157370_100020375 396
227 3300013297 Ga0157378_10051291 Ga0157378_100512912 396
228 3300013306 Ga0163162_10000114 Ga0163162_100001146 396
229 3300013306 Ga0163162_10033109 Ga0163162_100331094 396
230 3300013306 Ga0163162_10034871 Ga0163162_100348714 396
231 3300013308 Ga0157375_10000569 Ga0157375_100005693 396
232 3300014325 Ga0163163_10001561 Ga0163163_100015618 396
233 3300014968 Ga0157379_10123342 Ga0157379_101233421 396
234 3300014969 Ga0157376_10001971 Ga0157376_1000197110 396
235 3300017792 Ga0163161_10035193 Ga0163161_100351932 396
236 3300025931 Ga0207644_10010232 Ga0207644_100102321 396
237 3300025961 Ga0207712_10023569 Ga0207712_100235694 396
238 3300025986 Ga0207658_10009260 Ga0207658_100092603 396
239 3300026095 Ga0207676_10127029 Ga0207676_101270293 396
240 3300026121 Ga0207683_10076209 Ga0207683_100762092 396
241 3300026121 Ga0207683_10261660 Ga0207683_102616602 396
242 3300028381 Ga0268264_10083598 Ga0268264_100835982 396
243 3300048917 Ga0496114_0031538 Ga0496114_0031538_631_1857 396
244 3300049571 Ga0501034_0000002 Ga0501034_0000002_225855_227051 396
245 3300049742 Ga0501080_0164545 Ga0501080_0164545_75_1304 396
246 3300002459 JGI24751J29686_10000595 JGI24751J29686_100005953 397
247 3300005329 Ga0070683_100064447 Ga0070683_1000644474 397
248 3300005333 Ga0070677_10006364 Ga0070677_100063642 397
249 3300005333 Ga0070677_10013186 Ga0070677_100131862 397
250 3300005338 Ga0068868_100145768 Ga0068868_1001457682 397
251 3300005343 Ga0070687_100046307 Ga0070687_1000463071 397
252 3300005354 Ga0070675_100032271 Ga0070675_1000322715 397
253 3300005354 Ga0070675_100120983 Ga0070675_1001209832 397
254 3300005355 Ga0070671_100002355 Ga0070671_1000023556 397
255 3300005364 Ga0070673_100039500 Ga0070673_1000395002 397
256 3300005364 Ga0070673_100057787 Ga0070673_1000577874 397
257 3300005366 Ga0070659_100033965 Ga0070659_1000339653 397
258 3300005441 Ga0070700_100021636 Ga0070700_1000216361 397
259 3300005459 Ga0068867_100051909 Ga0068867_1000519092 397
260 3300005535 Ga0070684_100162345 Ga0070684_1001623451 397
261 3300005543 Ga0070672_100169813 Ga0070672_1001698132 397
262 3300005564 Ga0070664_100008145 Ga0070664_1000081455 397
263 3300005577 Ga0068857_100218301 Ga0068857_1002183012 397
264 3300005616 Ga0068852_100005753 Ga0068852_1000057536 397
265 3300005843 Ga0068860_100122753 Ga0068860_1001227532 397
266 3300009553 Ga0105249_10000198 Ga0105249_1000019830 397
267 3300013100 Ga0157373_10015477 Ga0157373_100154775 397
268 3300013102 Ga0157371_10053204 Ga0157371_100532043 397
269 3300013105 Ga0157369_10129300 Ga0157369_101293001 397
270 3300013296 Ga0157374_10107255 Ga0157374_101072551 397
271 3300013297 Ga0157378_10003777 Ga0157378_100037774 397
272 3300013297 Ga0157378_10004582 Ga0157378_100045824 397
273 3300013306 Ga0163162_10005360 Ga0163162_100053603 397
274 3300013307 Ga0157372_10014774 Ga0157372_100147748 397
275 3300013307 Ga0157372_10048957 Ga0157372_100489574 397
276 3300014325 Ga0163163_10002419 Ga0163163_100024198 397
277 3300025250 Ga0209026_1001516 Ga0209026_10015166 397
278 3300025907 Ga0207645_10017937 Ga0207645_100179372 397
279 3300025918 Ga0207662_10024530 Ga0207662_100245302 397
