F457734

General Info

Members Datasets Scaffolds Average Seq Length
514 276 1028 154

Family's Representative Sequence

Representative Sequence 3300027695|Ga0209966_1000108|Ga0209966_100010815
Length 152
Sequence MLIRPDPLTDPALHALLAEHLRHMHSLSPPESVHALDLGALRRPEISFWSCWSDAGELMGCGALKTLDAAHGEVKSMRTAAAHLRQGVARALLEHIVAQARSRGLRQLSLETGSMDAFEPARRLYASFGFTPCGPFADYAEDPNSVFMTRAL

Samples

Sample ID Description Type Environment
1 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
188 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
275 2738543013 Variovorax sp. BT01 Isolate Unclassified
276 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0.19
Rhizoplane 2.92
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209966_1000108 3300027695 Bacteria 36408
2 MBSR1b_contig_13844533 2162886012 Bacteria 954
3 JGI25157J39369_1001440 3300002741 Bacteria 8957
4 JGI25406J46586_10064535 3300003203 Bacteria 1170
5 Ga0055524_1052259 3300003775 Bacteria 914
6 Ga0065707_10179017 3300005295 Unclassified 1380
7 Ga0065707_10317127 3300005295 Bacteria 966
8 Ga0070676_10246105 3300005328 Bacteria 1191
9 Ga0070690_100290284 3300005330 Bacteria 1169
10 Ga0070670_100004471 3300005331 Bacteria 11710
11 Ga0070670_100031661 3300005331 Bacteria 4555
12 Ga0070670_100039951 3300005331 Bacteria 4035
13 Ga0070670_100068289 3300005331 Bacteria 3051
14 Ga0068869_100013307 3300005334 Bacteria 5469
15 Ga0068869_100029149 3300005334 Bacteria 3864
16 Ga0070666_10004385 3300005335 Bacteria 8596
17 Ga0070666_10026427 3300005335 Bacteria 3793
18 Ga0070682_100004878 3300005337 Bacteria 7445
19 Ga0068868_100004933 3300005338 Bacteria 9373
20 Ga0070660_100018609 3300005339 Bacteria 5078
21 Ga0070689_100053613 3300005340 Bacteria 3121
22 Ga0070689_100824429 3300005340 Bacteria 817
23 Ga0070689_101122750 3300005340 Bacteria 703
24 Ga0070668_100003653 3300005347 Bacteria 11348
25 Ga0070668_100095888 3300005347 Bacteria 2344
26 Ga0070668_100205833 3300005347 Bacteria 1617
27 Ga0070669_100002397 3300005353 Bacteria 13564
28 Ga0070669_100021023 3300005353 Bacteria 4664
29 Ga0070669_100122618 3300005353 Bacteria 1985
30 Ga0070669_100382946 3300005353 Bacteria 1147
31 Ga0070669_100566274 3300005353 Bacteria 949
32 Ga0070669_101144084 3300005353 Unclassified 671
33 Ga0070675_100010548 3300005354 Bacteria 7220
34 Ga0070675_100035040 3300005354 Bacteria 4076
35 Ga0070675_100053546 3300005354 Bacteria 3319
36 Ga0070675_100067295 3300005354 Bacteria 2964
37 Ga0070671_100000036 3300005355 Bacteria 95440
38 Ga0070671_100029181 3300005355 Bacteria 4549
39 Ga0070671_100153693 3300005355 Bacteria 1943
40 Ga0070671_100619175 3300005355 Bacteria 936
41 Ga0070674_100038348 3300005356 Bacteria 3229
42 Ga0070674_100089387 3300005356 Bacteria 2219
43 Ga0070674_100753253 3300005356 Bacteria 837
44 Ga0070673_100076286 3300005364 Bacteria 2706
45 Ga0070673_101626488 3300005364 Unclassified 610
46 Ga0070688_100036899 3300005365 Bacteria 2975
47 Ga0070688_100078299 3300005365 Bacteria 2132
48 Ga0070688_100528833 3300005365 Unclassified 893
49 Ga0070659_100003947 3300005366 Bacteria 10551
50 Ga0070659_100132343 3300005366 Bacteria 2026
51 Ga0070667_100015583 3300005367 Bacteria 6284
52 Ga0070667_100025783 3300005367 Bacteria 4889
53 Ga0070667_100556136 3300005367 Bacteria 1055
54 Ga0070714_100002264 3300005435 Bacteria 14154
55 Ga0070714_100023863 3300005435 Bacteria 5031
56 Ga0070713_100006101 3300005436 Bacteria 8312
57 Ga0070713_100206574 3300005436 Unclassified 1776
58 Ga0070710_10231403 3300005437 Bacteria 1180
59 Ga0070710_10445548 3300005437 Bacteria 877
60 Ga0070701_10113030 3300005438 Bacteria 1520
61 Ga0070705_100939127 3300005440 Bacteria 698
62 Ga0070708_100001185 3300005445 Bacteria 20037
63 Ga0070678_100002199 3300005456 Bacteria 10605
64 Ga0070678_100509314 3300005456 Bacteria 1063
65 Ga0070678_100938006 3300005456 Unclassified 793
66 Ga0070662_100030341 3300005457 Bacteria 3782
67 Ga0070662_100511544 3300005457 Bacteria 1002
68 Ga0070662_100554457 3300005457 Bacteria 963
69 Ga0070681_10013609 3300005458 Bacteria 8095
70 Ga0068867_100005598 3300005459 Bacteria 8900
71 Ga0068867_100012294 3300005459 Bacteria 6054
72 Ga0068867_100355274 3300005459 Unclassified 1224
73 Ga0068867_101348109 3300005459 Bacteria 660
74 Ga0070685_10025552 3300005466 Bacteria 3252
75 Ga0070699_101477067 3300005518 Bacteria 623
76 Ga0070679_100383495 3300005530 Bacteria 1352
77 Ga0070684_100442047 3300005535 Bacteria 1201
78 Ga0070697_100414514 3300005536 Bacteria 1170
79 Ga0068853_100018685 3300005539 Bacteria 5740
80 Ga0068853_100157230 3300005539 Bacteria 2048
81 Ga0070672_100012903 3300005543 Bacteria 5887
82 Ga0070672_100586394 3300005543 Bacteria 970
83 Ga0070686_100549051 3300005544 Bacteria 903
84 Ga0070696_100310623 3300005546 Bacteria 1210
85 Ga0070665_100043396 3300005548 Bacteria 4519
86 Ga0070665_101028203 3300005548 Bacteria 836
