F457746

General Info

Members Datasets Scaffolds Average Seq Length
514 246 1028 230

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0372584|Ga0373937_0372584_52_801
Length 249
Sequence MPCGFALWRRFALNSQLPVDLQAAAKLKSPEAPLLRAEDLWKSYENGSIQVLNGVDLEAFPGQAVALCGPSGCGKSTLLHLLGGLDEPDRGRILIHGSDLASRRRTHFLRHEVGFVFQLHNLIPDLTLEENCLIPTVAAGTPRTDALARLHDLAERTGLTHRLKQRIQKLSGGERQRTALCRALMNRPGILLADEPTGSLDERTSGQIFDLLLELARTDGITLVMATHDRGLAAHCDRLVEMRDGKICE

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
102 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
131 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
199 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
208 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
209 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
210 2643221638 Duganella sp. Root336D2 Isolate Unclassified
211 2643221645 Massilia sp. Root351 Isolate Unclassified
212 2643221664 Massilia sp. Root418 Isolate Unclassified
213 2738541280 Massilia sp. GV090 Isolate Unclassified
214 2738541297 Duganella sp. GV083 Isolate Unclassified
215 2738541300 Massilia sp. GV016 Isolate Unclassified
216 2738541357 Duganella sp. GV053 Isolate Unclassified
217 2738543003 Duganella sp. GV066 Isolate Unclassified
218 2738543018 Massilia sp. GV045 Isolate Unclassified
219 2738543026 Duganella sp. GV089 Isolate Unclassified
220 2738543029 Duganella sp. GV039 Isolate Unclassified
221 2738543030 Massilia sp. GV097 Isolate Unclassified
222 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
223 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
224 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
225 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
226 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
227 2821131069 Duganella sp. 1224 Isolate Unclassified
228 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
229 2842711865 Duganella sp. R-73148 Isolate Unclassified
230 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
231 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
232 2857553236 Duganella sp. R-74557 Isolate Unclassified
233 2857558681 Duganella sp. R-74565 Isolate Unclassified
234 2857564685 Duganella sp. R-74599 Isolate Unclassified
235 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
236 2904424332 Duganella sp. 1411 Isolate Rhizosphere
237 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
238 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
239 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
240 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
241 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
242 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
243 2919476304 Duganella sp. 3397 Isolate Unclassified
244 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
245 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
246 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.22
Metatranscriptomes 0
Isolates 7.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.09
Nodule 0.97
Rhizoplane 1.75
Rhizosphere 69.65
Stem 0
Stem Tuber 0
Unclassified 5.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0372584 3300036401 Bacteria 1354
2 JGI25154J39366_1000833 3300002738 Bacteria 13412
3 JGI25158J39367_1012445 3300002739 Bacteria 1121
4 JGI25152J39213_1000065 3300002773 Bacteria 70114
5 JGI25150J39212_1000457 3300002774 Bacteria 17975
6 JGI25150J39212_1002265 3300002774 Bacteria 4876
7 JGI25150J39212_1008471 3300002774 Bacteria 2009
8 JGI25159J45721_1001693 3300002987 Bacteria 8927
9 JGI25159J45721_1004374 3300002987 Bacteria 4705
10 JGI25153J46596_10004646 3300003215 Bacteria 7346
11 JGI25153J46596_10028743 3300003215 Bacteria 1923
12 rootH2_10034108 3300003320 Bacteria 1274
13 rootH2_10110891 3300003320 Bacteria 3099
14 JGI25160J50197_1049536 3300003354 Bacteria 900