280 3300025925 Ga0207650_10000839 Ga0207650_1000083912 397
281 3300025925 Ga0207650_10025751 Ga0207650_100257511 397
282 3300025931 Ga0207644_10019944 Ga0207644_100199443 397
283 3300025931 Ga0207644_10159974 Ga0207644_101599741 397
284 3300025940 Ga0207691_10005034 Ga0207691_100050341 397
285 3300025945 Ga0207679_10013132 Ga0207679_100131322 397
286 3300025945 Ga0207679_10068609 Ga0207679_100686092 397
287 3300025961 Ga0207712_10002648 Ga0207712_100026487 397
288 3300025972 Ga0207668_10305673 Ga0207668_103056731 397
289 3300026023 Ga0207677_10125633 Ga0207677_101256331 397
290 3300026075 Ga0207708_10079699 Ga0207708_100796993 397
291 3300026089 Ga0207648_10068106 Ga0207648_100681064 397
292 3300026095 Ga0207676_10126357 Ga0207676_101263571 397
293 3300026118 Ga0207675_100205453 Ga0207675_1002054532 397
294 3300026142 Ga0207698_10005988 Ga0207698_100059883 397
295 3300037418 Ga0395900_0014371 Ga0395900_0014371_4494_5777 397
296 3300037471 Ga0395905_0083190 Ga0395905_0083190_466_1695 397
297 3300045051 Ga0451576_0154565 Ga0451576_0154565_89_1288 397
298 3300049649 Ga0501198_007524 Ga0501198_007524_157_1386 397
299 3300049763 Ga0501266_002135 Ga0501266_002135_254_1483 397
300 3300002077 JGI24744J21845_10003888 JGI24744J21845_100038882 398
301 3300005290 Ga0065712_10009565 Ga0065712_100095652 398
302 3300005290 Ga0065712_10099703 Ga0065712_100997031 398
303 3300005328 Ga0070676_10029274 Ga0070676_100292742 398
304 3300005328 Ga0070676_10037407 Ga0070676_100374072 398
305 3300005329 Ga0070683_100004056 Ga0070683_10000405612 398
306 3300005329 Ga0070683_100008664 Ga0070683_1000086645 398
307 3300005330 Ga0070690_100078066 Ga0070690_1000780662 398
308 3300005331 Ga0070670_100043860 Ga0070670_1000438601 398
309 3300005331 Ga0070670_100064850 Ga0070670_1000648502 398
310 3300005334 Ga0068869_100043081 Ga0068869_1000430815 398
311 3300005334 Ga0068869_100056825 Ga0068869_1000568251 398
312 3300005334 Ga0068869_100092188 Ga0068869_1000921882 398
313 3300005338 Ga0068868_100001233 Ga0068868_10000123312 398
314 3300005338 Ga0068868_100004427 Ga0068868_1000044273 398
315 3300005340 Ga0070689_100005525 Ga0070689_1000055259 398
316 3300005340 Ga0070689_100012064 Ga0070689_1000120644 398
317 3300005343 Ga0070687_100064622 Ga0070687_1000646221 398
318 3300005344 Ga0070661_100009940 Ga0070661_1000099404 398
319 3300005344 Ga0070661_100025550 Ga0070661_1000255504 398
320 3300005347 Ga0070668_100005681 Ga0070668_1000056812 398
321 3300005347 Ga0070668_100013041 Ga0070668_1000130413 398
322 3300005347 Ga0070668_100174707 Ga0070668_1001747071 398
323 3300005353 Ga0070669_100005411 Ga0070669_1000054115 398
324 3300005353 Ga0070669_100011966 Ga0070669_1000119662 398
325 3300005354 Ga0070675_100013715 Ga0070675_1000137156 398
326 3300005354 Ga0070675_100068608 Ga0070675_1000686083 398
327 3300005354 Ga0070675_100099007 Ga0070675_1000990072 398
328 3300005355 Ga0070671_100129027 Ga0070671_1001290271 398
329 3300005356 Ga0070674_100008043 Ga0070674_1000080432 398
330 3300005356 Ga0070674_100053427 Ga0070674_1000534272 398
331 3300005364 Ga0070673_100076705 Ga0070673_1000767054 398
332 3300005364 Ga0070673_100150713 Ga0070673_1001507132 398