87 Ga0068855_100163892 3300005563 Bacteria 2521
88 Ga0068857_100685622 3300005577 Bacteria 973
89 Ga0068854_100103246 3300005578 Bacteria 2140
90 Ga0068854_100410835 3300005578 Bacteria 1122
91 Ga0068854_100511034 3300005578 Bacteria 1013
92 Ga0068852_101312037 3300005616 Bacteria 745
93 Ga0068859_100019435 3300005617 Bacteria 6823
94 Ga0068859_100118131 3300005617 Bacteria 2717
95 Ga0068859_100644948 3300005617 Bacteria 1151
96 Ga0068864_100000918 3300005618 Bacteria 24714
97 Ga0068864_100024871 3300005618 Bacteria 5038
98 Ga0068864_100076751 3300005618 Bacteria 2921
99 Ga0068864_100362755 3300005618 Bacteria 1369
100 Ga0068864_100629293 3300005618 Unclassified 1043
101 Ga0068864_101164191 3300005618 Bacteria 769
102 Ga0068861_100018637 3300005719 Bacteria 4946
103 Ga0068861_100278301 3300005719 Bacteria 1440
104 Ga0068861_101565685 3300005719 Bacteria 648
105 Ga0068851_10161907 3300005834 Bacteria 1230
106 Ga0068863_100005523 3300005841 Bacteria 12432
107 Ga0068863_100006843 3300005841 Bacteria 11177
108 Ga0068863_100062069 3300005841 Bacteria 3534
109 Ga0068863_100541047 3300005841 Unclassified 1149
110 Ga0068858_100005177 3300005842 Bacteria 12772
111 Ga0068858_101033938 3300005842 Bacteria 805
112 Ga0068858_101050589 3300005842 Bacteria 799
113 Ga0068860_100002164 3300005843 Bacteria 20700
114 Ga0068860_100039385 3300005843 Bacteria 4520
115 Ga0068860_100234478 3300005843 Bacteria 1784
116 Ga0068860_100851255 3300005843 Bacteria 926
117 Ga0068862_100053015 3300005844 Bacteria 3472
118 Ga0068862_100305701 3300005844 Bacteria 1464
119 Ga0068862_100401716 3300005844 Bacteria 1282
120 Ga0081539_10002066 3300005985 Bacteria 30089
121 Ga0097621_100003339 3300006237 Bacteria 11041
122 Ga0097621_100267600 3300006237 Bacteria 1501
123 Ga0097621_100499260 3300006237 Unclassified 1102
124 Ga0097621_100636829 3300006237 Unclassified 977
125 Ga0075370_10172876 3300006353 Bacteria 1270
126 Ga0068871_100005315 3300006358 Bacteria 9021
127 Ga0068871_100253507 3300006358 Unclassified 1533
128 Ga0068871_100351425 3300006358 Bacteria 1304
129 Ga0075428_100045462 3300006844 Bacteria 4824
130 Ga0075430_100053021 3300006846 Unclassified 3415
131 Ga0075430_100847637 3300006846 Bacteria 753
132 Ga0075434_100240290 3300006871 Unclassified 1831
133 Ga0075429_100002542 3300006880 Bacteria 15374
134 Ga0068865_100005532 3300006881 Bacteria 7664
135 Ga0068865_100341220 3300006881 Bacteria 1211
136 Ga0075436_100011565 3300006914 Bacteria 6054
137 Ga0097620_100019438 3300006931 Bacteria 6823
138 Ga0097620_100118133 3300006931 Bacteria 2717
139 Ga0097620_100644935 3300006931 Bacteria 1151
140 Ga0099826_10129341 3300006948 Bacteria 1475
141 Ga0099794_10001563 3300007265 Bacteria 8063
142 Ga0111539_10008911 3300009094 Bacteria 12702
143 Ga0111539_10034013 3300009094 Bacteria 6184
144 Ga0111539_10096265 3300009094 Bacteria 3477
145 Ga0111539_11748714 3300009094 Unclassified 721
146 Ga0111539_12075580 3300009094 Unclassified 659
147 Ga0105245_10549340 3300009098 Bacteria 1177
148 Ga0105247_10108346 3300009101 Unclassified 1785
149 Ga0105247_10355318 3300009101 Bacteria 1032
150 Ga0105243_10188219 3300009148 Bacteria 1801
151 Ga0105242_10068055 3300009176 Bacteria 2945
152 Ga0105242_10167721 3300009176 Bacteria 1927
153 Ga0105248_10003651 3300009177 Bacteria 17086
154 Ga0105248_10047018 3300009177 Bacteria 4839
155 Ga0105248_10071508 3300009177 Bacteria 3897
156 Ga0105248_10082022 3300009177 Bacteria 3625
157 Ga0105248_10151009 3300009177 Bacteria 2621
158 Ga0105248_10332958 3300009177 Bacteria 1710
159 Ga0105248_10333445 3300009177 Bacteria 1708
160 Ga0105248_12085376 3300009177 Unclassified 645
161 Ga0105237_10012080 3300009545 Bacteria 9122
162 Ga0105238_10172514 3300009551 Bacteria 2139
163 Ga0105238_10465825 3300009551 Bacteria 1262
164 Ga0105249_10019560 3300009553 Bacteria 6042
165 Ga0157373_10089441 3300013100 Bacteria 2169
166 Ga0157371_10102212 3300013102 Bacteria 2033
167 Ga0157370_10025051 3300013104 Bacteria 5906
168 Ga0157370_10308366 3300013104 Bacteria 1461
169 Ga0157374_10003902 3300013296 Bacteria 12522
170 Ga0157374_10007175 3300013296 Bacteria 9491
171 Ga0157374_10575624 3300013296 Bacteria 1135
172 Ga0157374_10753593 3300013296 Bacteria 988
173 Ga0157374_10979815 3300013296 Bacteria 864
174 Ga0157378_10026941 3300013297 Bacteria 5069
175 Ga0157378_10035833 3300013297 Bacteria 4391
176 Ga0157378_10153232 3300013297 Bacteria 2149
177 Ga0157378_10897387 3300013297 Bacteria 917
178 Ga0163162_10030574 3300013306 Bacteria 5336
179 Ga0163162_10099301 3300013306 Bacteria 3002
180 Ga0163162_10208673 3300013306 Unclassified 2083
181 Ga0157375_10017493 3300013308 Bacteria 6471
182 Ga0157375_10019666 3300013308 Bacteria 6149
183 Ga0157375_10156314 3300013308 Unclassified 2419
184 Ga0157375_10198118 3300013308 Bacteria 2164
185 Ga0163163_10024872 3300014325 Bacteria 5701
186 Ga0163163_10040215 3300014325 Unclassified 4565