15 JGI25161J50226_1002449 3300003374 Bacteria 4757
16 JGI25161J50226_1002599 3300003374 Bacteria 4537
17 Ga0055538_1000020 3300003751 Bacteria 264193
18 Ga0055539_1000025 3300003752 Bacteria 264193
19 Ga0055533_1000034 3300003756 Bacteria 264193
20 Ga0055525_1000044 3300003759 Bacteria 264193
21 Ga0055529_1000128 3300003763 Bacteria 108143
22 Ga0055526_1000019 3300003771 Bacteria 189698
23 Ga0055526_1000148 3300003771 Bacteria 61933
24 Ga0055526_1000283 3300003771 Bacteria 42457
25 Ga0055526_1006734 3300003771 Bacteria 6156
26 Ga0055537_1000063 3300003773 Bacteria 77468
27 Ga0055537_1004609 3300003773 Bacteria 3900
28 Ga0055524_1000151 3300003775 Bacteria 82351
29 Ga0055524_1000883 3300003775 Bacteria 19550
30 Ga0055524_1001152 3300003775 Bacteria 15898
31 Ga0055524_1010256 3300003775 Bacteria 3742
32 Ga0055524_1013090 3300003775 Bacteria 3149
33 Ga0055534_1000045 3300003784 Bacteria 98659
34 Ga0055534_1004411 3300003784 Bacteria 4082
35 Ga0055528_1000013 3300003790 Bacteria 176239
36 Ga0055530_10001631 3300003791 Bacteria 16047
37 Ga0055530_10006471 3300003791 Bacteria 5220
38 Ga0055530_10010544 3300003791 Bacteria 3403
39 Ga0055531_10002342 3300003794 Bacteria 12754
40 Ga0055541_1000019 3300003841 Bacteria 264193
41 Ga0055543_1004171 3300004625 Bacteria 4009
42 Ga0065165_1000005 3300005262 Bacteria 370361
43 Ga0065165_1002696 3300005262 Bacteria 14278
44 Ga0065165_1047368 3300005262 Bacteria 1241
45 Ga0070658_10350550 3300005327 Bacteria 1263
46 Ga0070683_100022995 3300005329 Bacteria 5573
47 Ga0070683_100036607 3300005329 Bacteria 4491
48 Ga0070683_100240385 3300005329 Bacteria 1722
49 Ga0070683_100415005 3300005329 Bacteria 1284
50 Ga0070682_100019759 3300005337 Bacteria 3956
51 Ga0070660_100003069 3300005339 Bacteria 11481
52 Ga0070661_100101723 3300005344 Bacteria 2138
53 Ga0070661_100107004 3300005344 Bacteria 2085
54 Ga0070659_100002858 3300005366 Bacteria 12292
55 Ga0070684_100015897 3300005535 Bacteria 6142
56 Ga0070684_100143178 3300005535 Unclassified 2163
57 Ga0070684_100232809 3300005535 Bacteria 1682
58 Ga0068853_100000261 3300005539 Bacteria 37164
59 Ga0068853_100028747 3300005539 Bacteria 4679
60 Ga0068853_100354972 3300005539 Unclassified 1364
61 Ga0068855_100018987 3300005563 Bacteria 8266
62 Ga0068855_100023211 3300005563 Bacteria 7432
63 Ga0068855_100027693 3300005563 Bacteria 6780
64 Ga0068855_100302535 3300005563 Bacteria 1771
65 Ga0068855_100511126 3300005563 Bacteria 1304
66 Ga0070664_100047761 3300005564 Bacteria 3617
67 Ga0068857_100115673 3300005577 Bacteria 2413
68 Ga0068854_100003668 3300005578 Bacteria 9603
69 Ga0068854_100012386 3300005578 Bacteria 5583
70 Ga0068854_100035394 3300005578 Bacteria 3494
71 Ga0068856_100028302 3300005614 Bacteria 5471
72 Ga0068852_100000038 3300005616 Bacteria 96977
73 Ga0068852_100018200 3300005616 Bacteria 5531
74 Ga0068852_100108008 3300005616 Unclassified 2525
75 Ga0068852_100222573 3300005616 Bacteria 1795
76 Ga0068852_100383919 3300005616 Unclassified 1378
77 Ga0068852_100781173 3300005616 Bacteria 968
78 Ga0068851_10055653 3300005834 Bacteria 2016
79 Ga0070717_10272807 3300006028 Bacteria 1498
80 Ga0075432_10055213 3300006058 Bacteria 1407
81 Ga0079104_1011067 3300006946 Bacteria 2926
82 Ga0099826_10000001 3300006948 Bacteria 1155201
83 Ga0105244_10002584 3300009036 Bacteria 13587
84 Ga0105244_10009833 3300009036 Bacteria 5839
85 Ga0105240_10000965 3300009093 Bacteria 51267
86 Ga0105240_10014003 3300009093 Bacteria 10974
87 Ga0105240_10098133 3300009093 Unclassified 3568
88 Ga0105240_10201792 3300009093 Bacteria 2330
89 Ga0105240_10289822 3300009093 Bacteria 1877
90 Ga0105241_10036311 3300009174 Unclassified 3708
91 Ga0105241_10041045 3300009174 Unclassified 3494
92 Ga0105237_10022163 3300009545 Bacteria 6518
93 Ga0105237_10123374 3300009545 Bacteria 2585
94 Ga0105237_10128507 3300009545 Bacteria 2528