333 3300005365 Ga0070688_100002521 Ga0070688_1000025218 398
334 3300005365 Ga0070688_100006462 Ga0070688_1000064625 398
335 3300005365 Ga0070688_100007694 Ga0070688_1000076944 398
336 3300005365 Ga0070688_100083122 Ga0070688_1000831221 398
337 3300005366 Ga0070659_100037708 Ga0070659_1000377084 398
338 3300005367 Ga0070667_100128472 Ga0070667_1001284722 398
339 3300005438 Ga0070701_10116470 Ga0070701_101164702 398
340 3300005457 Ga0070662_100061111 Ga0070662_1000611112 398
341 3300005457 Ga0070662_100079573 Ga0070662_1000795732 398
342 3300005459 Ga0068867_100132870 Ga0068867_1001328702 398
343 3300005466 Ga0070685_10006227 Ga0070685_100062275 398
344 3300005466 Ga0070685_10027437 Ga0070685_100274374 398
345 3300005466 Ga0070685_10060982 Ga0070685_100609823 398
346 3300005471 Ga0070698_100002852 Ga0070698_10000285216 398
347 3300005471 Ga0070698_100028579 Ga0070698_1000285794 398
348 3300005535 Ga0070684_100000726 Ga0070684_10000072611 398
349 3300005535 Ga0070684_100001044 Ga0070684_10000104416 398
350 3300005539 Ga0068853_100008440 Ga0068853_1000084405 398
351 3300005539 Ga0068853_100009253 Ga0068853_1000092536 398
352 3300005539 Ga0068853_100075607 Ga0068853_1000756072 398
353 3300005543 Ga0070672_100030618 Ga0070672_1000306182 398
354 3300005543 Ga0070672_100033229 Ga0070672_1000332292 398
355 3300005548 Ga0070665_100011972 Ga0070665_1000119727 398
356 3300005564 Ga0070664_100001643 Ga0070664_10000164319 398
357 3300005564 Ga0070664_100006069 Ga0070664_1000060696 398
358 3300005577 Ga0068857_100001310 Ga0068857_1000013105 398
359 3300005577 Ga0068857_100001481 Ga0068857_10000148110 398
360 3300005578 Ga0068854_100129233 Ga0068854_1001292332 398
361 3300005617 Ga0068859_100057082 Ga0068859_1000570821 398
362 3300005617 Ga0068859_100076441 Ga0068859_1000764412 398
363 3300005617 Ga0068859_100153297 Ga0068859_1001532973 398
364 3300005618 Ga0068864_100022103 Ga0068864_1000221033 398
365 3300005718 Ga0068866_10073999 Ga0068866_100739992 398
366 3300005719 Ga0068861_100021374 Ga0068861_1000213743 398
367 3300005840 Ga0068870_10092344 Ga0068870_100923442 398
368 3300005841 Ga0068863_100087279 Ga0068863_1000872792 398
369 3300005842 Ga0068858_100029705 Ga0068858_1000297054 398
370 3300005843 Ga0068860_100029331 Ga0068860_1000293313 398
371 3300005843 Ga0068860_100413786 Ga0068860_1004137861 398
372 3300005844 Ga0068862_100067363 Ga0068862_1000673635 398
373 3300005844 Ga0068862_100166644 Ga0068862_1001666442 398
374 3300006163 Ga0070715_10007504 Ga0070715_100075044 398
375 3300006195 Ga0075366_10057295 Ga0075366_100572951 398
376 3300006237 Ga0097621_100093913 Ga0097621_1000939132 398
377 3300006358 Ga0068871_100010795 Ga0068871_1000107955 398
378 3300006358 Ga0068871_100145696 Ga0068871_1001456962 398
379 3300006880 Ga0075429_100120141 Ga0075429_1001201413 398
380 3300006881 Ga0068865_100093809 Ga0068865_1000938091 398
381 3300006931 Ga0097620_100057080 Ga0097620_1000570805 398
382 3300006931 Ga0097620_100076441 Ga0097620_1000764413 398
383 3300006931 Ga0097620_100153307 Ga0097620_1001533073 398
384 3300009094 Ga0111539_10007178 Ga0111539_100071788 398
385 3300009147 Ga0114129_10025228 Ga0114129_100252282 398