187 Ga0163163_11080553 3300014325 Unclassified 865
188 Ga0157380_10066724 3300014326 Bacteria 2895
189 Ga0157380_10131067 3300014326 Bacteria 2139
190 Ga0157380_10802479 3300014326 Bacteria 958
191 Ga0157380_11284207 3300014326 Bacteria 779
192 Ga0182008_10031966 3300014497 Bacteria 2646
193 Ga0182008_10032036 3300014497 Bacteria 2643
194 Ga0157377_10287794 3300014745 Bacteria 1080
195 Ga0157379_10004507 3300014968 Bacteria 11946
196 Ga0157379_10149082 3300014968 Bacteria 2110
197 Ga0157379_10389315 3300014968 Bacteria 1280
198 Ga0157376_10008447 3300014969 Bacteria 7433
199 Ga0157376_10035773 3300014969 Bacteria 4018
200 Ga0182007_10008428 3300015262 Bacteria 4238
201 Ga0183369_1003 3300015685 Bacteria 726443
202 Ga0163161_10003504 3300017792 Bacteria 10984
203 Ga0163161_10031817 3300017792 Bacteria 3762
204 Ga0163161_10097705 3300017792 Bacteria 2181
205 Ga0163161_10107514 3300017792 Bacteria 2082
206 Ga0213876_10000006 3300021384 Bacteria 700803
207 Ga0213876_10000124 3300021384 Bacteria 84379
208 Ga0209258_114022 3300025242 Bacteria 942
209 Ga0209026_1000145 3300025250 Bacteria 111490
210 Ga0207666_1046745 3300025271 Bacteria 682
211 Ga0209025_1000466 3300025294 Bacteria 79039
212 Ga0209256_1009850 3300025299 Bacteria 4111
213 Ga0207656_10272746 3300025321 Bacteria 833
214 Ga0207656_10378879 3300025321 Bacteria 709
215 Ga0207692_10076792 3300025898 Unclassified 1775
216 Ga0207688_10271662 3300025901 Bacteria 1031
217 Ga0207680_10001218 3300025903 Bacteria 12163
218 Ga0207680_10797202 3300025903 Unclassified 677
219 Ga0207645_10000997 3300025907 Bacteria 23377
220 Ga0207645_10590259 3300025907 Bacteria 754
221 Ga0207705_10426845 3300025909 Bacteria 1027
222 Ga0207707_10160363 3300025912 Bacteria 1967
223 Ga0207671_10024015 3300025914 Bacteria 4588
224 Ga0207657_10108983 3300025919 Bacteria 2289
225 Ga0207649_10818320 3300025920 Bacteria 728
226 Ga0207652_10195281 3300025921 Bacteria 1821
227 Ga0207681_10001759 3300025923 Bacteria 13911
228 Ga0207681_10029686 3300025923 Bacteria 3556
229 Ga0207694_10033141 3300025924 Bacteria 3957
230 Ga0207694_10424819 3300025924 Bacteria 1107
231 Ga0207650_10029252 3300025925 Bacteria 3959
232 Ga0207650_10187097 3300025925 Bacteria 1653
233 Ga0207650_10646598 3300025925 Bacteria 891
234 Ga0207650_10963572 3300025925 Bacteria 725
235 Ga0207659_10003127 3300025926 Bacteria 9890
236 Ga0207659_10198193 3300025926 Bacteria 1602
237 Ga0207659_10404284 3300025926 Bacteria 1143
238 Ga0207700_10073412 3300025928 Bacteria 2642
239 Ga0207664_10000315 3300025929 Bacteria 36069
240 Ga0207664_11532340 3300025929 Bacteria 588
241 Ga0207644_10000155 3300025931 Bacteria 49535
242 Ga0207644_10035719 3300025931 Bacteria 3484
243 Ga0207644_10411755 3300025931 Bacteria 1106
244 Ga0207644_10469188 3300025931 Bacteria 1036
245 Ga0207690_10001379 3300025932 Bacteria 15251
246 Ga0207690_10047495 3300025932 Bacteria 2849
247 Ga0207706_10082542 3300025933 Bacteria 2825
248 Ga0207686_10118497 3300025934 Bacteria 1798
249 Ga0207686_10840537 3300025934 Bacteria 738
250 Ga0207709_10124480 3300025935 Bacteria 1746
251 Ga0207670_10020564 3300025936 Bacteria 4058
252 Ga0207670_10973356 3300025936 Unclassified 713
253 Ga0207669_10086480 3300025937 Bacteria 2027
254 Ga0207704_10001647 3300025938 Bacteria 10023
255 Ga0207704_10284991 3300025938 Bacteria 1258
256 Ga0207691_10000687 3300025940 Bacteria 33422
257 Ga0207691_10002769 3300025940 Bacteria 17084
258 Ga0207691_10201469 3300025940 Bacteria 1732
259 Ga0207711_10010992 3300025941 Bacteria 7521
260 Ga0207711_10030548 3300025941 Bacteria 4545
261 Ga0207711_10040263 3300025941 Bacteria 3975
262 Ga0207711_10108399 3300025941 Bacteria 2467
263 Ga0207711_10881765 3300025941 Unclassified 832
264 Ga0207689_10001598 3300025942 Bacteria 21447
265 Ga0207689_10163387 3300025942 Bacteria 1835
266 Ga0207679_10319097 3300025945 Bacteria 1345
267 Ga0207667_10015243 3300025949 Bacteria 8739
268 Ga0207651_10014400 3300025960 Bacteria 4564
269 Ga0207651_10275222 3300025960 Bacteria 1388
270 Ga0207712_10043632 3300025961 Bacteria 3094
271 Ga0207668_10001592 3300025972 Bacteria 13253
272 Ga0207668_10026310 3300025972 Bacteria 3776
273 Ga0207668_10749644 3300025972 Bacteria 861
274 Ga0207668_10924965 3300025972 Bacteria 777
275 Ga0207640_10414459 3300025981 Bacteria 1101
276 Ga0207640_11363095 3300025981 Unclassified 635
277 Ga0207658_10002849 3300025986 Bacteria 12386
278 Ga0207658_10098509 3300025986 Unclassified 2285
279 Ga0207658_10303257 3300025986 Bacteria 1377
280 Ga0207677_10008664 3300026023 Bacteria 5693
281 Ga0207703_10004578 3300026035 Bacteria 11334
282 Ga0207703_10261305 3300026035 Bacteria 1565
283 Ga0207708_10473206 3300026075 Bacteria 1047
284 Ga0207641_10001705 3300026088 Bacteria 21390
285 Ga0207641_10010763 3300026088 Bacteria 7500
286 Ga0207641_10015688 3300026088 Bacteria 6208