95 Ga0105237_10202028 3300009545 Unclassified 1988
96 Ga0105237_10202029 3300009545 Unclassified 1988
97 Ga0105238_10000399 3300009551 Bacteria 46183
98 Ga0105238_10024111 3300009551 Bacteria 6202
99 Ga0105238_10089774 3300009551 Unclassified 3060
100 Ga0105238_10248336 3300009551 Unclassified 1757
101 Ga0105239_10022162 3300010375 Bacteria 7001
102 Ga0105239_10147927 3300010375 Unclassified 2621
103 Ga0105239_10290387 3300010375 Unclassified 1841
104 Ga0157373_10160603 3300013100 Bacteria 1581
105 Ga0157370_10000102 3300013104 Bacteria 97420
106 Ga0157369_10000154 3300013105 Bacteria 97000
107 Ga0157369_10081061 3300013105 Unclassified 3474
108 Ga0157369_10170980 3300013105 Unclassified 2290
109 Ga0157369_10172596 3300013105 Bacteria 2278
110 Ga0157369_10503926 3300013105 Unclassified 1252
111 Ga0157374_10002372 3300013296 Bacteria 15865
112 Ga0163162_11495332 3300013306 Bacteria 769
113 Ga0157372_10000082 3300013307 Bacteria 99224
114 Ga0157372_10027929 3300013307 Bacteria 6150
115 Ga0157372_10163624 3300013307 Bacteria 2572
116 Ga0157372_10441988 3300013307 Unclassified 1516
117 Ga0182008_10000355 3300014497 Bacteria 35722
118 Ga0157376_10815524 3300014969 Bacteria 947
119 Ga0182006_1000067 3300015261 Bacteria 147932
120 Ga0182006_1000192 3300015261 Bacteria 62926
121 Ga0182007_10000123 3300015262 Bacteria 53953
122 Ga0182005_1000002 3300015265 Bacteria 908499
123 Ga0182005_1000008 3300015265 Bacteria 471394
124 Ga0163161_10171724 3300017792 Bacteria 1658
125 Ga0213872_10000019 3300021361 Bacteria 172803
126 Ga0213872_10000444 3300021361 Bacteria 33829
127 Ga0213872_10011739 3300021361 Bacteria 4141
128 Ga0213872_10040275 3300021361 Bacteria 2133
129 Ga0213872_10068029 3300021361 Bacteria 1607
130 Ga0209436_100250 3300025208 Bacteria 24650
131 Ga0209436_100756 3300025208 Bacteria 13395
132 Ga0209436_108653 3300025208 Bacteria 2006
133 Ga0209784_100002 3300025224 Bacteria 1753105
134 Ga0209566_100003 3300025225 Bacteria 1753105
135 Ga0209674_100004 3300025226 Bacteria 1753105
136 Ga0209563_100006 3300025230 Bacteria 1753105
137 Ga0207425_1000001 3300025245 Bacteria 2525432
138 Ga0207425_1000048 3300025245 Bacteria 188748
139 Ga0207425_1000348 3300025245 Bacteria 32202
140 Ga0209646_1000007 3300025246 Bacteria 670994
141 Ga0209677_100003 3300025253 Bacteria 1753105
142 Ga0209129_1000003 3300025258 Bacteria 903689
143 Ga0209129_1004586 3300025258 Bacteria 5313
144 Ga0209565_1000003 3300025263 Bacteria 1099648
145 Ga0209565_1000805 3300025263 Bacteria 17951
146 Ga0209565_1001379 3300025263 Bacteria 10899
147 Ga0209565_1001575 3300025263 Bacteria 9738
148 Ga0209565_1025666 3300025263 Bacteria 1189
149 Ga0209455_1000026 3300025272 Bacteria 653778
150 Ga0209673_1000003 3300025273 Bacteria 980859
151 Ga0209673_1011104 3300025273 Bacteria 3739
152 Ga0209130_1000046 3300025284 Bacteria 236658
153 Ga0209130_1000352 3300025284 Bacteria 52650
154 Ga0209130_1003061 3300025284 Bacteria 7514
155 Ga0209675_1000003 3300025291 Bacteria 1003982
156 Ga0209675_1001239 3300025291 Bacteria 15353
157 Ga0209675_1002418 3300025291 Bacteria 9622
158 Ga0209675_1005155 3300025291 Bacteria 5557
159 Ga0209564_1000002 3300025295 Bacteria 1636803
160 Ga0209564_1000007 3300025295 Bacteria 1028582
161 Ga0209564_1000012 3300025295 Bacteria 792078
162 Ga0209564_1000199 3300025295 Bacteria 138027
163 Ga0209564_1001406 3300025295 Bacteria 24898
164 Ga0209758_1000041 3300025297 Bacteria 410328
165 Ga0209758_1000470 3300025297 Bacteria 66488
166 Ga0209050_1000011 3300025298 Bacteria 914037
167 Ga0209050_1000089 3300025298 Bacteria 256212
168 Ga0209050_1001152 3300025298 Bacteria 31668
169 Ga0209050_1001629 3300025298 Bacteria 23020
170 Ga0209256_1000007 3300025299 Bacteria 1136599
171 Ga0209256_1000112 3300025299 Bacteria 178432
172 Ga0209256_1000163 3300025299 Bacteria 136008