386 3300009176 Ga0105242_10005646 Ga0105242_100056466 398
387 3300009177 Ga0105248_10235265 Ga0105248_102352652 398
388 3300009553 Ga0105249_10002904 Ga0105249_100029047 398
389 3300009553 Ga0105249_10040197 Ga0105249_100401972 398
390 3300009553 Ga0105249_10046850 Ga0105249_100468505 398
391 3300009553 Ga0105249_10049850 Ga0105249_100498504 398
392 3300009553 Ga0105249_10067986 Ga0105249_100679866 398
393 3300009553 Ga0105249_10085370 Ga0105249_100853703 398
394 3300009553 Ga0105249_10110797 Ga0105249_101107972 398
395 3300009553 Ga0105249_10211995 Ga0105249_102119952 398
396 3300010375 Ga0105239_10192161 Ga0105239_101921612 398
397 3300011119 Ga0105246_10086405 Ga0105246_100864051 398
398 3300013296 Ga0157374_10001517 Ga0157374_100015178 398
399 3300013296 Ga0157374_10036463 Ga0157374_100364632 398
400 3300013296 Ga0157374_10081940 Ga0157374_100819402 398
401 3300013297 Ga0157378_10093037 Ga0157378_100930372 398
402 3300013306 Ga0163162_10002721 Ga0163162_1000272110 398
403 3300013306 Ga0163162_10015313 Ga0163162_100153136 398
404 3300013306 Ga0163162_10031917 Ga0163162_100319174 398
405 3300013306 Ga0163162_10252090 Ga0163162_102520902 398
406 3300013306 Ga0163162_10361411 Ga0163162_103614111 398
407 3300013307 Ga0157372_10059218 Ga0157372_100592182 398
408 3300013307 Ga0157372_10204187 Ga0157372_102041872 398
409 3300013308 Ga0157375_10114911 Ga0157375_101149112 398
410 3300014325 Ga0163163_10000479 Ga0163163_1000047914 398
411 3300014325 Ga0163163_10197996 Ga0163163_101979962 398
412 3300014326 Ga0157380_10002872 Ga0157380_1000287215 398
413 3300014326 Ga0157380_10006580 Ga0157380_100065805 398
414 3300014745 Ga0157377_10007148 Ga0157377_100071483 398
415 3300014745 Ga0157377_10007381 Ga0157377_100073813 398
416 3300014968 Ga0157379_10234616 Ga0157379_102346162 398
417 3300014969 Ga0157376_10075279 Ga0157376_100752793 398
418 3300014969 Ga0157376_10077866 Ga0157376_100778662 398
419 3300017792 Ga0163161_10007512 Ga0163161_100075125 398
420 3300017792 Ga0163161_10135929 Ga0163161_101359292 398
421 3300025903 Ga0207680_10074395 Ga0207680_100743952 398
422 3300025904 Ga0207647_10089766 Ga0207647_100897662 398
423 3300025907 Ga0207645_10000278 Ga0207645_100002782 398
424 3300025907 Ga0207645_10013504 Ga0207645_100135046 398
425 3300025908 Ga0207643_10002562 Ga0207643_100025627 398
426 3300025908 Ga0207643_10054849 Ga0207643_100548492 398
427 3300025908 Ga0207643_10060488 Ga0207643_100604882 398
428 3300025918 Ga0207662_10057096 Ga0207662_100570962 398
429 3300025920 Ga0207649_10073682 Ga0207649_100736822 398
430 3300025923 Ga0207681_10002188 Ga0207681_100021885 398
431 3300025923 Ga0207681_10010587 Ga0207681_100105872 398
432 3300025925 Ga0207650_10067225 Ga0207650_100672252 398
433 3300025931 Ga0207644_10238815 Ga0207644_102388152 398
434 3300025932 Ga0207690_10067353 Ga0207690_100673532 398
435 3300025933 Ga0207706_10050232 Ga0207706_100502323 398
436 3300025933 Ga0207706_10116385 Ga0207706_101163852 398
437 3300025933 Ga0207706_10155168 Ga0207706_101551682 398
438 3300025934 Ga0207686_10157475 Ga0207686_101574751 398
439 3300025936 Ga0207670_10001421 Ga0207670_100014216 398
440 3300025936 Ga0207670_10009852 Ga0207670_100098524 398