287 Ga0207641_10024707 3300026088 Bacteria 4953
288 Ga0207641_10650798 3300026088 Bacteria 1035
289 Ga0207648_10002985 3300026089 Bacteria 17880
290 Ga0207648_10003315 3300026089 Bacteria 16908
291 Ga0207648_10400941 3300026089 Bacteria 1243
292 Ga0207676_10006526 3300026095 Bacteria 8249
293 Ga0207676_10049488 3300026095 Bacteria 3270
294 Ga0207676_10056664 3300026095 Bacteria 3082
295 Ga0207676_10058044 3300026095 Bacteria 3051
296 Ga0207676_10125463 3300026095 Bacteria 2173
297 Ga0207676_10257926 3300026095 Bacteria 1572
298 Ga0207674_10804593 3300026116 Bacteria 907
299 Ga0207675_100031791 3300026118 Bacteria 4917
300 Ga0207675_100166648 3300026118 Bacteria 2104
301 Ga0207675_100707465 3300026118 Bacteria 1017
302 Ga0207683_10000250 3300026121 Bacteria 48026
303 Ga0207683_10026920 3300026121 Bacteria 4968
304 Ga0207683_10150455 3300026121 Bacteria 2101
305 Ga0207683_10293864 3300026121 Bacteria 1486
306 Ga0207698_10673689 3300026142 Bacteria 1027
307 Ga0207428_10002138 3300027907 Bacteria 19861
308 Ga0268266_10039607 3300028379 Bacteria 4014
309 Ga0268265_10146500 3300028380 Bacteria 1985
310 Ga0268265_10913651 3300028380 Bacteria 863
311 Ga0268265_11577292 3300028380 Bacteria 661
312 Ga0268264_10005288 3300028381 Bacteria 10932
313 Ga0268264_10028152 3300028381 Bacteria 4595
314 Ga0268264_10144773 3300028381 Bacteria 2123
315 Ga0268264_10479983 3300028381 Bacteria 1209
316 Ga0316183_1013904 3300030742 Bacteria 1279
317 Ga0265327_10120705 3300031251 Bacteria 1242
318 Ga0307408_100004085 3300031548 Bacteria 9957
319 Ga0307408_100294564 3300031548 Bacteria 1357
320 Ga0307408_100924861 3300031548 Bacteria 800
321 Ga0307516_10000610 3300031730 Bacteria 48458
322 Ga0307405_10001333 3300031731 Bacteria 10339
323 Ga0307405_10983693 3300031731 Bacteria 719
324 Ga0307406_10330010 3300031901 Bacteria 1184
325 Ga0307406_11248728 3300031901 Bacteria 647
326 Ga0307407_10009244 3300031903 Bacteria 4579
327 Ga0307409_100126017 3300031995 Bacteria 2178
328 Ga0307416_100016316 3300032002 Bacteria 5158
329 Ga0307416_100580353 3300032002 Bacteria 1198
330 Ga0307416_102386923 3300032002 Bacteria 628
331 Ga0307411_10002241 3300032005 Bacteria 8441
332 Ga0307411_10470263 3300032005 Bacteria 1056
333 Ga0373936_0017706 3300035113 Bacteria 2745
334 Ga0373936_0183451 3300035113 Unclassified 919
335 Ga0373956_0062499 3300035119 Bacteria 1688
336 Ga0373957_0004945 3300035120 Unclassified 4101
337 Ga0373943_0075702 3300035170 Bacteria 1715
338 Ga0373943_0223962 3300035170 Unclassified 1048
339 Ga0373955_0075960 3300035172 Unclassified 1889
340 Ga0373955_0076399 3300035172 Unclassified 1884
341 Ga0373955_0080490 3300035172 Bacteria 1840
342 Ga0316574_0084776 3300035398 Bacteria 2016
343 Ga0373924_0371585 3300035410 Unclassified 638
344 Ga0373931_0864808 3300035691 Unclassified 606
345 Ga0373935_0004501 3300035692 Bacteria 8189
346 Ga0373935_0031702 3300035692 Bacteria 3282
347 Ga0373935_0636099 3300035692 Bacteria 782
348 Ga0373935_0837776 3300035692 Unclassified 680
349 Ga0373935_1199038 3300035692 Bacteria 566
350 Ga0373927_0028898 3300035695 Bacteria 3615
351 Ga0373933_0111799 3300035724 Bacteria 1705
352 Ga0373933_0204942 3300035724 Bacteria 1263
353 Ga0373947_0045270 3300035725 Bacteria 2633
354 Ga0373947_0352290 3300035725 Bacteria 988
355 Ga0373937_0000872 3300036401 Bacteria 25896
356 Ga0373937_0090378 3300036401 Bacteria 2836
357 Ga0373937_0639021 3300036401 Bacteria 1009
358 Ga0373937_0960409 3300036401 Bacteria 803
359 Ga0373925_0096884 3300037068 Bacteria 2262
360 Ga0373925_0144570 3300037068 Unclassified 1863
361 Ga0395900_0485258 3300037418 Unclassified 1188
362 Ga0395900_0996842 3300037418 Bacteria 758
363 Ga0395905_0006458 3300037471 Bacteria 11803
364 Ga0395905_0017276 3300037471 Bacteria 6853
365 Ga0395905_0054436 3300037471 Bacteria 3745
366 Ga0395901_0201854 3300038443 Bacteria 2084
367 Ga0400488_28508 3300038741 Bacteria 3848
368 Ga0242420_076377 3300038996 Unclassified 687
369 Ga0400483_083420 3300039062 Bacteria 7991
370 Ga0400483_284260 3300039062 Bacteria 5494
371 Ga0400489_22353 3300039093 Bacteria 1395
372 Ga0436365_0695157 3300039437 Bacteria 511493
373 Ga0436365_1600837 3300039437 Bacteria 192134
374 Ga0439436_0010256 3300041404 Bacteria 2861
375 Ga0439436_0093910 3300041404 Bacteria 835
376 Ga0439439_0014781 3300041406 Bacteria 1902
377 Ga0439465_0000667 3300041413 Bacteria 10503
378 Ga0439465_0158764 3300041413 Bacteria 810
379 Ga0451793_0863060 3300041452 Bacteria 574
380 Ga0451807_1033259 3300041486 Bacteria 528
381 Ga0451847_0058150 3300041503 Bacteria 610
382 Ga0451851_1013972 3300041507 Unclassified 516
383 Ga0451853_0214493 3300041512 Bacteria 3770
384 Ga0451853_2845121 3300041512 Unclassified 778
385 Ga0439441_002765 3300042001 Bacteria 2507
386 Ga0439445_0004809 3300042004 Bacteria 3065
387 Ga0439445_0006480 3300042004 Bacteria 2692
388 Ga0439445_0034465 3300042004 Bacteria 1326