173 Ga0209256_1000329 3300025299 Bacteria 80077
174 Ga0209256_1000363 3300025299 Bacteria 73406
175 Ga0209256_1004265 3300025299 Bacteria 9136
176 Ga0207426_1019108 3300025302 Bacteria 2401
177 Ga0209257_1000003 3300025304 Bacteria 1702593
178 Ga0209257_1004697 3300025304 Bacteria 10258
179 Ga0207655_1019615 3300025728 Bacteria 3522
180 Ga0207705_10039429 3300025909 Unclassified 3385
181 Ga0207695_10000035 3300025913 Bacteria 486590
182 Ga0207695_10046181 3300025913 Unclassified 4617
183 Ga0207695_10550461 3300025913 Bacteria 1035
184 Ga0207671_10000975 3300025914 Bacteria 35477
185 Ga0207671_10097026 3300025914 Bacteria 2228
186 Ga0207671_10124828 3300025914 Unclassified 1970
187 Ga0207657_10015080 3300025919 Bacteria 7505
188 Ga0207649_10007552 3300025920 Bacteria 5911
189 Ga0207649_10025906 3300025920 Bacteria 3425
190 Ga0207649_10025962 3300025920 Unclassified 3422
191 Ga0207694_10001160 3300025924 Bacteria 22863
192 Ga0207694_10031662 3300025924 Unclassified 4043
193 Ga0207694_10162239 3300025924 Unclassified 1806
194 Ga0207690_10001409 3300025932 Bacteria 15131
195 Ga0207661_10057177 3300025944 Bacteria 3135
196 Ga0207661_10131759 3300025944 Unclassified 2142
197 Ga0207679_10032279 3300025945 Bacteria 3674
198 Ga0207667_10000034 3300025949 Bacteria 304569
199 Ga0207667_10011234 3300025949 Bacteria 10419
200 Ga0207667_10035026 3300025949 Bacteria 5387
201 Ga0207667_10186653 3300025949 Bacteria 2128
202 Ga0207667_10330877 3300025949 Bacteria 1555
203 Ga0207640_10004292 3300025981 Bacteria 7715
204 Ga0207640_10165740 3300025981 Bacteria 1640
205 Ga0207639_10000059 3300026041 Bacteria 108373
206 Ga0207639_10213218 3300026041 Unclassified 1663
207 Ga0207702_10013852 3300026078 Bacteria 6699
208 Ga0207702_10070788 3300026078 Unclassified 3001
209 Ga0207674_10175775 3300026116 Bacteria 2093
210 Ga0207698_10000032 3300026142 Bacteria 112742
211 Ga0207698_10000334 3300026142 Bacteria 27952
212 Ga0207698_10043637 3300026142 Bacteria 3361
213 Ga0207698_10179039 3300026142 Unclassified 1876
214 Ga0207698_10252233 3300026142 Bacteria 1615
215 Ga0209281_1008419 3300027111 Bacteria 2507
216 Ga0209282_1000001 3300027666 Bacteria 2450367
217 Ga0265326_10052639 3300028558 Unclassified 1152
218 Ga0265318_10064236 3300028577 Bacteria 1366
219 Ga0265336_10000609 3300028666 Bacteria 19903
220 Ga0265320_10226052 3300031240 Unclassified 833
221 Ga0265329_10000502 3300031242 Bacteria 20314
222 Ga0307408_100000688 3300031548 Bacteria 27783
223 Ga0307408_100001045 3300031548 Bacteria 21257
224 Ga0307408_100001403 3300031548 Bacteria 17944
225 Ga0307408_100005812 3300031548 Bacteria 8209
226 Ga0307408_100153513 3300031548 Bacteria 1820
227 Ga0265314_10001371 3300031711 Bacteria 27333
228 Ga0265314_10056504 3300031711 Bacteria 2701
229 Ga0307416_100010055 3300032002 Bacteria 6230
230 Ga0316583_10009621 3300032133 Bacteria 3483
231 Ga0373933_0392509 3300035724 Bacteria 905
232 Ga0395899_0005108 3300037312 Bacteria 10211
233 Ga0395900_0014999 3300037418 Bacteria 7898
234 Ga0395905_0001736 3300037471 Bacteria 25480
235 Ga0395905_0018887 3300037471 Bacteria 6538
236 Ga0395905_0216074 3300037471 Bacteria 1795
237 Ga0395905_0379034 3300037471 Bacteria 1308
238 Ga0395901_0052452 3300038443 Bacteria 4239
239 Ga0436361_0099651 3300039447 Bacteria 6639
240 Ga0436361_0173386 3300039447 Bacteria 6681
241 Ga0436361_0512515 3300039447 Bacteria 2673
242 Ga0436361_0552734 3300039447 Bacteria 6588
243 Ga0436361_0964441 3300039447 Bacteria 26261
244 Ga0436361_1133021 3300039447 Bacteria 2973
245 Ga0439435_0096264 3300042436 Bacteria 905
246 Ga0466972_0000070 3300044658 Bacteria 100242
247 Ga0466972_0007711 3300044658 Bacteria 5405
248 Ga0466965_0004382 3300044683 Bacteria 6277
249 Ga0466966_0051708 3300044684 Bacteria 2611
250 Ga0466961_0056560 3300044693 Bacteria 2500
251 Ga0466964_0003338 3300044706 Bacteria 5851