441 3300025936 Ga0207670_10045101 Ga0207670_100451013 398
442 3300025937 Ga0207669_10100285 Ga0207669_101002852 398
443 3300025938 Ga0207704_10172341 Ga0207704_101723411 398
444 3300025940 Ga0207691_10016200 Ga0207691_100162002 398
445 3300025940 Ga0207691_10077269 Ga0207691_100772694 398
446 3300025942 Ga0207689_10010843 Ga0207689_100108433 398
447 3300025942 Ga0207689_10012613 Ga0207689_100126138 398
448 3300025942 Ga0207689_10020486 Ga0207689_100204862 398
449 3300025942 Ga0207689_10034663 Ga0207689_100346631 398
450 3300025942 Ga0207689_10048012 Ga0207689_100480123 398
451 3300025944 Ga0207661_10000258 Ga0207661_1000025823 398
452 3300025944 Ga0207661_10061768 Ga0207661_100617682 398
453 3300025945 Ga0207679_10002552 Ga0207679_100025522 398
454 3300025945 Ga0207679_10006277 Ga0207679_100062777 398
455 3300025960 Ga0207651_10043755 Ga0207651_100437552 398
456 3300025961 Ga0207712_10002127 Ga0207712_100021276 398
457 3300025961 Ga0207712_10010033 Ga0207712_100100336 398
458 3300025961 Ga0207712_10251224 Ga0207712_102512241 398
459 3300025972 Ga0207668_10145039 Ga0207668_101450393 398
460 3300025972 Ga0207668_10161422 Ga0207668_101614222 398
461 3300025986 Ga0207658_10034174 Ga0207658_100341744 398
462 3300026023 Ga0207677_10011124 Ga0207677_100111242 398
463 3300026023 Ga0207677_10031336 Ga0207677_100313361 398
464 3300026035 Ga0207703_10049363 Ga0207703_100493633 398
465 3300026041 Ga0207639_10014902 Ga0207639_100149024 398
466 3300026041 Ga0207639_10033112 Ga0207639_100331124 398
467 3300026041 Ga0207639_10083007 Ga0207639_100830073 398
468 3300026041 Ga0207639_10153767 Ga0207639_101537671 398
469 3300026088 Ga0207641_10018892 Ga0207641_100188922 398
470 3300026088 Ga0207641_10033636 Ga0207641_100336363 398
471 3300026088 Ga0207641_10101467 Ga0207641_101014673 398
472 3300026089 Ga0207648_10013863 Ga0207648_100138635 398
473 3300026089 Ga0207648_10014152 Ga0207648_100141523 398
474 3300026089 Ga0207648_10066677 Ga0207648_100666774 398
475 3300026089 Ga0207648_10258171 Ga0207648_102581712 398
476 3300026095 Ga0207676_10000458 Ga0207676_1000045823 398
477 3300026116 Ga0207674_10001674 Ga0207674_1000167413 398
478 3300026116 Ga0207674_10004327 Ga0207674_1000432715 398
479 3300026118 Ga0207675_100006204 Ga0207675_1000062041 398
480 3300026118 Ga0207675_100024526 Ga0207675_1000245262 398
481 3300026118 Ga0207675_100067127 Ga0207675_1000671272 398
482 3300026118 Ga0207675_100118358 Ga0207675_1001183581 398
483 3300026118 Ga0207675_100190278 Ga0207675_1001902781 398
484 3300026121 Ga0207683_10001371 Ga0207683_100013716 398
485 3300026121 Ga0207683_10100025 Ga0207683_101000252 398
486 3300026121 Ga0207683_10107256 Ga0207683_101072562 398
487 3300027907 Ga0207428_10012535 Ga0207428_100125355 398
488 3300028379 Ga0268266_10084758 Ga0268266_100847582 398
489 3300035170 Ga0373943_0139529 Ga0373943_0139529_10_1209 398
490 3300036401 Ga0373937_0017116 Ga0373937_0017116_4739_5968 398
491 3300036647 Ga0316582_0011833 Ga0316582_0011833_311_1561 398
492 3300041413 Ga0439465_0013735 Ga0439465_0013735_573_1799 398
493 3300042125 Ga0450923_003592 Ga0450923_003592_924_2150 398
494 3300046516 Ga0495628_0008538 Ga0495628_0008538_2279_3508 398