389 Ga0439449_0000312 3300042007 Bacteria 17528
390 Ga0439449_0032204 3300042007 Bacteria 1954
391 Ga0439457_025554 3300042014 Bacteria 1307
392 Ga0439462_0045507 3300042015 Bacteria 1175
393 Ga0439460_0153115 3300042461 Unclassified 770
394 Ga0451577_0300856 3300042876 Bacteria 1454
395 Ga0451577_0736603 3300042876 Unclassified 892
396 Ga0453684_0100637 3300044712 Bacteria 3537
397 Ga0453684_0308089 3300044712 Unclassified 1798
398 Ga0451576_0103663 3300045051 Bacteria 2959
399 Ga0451576_0359695 3300045051 Bacteria 1524
400 Ga0495592_0004385 3300046454 Eukaryota 10323
401 Ga0495603_0160542 3300046455 Bacteria 1304
402 Ga0495629_0102747 3300046459 Bacteria 1994
403 Ga0495638_0199256 3300046460 Bacteria 1131
404 Ga0495653_0471697 3300046463 Eukaryota 786
405 Ga0495580_0043286 3300046472 Bacteria 3205
406 Ga0495580_0504941 3300046472 Unclassified 807
407 Ga0495594_0301944 3300046499 Unclassified 912
408 Ga0495594_0414949 3300046499 Unclassified 766
409 Ga0495608_0008746 3300046511 Eukaryota 7082
410 Ga0495608_0137406 3300046511 Bacteria 1561
411 Ga0495618_0021548 3300046514 Eukaryota 3974
412 Ga0495628_0048920 3300046516 Eukaryota 3349
413 Ga0495630_0482435 3300046517 Eukaryota 950
414 Ga0495630_0501409 3300046517 Unclassified 931
415 Ga0495663_0000829 3300046525 Bacteria 10579
416 Ga0495652_0053567 3300046529 Eukaryota 3438
417 Ga0495665_0403076 3300046531 Unclassified 694
418 Ga0495598_0000061 3300046537 Bacteria 17578
419 Ga0495621_0000101 3300046539 Bacteria 17540
420 Ga0495621_0238099 3300046539 Unclassified 741
421 Ga0495645_0009313 3300046543 Eukaryota 6869
422 Ga0495645_0917288 3300046543 Unclassified 519
423 Ga0495667_0001121 3300046559 Bacteria 17425
424 Ga0495634_0027920 3300046642 Eukaryota 3922
425 Ga0495635_0044890 3300046663 Eukaryota 3049
426 Ga0495635_0370648 3300046663 Viruses 954
427 Ga0495635_0371342 3300046663 Bacteria 953
428 Ga0495657_0001670 3300046675 Bacteria 19063
429 Ga0495657_0003895 3300046675 Eukaryota 12011
430 Ga0495599_0002050 3300046678 Eukaryota 11674
431 Ga0495646_0008242 3300046680 Eukaryota 6625
432 Ga0495646_0262744 3300046680 Unclassified 922
433 Ga0495647_0447219 3300046681 Unclassified 598
434 Ga0495658_0186644 3300046683 Bacteria 1288
435 Ga0495658_0515308 3300046683 Unclassified 765
436 Ga0495613_0607574 3300046689 Viruses 727
437 Ga0495624_0002372 3300046690 Eukaryota 14310
438 Ga0495624_0502987 3300046690 Unclassified 725
439 Ga0495600_0299752 3300046809 Bacteria 1014
440 Ga0495604_0003988 3300047317 Eukaryota 11738
441 Ga0495674_0001982 3300047319 Eukaryota 20120
442 Ga0495674_0149124 3300047319 Bacteria 1962
443 Ga0495676_0000780 3300047321 Eukaryota 26618
444 Ga0495680_0125808 3300047322 Bacteria 1888
445 Ga0495675_0303920 3300047444 Eukaryota 947
446 Ga0495684_0041787 3300047471 Bacteria 3513
447 Ga0495684_0175889 3300047471 Bacteria 1589
448 Ga0495684_0202005 3300047471 Unclassified 1465
449 Ga0495602_0019300 3300048088 Eukaryota 6773
450 Ga0496101_0555743 3300048904 Bacteria 908
451 Ga0496105_0412050 3300048908 Bacteria 1071
452 Ga0496106_0561043 3300048909 Bacteria 916
453 Ga0496108_0078289 3300048911 Bacteria 2798
454 Ga0496108_0224095 3300048911 Bacteria 1634
455 Ga0496109_0858785 3300048912 Bacteria 845
456 Ga0496109_1316320 3300048912 Bacteria 658
457 Ga0496110_0031837 3300048913 Bacteria 4553
458 Ga0496112_0003391 3300048915 Bacteria 13159
459 Ga0496112_0064836 3300048915 Bacteria 3605
460 Ga0496113_0097083 3300048916 Unclassified 2279
461 Ga0496114_0042448 3300048917 Bacteria 3771
462 Ga0496114_0099783 3300048917 Bacteria 2477
463 Ga0496122_0265384 3300048925 Bacteria 950
464 Ga0501031_0154411 3300049568 Bacteria 1500
465 Ga0501032_0082539 3300049569 Bacteria 2138
466 Ga0501034_0804606 3300049571 Bacteria 832
467 Ga0501034_0892700 3300049571 Bacteria 777
468 Ga0501037_0056789 3300049573 Bacteria 2859
469 Ga0501037_0119085 3300049573 Bacteria 1899
470 Ga0501037_0186888 3300049573 Bacteria 1468
471 Ga0501038_0456276 3300049574 Bacteria 982
472 Ga0501038_0716985 3300049574 Bacteria 748
473 Ga0501039_0500726 3300049575 Bacteria 954
474 Ga0501040_0450959 3300049576 Bacteria 926
475 Ga0501041_0296863 3300049577 Bacteria 1018
476 Ga0501043_0373658 3300049579 Bacteria 1080
477 Ga0501043_0438665 3300049579 Bacteria 983
478 Ga0501046_0110255 3300049580 Bacteria 2103
479 Ga0501047_0130781 3300049581 Bacteria 2391
480 Ga0501047_0420142 3300049581 Bacteria 1168
481 Ga0501047_1017360 3300049581 Unclassified 642
482 Ga0501048_0065216 3300049582 Bacteria 2575
483 Ga0501048_0378077 3300049582 Bacteria 1011
484 Ga0501071_0474807 3300049587 Bacteria 958
485 Ga0501073_0007984 3300049589 Bacteria 7856
486 Ga0501075_0120358 3300049591 Bacteria 1998
487 Ga0501076_0215649 3300049592 Bacteria 1569
488 Ga0501076_0432672 3300049592 Bacteria 1083
489 Ga0501079_0947553 3300049741 Bacteria 678
490 Ga0501080_0399578 3300049742 Bacteria 1236