252 Ga0466964_0016805 3300044706 Bacteria 2796
253 Ga0466971_0035944 3300044719 Bacteria 2222
254 Ga0466968_0002805 3300044735 Bacteria 6437
255 Ga0466968_0003180 3300044735 Bacteria 6057
256 Ga0466970_0009569 3300044765 Bacteria 4903
257 Ga0466960_0071573 3300044901 Bacteria 1727
258 Ga0466960_0149468 3300044901 Bacteria 1247
259 Ga0466959_0158986 3300045049 Bacteria 1589
260 Ga0451576_0958827 3300045051 Bacteria 897
261 Ga0466967_0001419 3300045976 Bacteria 13868
262 Ga0495617_000033 3300046452 Bacteria 147979
263 Ga0495617_000938 3300046452 Bacteria 13544
264 Ga0495617_006140 3300046452 Bacteria 4230
265 Ga0495627_000001 3300046453 Bacteria 1104709
266 Ga0495627_012878 3300046453 Bacteria 2954
267 Ga0495590_0000005 3300046457 Bacteria 384276
268 Ga0495590_0014880 3300046457 Bacteria 2835
269 Ga0495590_0021774 3300046457 Bacteria 2270
270 Ga0495638_0000436 3300046460 Bacteria 50390
271 Ga0495638_0004729 3300046460 Bacteria 10286
272 Ga0495638_0222389 3300046460 Bacteria 1054
273 Ga0495653_0000040 3300046463 Bacteria 119794
274 Ga0495653_0442198 3300046463 Bacteria 819
275 Ga0495650_0000648 3300046471 Bacteria 45807
276 Ga0495650_0000671 3300046471 Bacteria 44516
277 Ga0495650_0000909 3300046471 Bacteria 34900
278 Ga0495650_0001166 3300046471 Bacteria 28063
279 Ga0495650_0001520 3300046471 Bacteria 22029
280 Ga0495650_0001915 3300046471 Bacteria 18439
281 Ga0495605_0000038 3300046474 Bacteria 197063
282 Ga0495605_0001338 3300046474 Bacteria 16309
283 Ga0495639_0079489 3300046475 Bacteria 1525
284 Ga0495584_0000001 3300046491 Bacteria 649329
285 Ga0495584_0000153 3300046491 Bacteria 47948
286 Ga0495584_0018466 3300046491 Bacteria 3544
287 Ga0495584_0026562 3300046491 Bacteria 2933
288 Ga0495585_0000126 3300046492 Bacteria 82816
289 Ga0495585_0000161 3300046492 Bacteria 71753
290 Ga0495585_0001373 3300046492 Bacteria 19276
291 Ga0495585_0020013 3300046492 Bacteria 3850
292 Ga0495607_0004488 3300046501 Bacteria 10241
293 Ga0495607_0016028 3300046501 Bacteria 4843
294 Ga0495607_0024238 3300046501 Bacteria 3786
295 Ga0495607_0041047 3300046501 Bacteria 2750
296 Ga0495607_0070821 3300046501 Bacteria 1947
297 Ga0495607_0097342 3300046501 Bacteria 1582
298 Ga0495583_0000396 3300046506 Bacteria 66329
299 Ga0495583_0000709 3300046506 Bacteria 42771
300 Ga0495583_0075876 3300046506 Bacteria 1469
301 Ga0495606_0000053 3300046507 Bacteria 200818
302 Ga0495606_0000087 3300046507 Bacteria 156407
303 Ga0495606_0000239 3300046507 Bacteria 96850
304 Ga0495606_0001006 3300046507 Bacteria 41025
305 Ga0495606_0001197 3300046507 Bacteria 36483
306 Ga0495606_0002091 3300046507 Bacteria 24348
307 Ga0495606_0002153 3300046507 Bacteria 23733
308 Ga0495606_0005743 3300046507 Bacteria 11731
309 Ga0495606_0028914 3300046507 Bacteria 3902
310 Ga0495606_0038588 3300046507 Bacteria 3229
311 Ga0495606_0047939 3300046507 Bacteria 2814
312 Ga0495606_0162404 3300046507 Bacteria 1302
313 Ga0495610_0000008 3300046512 Bacteria 622732
314 Ga0495610_0000181 3300046512 Bacteria 70215
315 Ga0495610_0002193 3300046512 Bacteria 16550
316 Ga0495610_0007214 3300046512 Bacteria 7458
317 Ga0495610_0007266 3300046512 Bacteria 7422
318 Ga0495610_0021235 3300046512 Bacteria 3576
319 Ga0495610_0055307 3300046512 Bacteria 1913
320 Ga0495616_0001925 3300046513 Bacteria 13966
321 Ga0495616_0005793 3300046513 Bacteria 7552
322 Ga0495616_0016633 3300046513 Bacteria 4067
323 Ga0495616_0065421 3300046513 Bacteria 1771
324 Ga0495620_0063748 3300046515 Bacteria 1526
325 Ga0495637_0000207 3300046520 Bacteria 46156
326 Ga0495643_0000195 3300046522 Bacteria 96110
327 Ga0495643_0000516 3300046522 Bacteria 48137
328 Ga0495643_0131038 3300046522 Bacteria 1259
329 Ga0495644_0001337 3300046523 Bacteria 10083
330 Ga0495644_0011198 3300046523 Bacteria 3456
331 Ga0495648_0000002 3300046524 Bacteria 593972