495 3300046522 Ga0495643_0011954 Ga0495643_0011954_951_2177 398
496 3300046663 Ga0495635_0054344 Ga0495635_0054344_687_1916 398
497 3300047319 Ga0495674_0074931 Ga0495674_0074931_319_1548 398
498 3300047320 Ga0495672_0003054 Ga0495672_0003054_1980_3299 398
499 3300047321 Ga0495676_0139742 Ga0495676_0139742_48_1277 398
500 3300047472 Ga0495686_0024663 Ga0495686_0024663_1519_2745 398
501 3300047472 Ga0495686_0157867 Ga0495686_0157867_65_1291 398
502 3300048914 Ga0496111_0134218 Ga0496111_0134218_261_1490 398
503 3300049568 Ga0501031_0104292 Ga0501031_0104292_160_1389 398
504 3300049571 Ga0501034_0187119 Ga0501034_0187119_250_1449 398
505 3300049573 Ga0501037_0021632 Ga0501037_0021632_1608_2807 398
506 3300049574 Ga0501038_0203973 Ga0501038_0203973_125_1324 398
507 3300049579 Ga0501043_0121302 Ga0501043_0121302_594_1793 398
508 3300049581 Ga0501047_0079732 Ga0501047_0079732_1183_2400 398
509 3300049581 Ga0501047_0090179 Ga0501047_0090179_508_1707 398
510 3300049583 Ga0501067_0080588 Ga0501067_0080588_37_1284 398
511 3300049822 Ga0501035_0057261 Ga0501035_0057261_1929_3128 398
512 3300050493 nmdc:mga0k408_101808_c1 nmdc:mga0k408_101808_c1_216_1442 398
513 3300050493 nmdc:mga0k408_143178_c1 nmdc:mga0k408_143178_c1_136_1362 398
514 3300050511 nmdc:mga08y16_8251_c1 nmdc:mga08y16_8251_c1_5930_7156 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

21

362

0.92

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

67

197

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gb3-assembly3.cif.gz_F crystal structure of aspartate aminotransferase (tm1698) from thermotoga maritima at 2.50 a resolution 0.9561 1 382
1j32-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.935 8 380
2gb3-assembly3.cif.gz_F crystal structure of aspartate aminotransferase (tm1698) from thermotoga maritima at 2.50 a resolution 0.9321 1 382
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.9295 2 381
5wmh-assembly2.cif.gz_C arabidopsis thaliana prephenate aminotransferase 0.9289 1 380
ID Description Score Start End Superfamily
2gb3B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9527 35 269 3.40.640.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9513 50 271 3.40.640.10
1gd9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9468 52 270 3.40.640.10
2gb3B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9447 35 269 3.40.640.10
1j32B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9384 52 270 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A4Z0P8F8-F1-model_v4 Pyridoxal phosphate-dependent aminotransferase 0.992 2 386 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A7V5H4Y4-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9914 228 385 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A524H2H3-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9886 153 385 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A1F3EF76-F1-model_v4 Aspartate aminotransferase 0.9843 118 387 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A1H3HNB2-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9803 1 382 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
91.84 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map