491 Ga0501081_0916323 3300049743 Unclassified 661
492 Ga0501035_0229130 3300049822 Bacteria 1584
493 Ga0501035_0296518 3300049822 Unclassified 1363
494 Ga0501035_0406188 3300049822 Bacteria 1132
495 Ga0501035_0740229 3300049822 Bacteria 790
496 Ga0501044_0072345 3300049823 Bacteria 3505
497 Ga0501044_0217701 3300049823 Bacteria 1861
498 Ga0501044_0333332 3300049823 Bacteria 1439
499 Ga0501044_0463752 3300049823 Bacteria 1172
500 nmdc:mga07m45_212937_c1 3300050496 Bacteria 1124
501 nmdc:mga09592_10106_c1 3300050508 Bacteria 7676
502 nmdc:mga0qj67_789136_c1 3300050509 Bacteria 752
503 nmdc:mga08y16_2676_c1 3300050511 Bacteria 18308
504 nmdc:mga08y16_896430_c1 3300050511 Bacteria 873
505 nmdc:mga08y16_94773_c1 3300050511 Bacteria 3109
506 nmdc:mga08x19_6282_c1 3300050514 Bacteria 7032
507 Ga0495619_0124974 3300053085 Bacteria 1765
508 Ga0495619_0244686 3300053085 Bacteria 1243
509 Ga0500658_0312054 3300053134 Bacteria 723
510 Ga0500596_020901 3300053735 Bacteria 985
511 Ga0501082_0561680 3300060353 Bacteria 998
512 2687582191 2687453130 Bacteria 4227172
513 2739249527 2738543013 Bacteria 5618633
514 2894414796 2894414249 Bacteria 4405451
515 Ga0209966_1000108
516 MBSR1b_contig_13844533
517 JGI25157J39369_1001440
518 JGI25406J46586_10064535
519 Ga0055524_1052259
520 Ga0065707_10179017
521 Ga0065707_10317127
522 Ga0070676_10246105
523 Ga0070690_100290284
524 Ga0070670_100004471
525 Ga0070670_100031661
526 Ga0070670_100039951
527 Ga0070670_100068289
528 Ga0068869_100013307
529 Ga0068869_100029149
530 Ga0070666_10004385
531 Ga0070666_10026427
532 Ga0070682_100004878
533 Ga0068868_100004933
534 Ga0070660_100018609
535 Ga0070689_100053613
536 Ga0070689_100824429
537 Ga0070689_101122750
538 Ga0070668_100003653
539 Ga0070668_100095888
540 Ga0070668_100205833
541 Ga0070669_100002397
542 Ga0070669_100021023
543 Ga0070669_100122618
544 Ga0070669_100382946
545 Ga0070669_100566274
546 Ga0070669_101144084
547 Ga0070675_100010548
548 Ga0070675_100035040
549 Ga0070675_100053546
550 Ga0070675_100067295
551 Ga0070671_100000036
552 Ga0070671_100029181
553 Ga0070671_100153693
554 Ga0070671_100619175
555 Ga0070674_100038348
556 Ga0070674_100089387
557 Ga0070674_100753253
558 Ga0070673_100076286
559 Ga0070673_101626488
560 Ga0070688_100036899
561 Ga0070688_100078299
562 Ga0070688_100528833
563 Ga0070659_100003947
564 Ga0070659_100132343
565 Ga0070667_100015583
566 Ga0070667_100025783
567 Ga0070667_100556136
568 Ga0070714_100002264
569 Ga0070714_100023863
570 Ga0070713_100006101
571 Ga0070713_100206574
572 Ga0070710_10231403
573 Ga0070710_10445548
574 Ga0070701_10113030
575 Ga0070705_100939127
576 Ga0070708_100001185
577 Ga0070678_100002199
578 Ga0070678_100509314
579 Ga0070678_100938006
580 Ga0070662_100030341
581 Ga0070662_100511544
582 Ga0070662_100554457
583 Ga0070681_10013609
584 Ga0068867_100005598
585 Ga0068867_100012294
586 Ga0068867_100355274
587 Ga0068867_101348109
588 Ga0070685_10025552
589 Ga0070699_101477067
590 Ga0070679_100383495
591 Ga0070684_100442047
592 Ga0070697_100414514
593 Ga0068853_100018685
594 Ga0068853_100157230
595 Ga0070672_100012903
596 Ga0070672_100586394
597 Ga0070686_100549051
598 Ga0070696_100310623
599 Ga0070665_100043396
600 Ga0070665_101028203
601 Ga0068855_100163892
602 Ga0068857_100685622
603 Ga0068854_100103246
604 Ga0068854_100410835
605 Ga0068854_100511034
606 Ga0068852_101312037
607 Ga0068859_100019435
608 Ga0068859_100118131
609 Ga0068859_100644948
610 Ga0068864_100000918
611 Ga0068864_100024871
612 Ga0068864_100076751
613 Ga0068864_100362755
614 Ga0068864_100629293
615 Ga0068864_101164191
616 Ga0068861_100018637
617 Ga0068861_100278301
618 Ga0068861_101565685
619 Ga0068851_10161907
620 Ga0068863_100005523
621 Ga0068863_100006843
622 Ga0068863_100062069
623 Ga0068863_100541047
624 Ga0068858_100005177
625 Ga0068858_101033938
626 Ga0068858_101050589
627 Ga0068860_100002164
628 Ga0068860_100039385
629 Ga0068860_100234478
630 Ga0068860_100851255
631 Ga0068862_100053015
632 Ga0068862_100305701
633 Ga0068862_100401716
634 Ga0081539_10002066
635 Ga0097621_100003339
636 Ga0097621_100267600
637 Ga0097621_100499260
638 Ga0097621_100636829
639 Ga0075370_10172876
640 Ga0068871_100005315
641 Ga0068871_100253507
642 Ga0068871_100351425
643 Ga0075428_100045462
644 Ga0075430_100053021
645 Ga0075430_100847637
646 Ga0075434_100240290
647 Ga0075429_100002542
648 Ga0068865_100005532
649 Ga0068865_100341220
650 Ga0075436_100011565
651 Ga0097620_100019438
652 Ga0097620_100118133
653 Ga0097620_100644935
654 Ga0099826_10129341
655 Ga0099794_10001563
656 Ga0111539_10008911
657 Ga0111539_10034013
658 Ga0111539_10096265
659 Ga0111539_11748714
660 Ga0111539_12075580
661 Ga0105245_10549340
662 Ga0105247_10108346
663 Ga0105247_10355318
664 Ga0105243_10188219
665 Ga0105242_10068055
666 Ga0105242_10167721
667 Ga0105248_10003651
668 Ga0105248_10047018