332 Ga0495648_0000202 3300046524 Bacteria 69075
333 Ga0495648_0001252 3300046524 Bacteria 25382
334 Ga0495648_0004914 3300046524 Bacteria 11243
335 Ga0495648_0005930 3300046524 Bacteria 10053
336 Ga0495642_0011501 3300046528 Bacteria 3401
337 Ga0495642_0017332 3300046528 Bacteria 2814
338 Ga0495642_0049387 3300046528 Bacteria 1728
339 Ga0495654_0000002 3300046530 Bacteria 1021205
340 Ga0495654_0006038 3300046530 Bacteria 6950
341 Ga0495654_0017629 3300046530 Bacteria 3749
342 Ga0495609_0000921 3300046538 Bacteria 21323
343 Ga0495609_0002005 3300046538 Bacteria 12869
344 Ga0495609_0038883 3300046538 Bacteria 2143
345 Ga0495597_0000322 3300046542 Bacteria 43315
346 Ga0495597_0000936 3300046542 Bacteria 22526
347 Ga0495597_0006967 3300046542 Bacteria 5793
348 Ga0495622_0000041 3300046557 Bacteria 118419
349 Ga0495622_0019057 3300046557 Bacteria 3196
350 Ga0495633_0000348 3300046558 Bacteria 51243
351 Ga0495633_0000382 3300046558 Bacteria 46834
352 Ga0495633_0000567 3300046558 Bacteria 36076
353 Ga0495633_0010401 3300046558 Bacteria 5077
354 Ga0495633_0010459 3300046558 Bacteria 5060
355 Ga0495633_0014109 3300046558 Bacteria 4188
356 Ga0495633_0103827 3300046558 Bacteria 1318
357 Ga0495633_0135223 3300046558 Bacteria 1140
358 Ga0495656_0166053 3300046615 Bacteria 1076
359 Ga0495668_0000006 3300046616 Bacteria 553404
360 Ga0495668_0000931 3300046616 Bacteria 32633
361 Ga0495668_0001037 3300046616 Bacteria 29441
362 Ga0495668_0002867 3300046616 Bacteria 13670
363 Ga0495668_0007419 3300046616 Bacteria 7008
364 Ga0495668_0353582 3300046616 Bacteria 806
365 Ga0495611_0002916 3300046648 Bacteria 7633
366 Ga0495611_0028657 3300046648 Bacteria 2439
367 Ga0495625_0000124 3300046660 Bacteria 120849
368 Ga0495625_0000468 3300046660 Bacteria 60719
369 Ga0495625_0006500 3300046660 Bacteria 10386
370 Ga0495625_0011094 3300046660 Bacteria 7380
371 Ga0495625_0012382 3300046660 Bacteria 6913
372 Ga0495625_0021041 3300046660 Bacteria 5028
373 Ga0495625_0078723 3300046660 Bacteria 2301
374 Ga0495659_0000244 3300046664 Bacteria 22578
375 Ga0495659_0000262 3300046664 Bacteria 21388
376 Ga0495661_0009588 3300046665 Bacteria 6635
377 Ga0495661_0033649 3300046665 Bacteria 3231
378 Ga0495661_0160454 3300046665 Bacteria 1207
379 Ga0495669_0024047 3300046684 Bacteria 2654
380 Ga0495670_0005867 3300046691 Bacteria 6020
381 Ga0495671_0000002 3300046692 Bacteria 1136189
382 Ga0495671_0000379 3300046692 Bacteria 36536
383 Ga0495671_0003948 3300046692 Bacteria 8994
384 Ga0495671_0010942 3300046692 Bacteria 5010
385 Ga0495671_0057401 3300046692 Bacteria 1926
386 Ga0495649_0071406 3300046694 Bacteria 1861
387 Ga0495649_0098484 3300046694 Bacteria 1555
388 Ga0495660_0000364 3300046810 Bacteria 39845
389 Ga0495660_0000790 3300046810 Bacteria 23704
390 Ga0495660_0000883 3300046810 Bacteria 22180
391 Ga0495660_0063143 3300046810 Bacteria 1984
392 Ga0495660_0117912 3300046810 Bacteria 1346
393 Ga0495660_0195168 3300046810 Bacteria 970
394 Ga0495636_0000382 3300047318 Bacteria 16673
395 Ga0495636_0087075 3300047318 Bacteria 1351
396 Ga0495672_0000022 3300047320 Bacteria 420632
397 Ga0495672_0000368 3300047320 Bacteria 57095
398 Ga0495672_0000398 3300047320 Bacteria 52924
399 Ga0495672_0004744 3300047320 Bacteria 10974
400 Ga0495672_0009362 3300047320 Bacteria 7106
401 Ga0495683_0005191 3300047323 Bacteria 7254
402 Ga0495683_0013073 3300047323 Bacteria 4347
403 Ga0495683_0036173 3300047323 Bacteria 2507
404 Ga0495687_000768 3300047443 Bacteria 34771
405 Ga0495687_004259 3300047443 Bacteria 9797
406 Ga0495687_006536 3300047443 Bacteria 7120
407 Ga0495687_014815 3300047443 Bacteria 3990
408 Ga0495677_0013933 3300047445 Bacteria 2926
409 Ga0495677_0039708 3300047445 Bacteria 1720
410 Ga0495679_038842 3300047446 Bacteria 1488
411 Ga0495679_046268 3300047446 Bacteria 1325