669 Ga0105248_10071508
670 Ga0105248_10082022
671 Ga0105248_10151009
672 Ga0105248_10332958
673 Ga0105248_10333445
674 Ga0105248_12085376
675 Ga0105237_10012080
676 Ga0105238_10172514
677 Ga0105238_10465825
678 Ga0105249_10019560
679 Ga0157373_10089441
680 Ga0157371_10102212
681 Ga0157370_10025051
682 Ga0157370_10308366
683 Ga0157374_10003902
684 Ga0157374_10007175
685 Ga0157374_10575624
686 Ga0157374_10753593
687 Ga0157374_10979815
688 Ga0157378_10026941
689 Ga0157378_10035833
690 Ga0157378_10153232
691 Ga0157378_10897387
692 Ga0163162_10030574
693 Ga0163162_10099301
694 Ga0163162_10208673
695 Ga0157375_10017493
696 Ga0157375_10019666
697 Ga0157375_10156314
698 Ga0157375_10198118
699 Ga0163163_10024872
700 Ga0163163_10040215
701 Ga0163163_11080553
702 Ga0157380_10066724
703 Ga0157380_10131067
704 Ga0157380_10802479
705 Ga0157380_11284207
706 Ga0182008_10031966
707 Ga0182008_10032036
708 Ga0157377_10287794
709 Ga0157379_10004507
710 Ga0157379_10149082
711 Ga0157379_10389315
712 Ga0157376_10008447
713 Ga0157376_10035773
714 Ga0182007_10008428
715 Ga0183369_1003
716 Ga0163161_10003504
717 Ga0163161_10031817
718 Ga0163161_10097705
719 Ga0163161_10107514
720 Ga0213876_10000006
721 Ga0213876_10000124
722 Ga0209258_114022
723 Ga0209026_1000145
724 Ga0207666_1046745
725 Ga0209025_1000466
726 Ga0209256_1009850
727 Ga0207656_10272746
728 Ga0207656_10378879
729 Ga0207692_10076792
730 Ga0207688_10271662
731 Ga0207680_10001218
732 Ga0207680_10797202
733 Ga0207645_10000997
734 Ga0207645_10590259
735 Ga0207705_10426845
736 Ga0207707_10160363
737 Ga0207671_10024015
738 Ga0207657_10108983
739 Ga0207649_10818320
740 Ga0207652_10195281
741 Ga0207681_10001759
742 Ga0207681_10029686
743 Ga0207694_10033141
744 Ga0207694_10424819
745 Ga0207650_10029252
746 Ga0207650_10187097
747 Ga0207650_10646598
748 Ga0207650_10963572
749 Ga0207659_10003127
750 Ga0207659_10198193
751 Ga0207659_10404284
752 Ga0207700_10073412
753 Ga0207664_10000315
754 Ga0207664_11532340
755 Ga0207644_10000155
756 Ga0207644_10035719
757 Ga0207644_10411755
758 Ga0207644_10469188
759 Ga0207690_10001379
760 Ga0207690_10047495
761 Ga0207706_10082542
762 Ga0207686_10118497
763 Ga0207686_10840537
764 Ga0207709_10124480
765 Ga0207670_10020564
766 Ga0207670_10973356
767 Ga0207669_10086480
768 Ga0207704_10001647
769 Ga0207704_10284991
770 Ga0207691_10000687
771 Ga0207691_10002769
772 Ga0207691_10201469
773 Ga0207711_10010992
774 Ga0207711_10030548
775 Ga0207711_10040263
776 Ga0207711_10108399
777 Ga0207711_10881765
778 Ga0207689_10001598
779 Ga0207689_10163387
780 Ga0207679_10319097
781 Ga0207667_10015243
782 Ga0207651_10014400
783 Ga0207651_10275222
784 Ga0207712_10043632
785 Ga0207668_10001592
786 Ga0207668_10026310
787 Ga0207668_10749644
788 Ga0207668_10924965
789 Ga0207640_10414459
790 Ga0207640_11363095
791 Ga0207658_10002849
792 Ga0207658_10098509
793 Ga0207658_10303257
794 Ga0207677_10008664
795 Ga0207703_10004578
796 Ga0207703_10261305
797 Ga0207708_10473206
798 Ga0207641_10001705
799 Ga0207641_10010763
800 Ga0207641_10015688
801 Ga0207641_10024707
802 Ga0207641_10650798
803 Ga0207648_10002985
804 Ga0207648_10003315
805 Ga0207648_10400941
806 Ga0207676_10006526
807 Ga0207676_10049488
808 Ga0207676_10056664
809 Ga0207676_10058044
810 Ga0207676_10125463
811 Ga0207676_10257926
812 Ga0207674_10804593
813 Ga0207675_100031791
814 Ga0207675_100166648
815 Ga0207675_100707465
816 Ga0207683_10000250
817 Ga0207683_10026920
818 Ga0207683_10150455
819 Ga0207683_10293864
820 Ga0207698_10673689
821 Ga0207428_10002138
822 Ga0268266_10039607
823 Ga0268265_10146500
824 Ga0268265_10913651
825 Ga0268265_11577292
826 Ga0268264_10005288
827 Ga0268264_10028152
828 Ga0268264_10144773
829 Ga0268264_10479983
830 Ga0316183_1013904
831 Ga0265327_10120705
832 Ga0307408_100004085
833 Ga0307408_100294564
834 Ga0307408_100924861
835 Ga0307516_10000610
836 Ga0307405_10001333
837 Ga0307405_10983693
838 Ga0307406_10330010
839 Ga0307406_11248728
840 Ga0307407_10009244
841 Ga0307409_100126017
842 Ga0307416_100016316
843 Ga0307416_100580353
844 Ga0307416_102386923
845 Ga0307411_10002241
846 Ga0307411_10470263
847 Ga0373936_0017706
848 Ga0373936_0183451
849 Ga0373956_0062499
850 Ga0373957_0004945
851 Ga0373943_0075702
852 Ga0373943_0223962
853 Ga0373955_0075960
854 Ga0373955_0076399
855 Ga0373955_0080490
856 Ga0316574_0084776
857 Ga0373924_0371585
858 Ga0373931_0864808
859 Ga0373935_0004501
860 Ga0373935_0031702
861 Ga0373935_0636099
862 Ga0373935_0837776
863 Ga0373935_1199038
864 Ga0373927_0028898
865 Ga0373933_0111799
866 Ga0373933_0204942
867 Ga0373947_0045270
868 Ga0373947_0352290
869 Ga0373937_0000872
870 Ga0373937_0090378
871 Ga0373937_0639021
872 Ga0373937_0960409
873 Ga0373925_0096884
874 Ga0373925_0144570
875 Ga0395900_0485258
876 Ga0395900_0996842
877 Ga0395905_0006458
878 Ga0395905_0017276
879 Ga0395905_0054436
880 Ga0395901_0201854
881 Ga0400488_28508