412 Ga0495685_000636 3300047447 Bacteria 10727
413 Ga0495685_024685 3300047447 Bacteria 2068
414 Ga0495673_0000005 3300047469 Bacteria 943364
415 Ga0495673_0000067 3300047469 Bacteria 219908
416 Ga0495673_0000199 3300047469 Bacteria 93637
417 Ga0495673_0013652 3300047469 Bacteria 4254
418 Ga0495681_0010110 3300047470 Bacteria 5739
419 Ga0495681_0011342 3300047470 Bacteria 5314
420 Ga0495686_0001694 3300047472 Bacteria 22811
421 Ga0495686_0004510 3300047472 Bacteria 11416
422 Ga0495686_0050407 3300047472 Bacteria 2615
423 Ga0495686_0134042 3300047472 Bacteria 1466
424 Ga0496101_0228534 3300048904 Bacteria 1446
425 Ga0496101_0547347 3300048904 Bacteria 915
426 Ga0496103_0002526 3300048906 Bacteria 11465
427 Ga0496108_0048499 3300048911 Bacteria 3551
428 Ga0496111_0051061 3300048914 Bacteria 2985
429 Ga0496111_0401533 3300048914 Bacteria 1013
430 Ga0496114_0481276 3300048917 Bacteria 1098
431 Ga0496115_0065486 3300048918 Bacteria 2935
432 Ga0496116_0016994 3300048919 Bacteria 5668
433 Ga0496117_0000001 3300048920 Bacteria 2526244
434 Ga0496118_0000002 3300048921 Bacteria 1690764
435 Ga0496121_0004709 3300048924 Bacteria 18050
436 Ga0496121_0037150 3300048924 Bacteria 4329
437 Ga0496121_0139433 3300048924 Bacteria 1801
438 Ga0496121_0140697 3300048924 Bacteria 1791
439 Ga0496122_0002892 3300048925 Bacteria 23489
440 Ga0496122_0089752 3300048925 Bacteria 2100
441 Ga0496122_0153599 3300048925 Bacteria 1416
442 Ga0496123_0001347 3300048926 Bacteria 34616
443 Ga0496123_0008053 3300048926 Bacteria 9754
444 Ga0496124_0005245 3300048927 Bacteria 14683
445 Ga0496124_0104298 3300048927 Bacteria 2293
446 Ga0496125_0004450 3300048928 Bacteria 16173
447 Ga0496125_0144721 3300048928 Bacteria 1645
448 Ga0496126_0006570 3300048929 Bacteria 12954
449 Ga0496126_0205869 3300048929 Bacteria 1659
450 Ga0495678_000002 3300049459 Bacteria 999613
451 Ga0495678_000291 3300049459 Bacteria 55271
452 Ga0495678_020340 3300049459 Bacteria 2942
453 Ga0495678_021434 3300049459 Bacteria 2845
454 Ga0495678_033443 3300049459 Bacteria 2122
455 Ga0495678_106477 3300049459 Bacteria 963
456 Ga0495682_0000649 3300049460 Bacteria 23246
457 Ga0495682_0001105 3300049460 Bacteria 15707
458 Ga0495682_0013087 3300049460 Bacteria 3163
459 Ga0495682_0023577 3300049460 Bacteria 2296
460 Ga0501037_0013172 3300049573 Bacteria 6097
461 Ga0501043_0020163 3300049579 Bacteria 5234
462 Ga0501070_0624947 3300049586 Bacteria 857
463 Ga0501222_021508 3300049662 Bacteria 865
464 Ga0501238_002866 3300049671 Bacteria 2094
465 Ga0501249_003800 3300049679 Bacteria 3049
466 Ga0501080_0523491 3300049742 Bacteria 1058
467 Ga0501269_000121 3300049766 Bacteria 24650
468 Ga0501035_0037109 3300049822 Bacteria 4414
469 Ga0500618_000332 3300053125 Bacteria 34213
470 Ga0500618_004336 3300053125 Bacteria 4580
471 Ga0500586_000195 3300053145 Bacteria 11689
472 Ga0500586_045700 3300053145 Bacteria 1499
473 Ga0500622_0014356 3300053156 Bacteria 4255
474 Ga0466962_0123099 3300061719 Bacteria 1252
475 2511385135 2511231026 Bacteria 5225445
476 2601668102 2600255292 Bacteria 6300551
477 2643792313 2643221554 Bacteria 6603920
478 2644212195 2643221638 Bacteria 6579467
479 2644253443 2643221645 Bacteria 7207331
480 2644355509 2643221664 Bacteria 7272945
481 2738737369 2738541280 Bacteria 6630198
482 2738828088 2738541297 Bacteria 6549566
483 2738841598 2738541300 Bacteria 6675882
484 2739151884 2738541357 Bacteria 6549408
485 2739194095 2738543003 Bacteria 6549560
486 2739272469 2738543018 Bacteria 6718814
487 2739320280 2738543026 Bacteria 6549408
488 2739338812 2738543029 Bacteria 6549249
489 2739341513 2738543030 Bacteria 6719714
490 2765569885 2765235838 Bacteria 5445269
491 2808981805 2808606386 Bacteria 4471946
492 2809131433 2808606415 Bacteria 4576710
493 2809151055 2808606419 Bacteria 4576925
494 2819614038 2818991449 Bacteria 5518009