882 Ga0242420_076377
883 Ga0400483_083420
884 Ga0400483_284260
885 Ga0400489_22353
886 Ga0436365_0695157
887 Ga0436365_1600837
888 Ga0439436_0010256
889 Ga0439436_0093910
890 Ga0439439_0014781
891 Ga0439465_0000667
892 Ga0439465_0158764
893 Ga0451793_0863060
894 Ga0451807_1033259
895 Ga0451847_0058150
896 Ga0451851_1013972
897 Ga0451853_0214493
898 Ga0451853_2845121
899 Ga0439441_002765
900 Ga0439445_0004809
901 Ga0439445_0006480
902 Ga0439445_0034465
903 Ga0439449_0000312
904 Ga0439449_0032204
905 Ga0439457_025554
906 Ga0439462_0045507
907 Ga0439460_0153115
908 Ga0451577_0300856
909 Ga0451577_0736603
910 Ga0453684_0100637
911 Ga0453684_0308089
912 Ga0451576_0103663
913 Ga0451576_0359695
914 Ga0495592_0004385
915 Ga0495603_0160542
916 Ga0495629_0102747
917 Ga0495638_0199256
918 Ga0495653_0471697
919 Ga0495580_0043286
920 Ga0495580_0504941
921 Ga0495594_0301944
922 Ga0495594_0414949
923 Ga0495608_0008746
924 Ga0495608_0137406
925 Ga0495618_0021548
926 Ga0495628_0048920
927 Ga0495630_0482435
928 Ga0495630_0501409
929 Ga0495663_0000829
930 Ga0495652_0053567
931 Ga0495665_0403076
932 Ga0495598_0000061
933 Ga0495621_0000101
934 Ga0495621_0238099
935 Ga0495645_0009313
936 Ga0495645_0917288
937 Ga0495667_0001121
938 Ga0495634_0027920
939 Ga0495635_0044890
940 Ga0495635_0370648
941 Ga0495635_0371342
942 Ga0495657_0001670
943 Ga0495657_0003895
944 Ga0495599_0002050
945 Ga0495646_0008242
946 Ga0495646_0262744
947 Ga0495647_0447219
948 Ga0495658_0186644
949 Ga0495658_0515308
950 Ga0495613_0607574
951 Ga0495624_0002372
952 Ga0495624_0502987
953 Ga0495600_0299752
954 Ga0495604_0003988
955 Ga0495674_0001982
956 Ga0495674_0149124
957 Ga0495676_0000780
958 Ga0495680_0125808
959 Ga0495675_0303920
960 Ga0495684_0041787
961 Ga0495684_0175889
962 Ga0495684_0202005
963 Ga0495602_0019300
964 Ga0496101_0555743
965 Ga0496105_0412050
966 Ga0496106_0561043
967 Ga0496108_0078289
968 Ga0496108_0224095
969 Ga0496109_0858785
970 Ga0496109_1316320
971 Ga0496110_0031837
972 Ga0496112_0003391
973 Ga0496112_0064836
974 Ga0496113_0097083
975 Ga0496114_0042448
976 Ga0496114_0099783
977 Ga0496122_0265384
978 Ga0501031_0154411
979 Ga0501032_0082539
980 Ga0501034_0804606
981 Ga0501034_0892700
982 Ga0501037_0056789
983 Ga0501037_0119085
984 Ga0501037_0186888
985 Ga0501038_0456276
986 Ga0501038_0716985
987 Ga0501039_0500726
988 Ga0501040_0450959
989 Ga0501041_0296863
990 Ga0501043_0373658
991 Ga0501043_0438665
992 Ga0501046_0110255
993 Ga0501047_0130781
994 Ga0501047_0420142
995 Ga0501047_1017360
996 Ga0501048_0065216
997 Ga0501048_0378077
998 Ga0501071_0474807
999 Ga0501073_0007984
1000 Ga0501075_0120358
1001 Ga0501076_0215649
1002 Ga0501076_0432672
1003 Ga0501079_0947553
1004 Ga0501080_0399578
1005 Ga0501081_0916323
1006 Ga0501035_0229130
1007 Ga0501035_0296518
1008 Ga0501035_0406188
1009 Ga0501035_0740229
1010 Ga0501044_0072345
1011 Ga0501044_0217701
1012 Ga0501044_0333332
1013 Ga0501044_0463752
1014 nmdc:mga07m45_212937_c1
1015 nmdc:mga09592_10106_c1
1016 nmdc:mga0qj67_789136_c1
1017 nmdc:mga08y16_2676_c1
1018 nmdc:mga08y16_896430_c1
1019 nmdc:mga08y16_94773_c1
1020 nmdc:mga08x19_6282_c1
1021 Ga0495619_0124974
1022 Ga0495619_0244686
1023 Ga0500658_0312054
1024 Ga0500596_020901
1025 Ga0501082_0561680
1026 2687582191
1027 2739249527
1028 2894414796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

34

138

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

44

132

0.79

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

11

130

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4avc-assembly1.cif.gz_A crystal structure of protein lysine acetyltransferase rv0998 in complex with acetyl coa and camp 0.8527 45 150
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8498 2 151
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8428 45 151
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8425 45 151
6r45-assembly1.cif.gz_A crystal structure of eukaryotic o-glcnacase hat-like domain 0.8411 71 151
ID Description Score Start End Superfamily
af_Q54IL8_181_295_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9132 48 128 3.40.630.30
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9033 45 109 3.40.630.30
af_Q6ES10_187_273_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8617 43 107 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8498 2 151 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8497 45 133 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2S8PNJ3-F1-model_v4 GNAT family N-acetyltransferase 1.004 49 151 GO:0016747
AF-A0A7I8E5N1-F1-model_v4 N-acetyltransferase domain-containing protein 1.002 47 151 GO:0016747
AF-A0A3G9GFX0-F1-model_v4 Histone acetyltransferase HPA2 1.001 1 151 GO:0016747
AF-A0A7W9SRH1-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 1.001 1 151 GO:0016747
AF-A0A7Y2D6Z8-F1-model_v4 GNAT family N-acetyltransferase 1.001 1 151 GO:0016747

Map