495 2821132640 2821131069 Bacteria 6108407
496 2839097171 2839094727 Bacteria 5534556
497 2842716503 2842711865 Bacteria 7155354
498 2852622665 2852618963 Bacteria 4577824
499 2857549854 2857547612 Bacteria 6179999
500 2857557327 2857553236 Bacteria 6166726
501 2857560110 2857558681 Bacteria 6617694
502 2857566709 2857564685 Bacteria 6290584
503 2885081487 2885080285 Bacteria 6355622
504 2904424360 2904424332 Bacteria 7633521
505 2904443970 2904439833 Bacteria 5931679
506 2904534481 2904530477 Bacteria 5876334
507 2904584372 2904584206 Bacteria 6028872
508 2904590840 2904589729 Bacteria 6113573
509 2904603319 2904601388 Bacteria 5884906
510 2919080676 2919079590 Bacteria 5946433
511 2919477969 2919476304 Bacteria 5888696
512 2928132013 2928130867 Bacteria 5467269
513 2932411807 2932410948 Bacteria 6312192
514 2932418626 2932416698 Bacteria 6315112
515 Ga0373937_0372584
516 JGI25154J39366_1000833
517 JGI25158J39367_1012445
518 JGI25152J39213_1000065
519 JGI25150J39212_1000457
520 JGI25150J39212_1002265
521 JGI25150J39212_1008471
522 JGI25159J45721_1001693
523 JGI25159J45721_1004374
524 JGI25153J46596_10004646
525 JGI25153J46596_10028743
526 rootH2_10034108
527 rootH2_10110891
528 JGI25160J50197_1049536
529 JGI25161J50226_1002449
530 JGI25161J50226_1002599
531 Ga0055538_1000020
532 Ga0055539_1000025
533 Ga0055533_1000034
534 Ga0055525_1000044
535 Ga0055529_1000128
536 Ga0055526_1000019
537 Ga0055526_1000148
538 Ga0055526_1000283
539 Ga0055526_1006734
540 Ga0055537_1000063
541 Ga0055537_1004609
542 Ga0055524_1000151
543 Ga0055524_1000883
544 Ga0055524_1001152
545 Ga0055524_1010256
546 Ga0055524_1013090
547 Ga0055534_1000045
548 Ga0055534_1004411
549 Ga0055528_1000013
550 Ga0055530_10001631
551 Ga0055530_10006471
552 Ga0055530_10010544
553 Ga0055531_10002342
554 Ga0055541_1000019
555 Ga0055543_1004171
556 Ga0065165_1000005
557 Ga0065165_1002696
558 Ga0065165_1047368
559 Ga0070658_10350550
560 Ga0070683_100022995
561 Ga0070683_100036607
562 Ga0070683_100240385
563 Ga0070683_100415005
564 Ga0070682_100019759
565 Ga0070660_100003069
566 Ga0070661_100101723
567 Ga0070661_100107004
568 Ga0070659_100002858
569 Ga0070684_100015897
570 Ga0070684_100143178
571 Ga0070684_100232809
572 Ga0068853_100000261
573 Ga0068853_100028747
574 Ga0068853_100354972
575 Ga0068855_100018987
576 Ga0068855_100023211
577 Ga0068855_100027693
578 Ga0068855_100302535
579 Ga0068855_100511126
580 Ga0070664_100047761
581 Ga0068857_100115673
582 Ga0068854_100003668
583 Ga0068854_100012386
584 Ga0068854_100035394
585 Ga0068856_100028302
586 Ga0068852_100000038
587 Ga0068852_100018200
588 Ga0068852_100108008
589 Ga0068852_100222573
590 Ga0068852_100383919
591 Ga0068852_100781173
592 Ga0068851_10055653
593 Ga0070717_10272807
594 Ga0075432_10055213
595 Ga0079104_1011067
596 Ga0099826_10000001
597 Ga0105244_10002584
598 Ga0105244_10009833
599 Ga0105240_10000965
600 Ga0105240_10014003
601 Ga0105240_10098133
602 Ga0105240_10201792
603 Ga0105240_10289822
604 Ga0105241_10036311
605 Ga0105241_10041045
606 Ga0105237_10022163
607 Ga0105237_10123374
608 Ga0105237_10128507
609 Ga0105237_10202028
610 Ga0105237_10202029
611 Ga0105238_10000399
612 Ga0105238_10024111
613 Ga0105238_10089774
614 Ga0105238_10248336
615 Ga0105239_10022162
616 Ga0105239_10147927
617 Ga0105239_10290387
618 Ga0157373_10160603
619 Ga0157370_10000102
620 Ga0157369_10000154
621 Ga0157369_10081061
622 Ga0157369_10170980
623 Ga0157369_10172596
624 Ga0157369_10503926
625 Ga0157374_10002372
626 Ga0163162_11495332
627 Ga0157372_10000082
628 Ga0157372_10027929
629 Ga0157372_10163624
630 Ga0157372_10441988
631 Ga0182008_10000355
632 Ga0157376_10815524
633 Ga0182006_1000067
634 Ga0182006_1000192
635 Ga0182007_10000123
636 Ga0182005_1000002
637 Ga0182005_1000008
638 Ga0163161_10171724
639 Ga0213872_10000019
640 Ga0213872_10000444
641 Ga0213872_10011739
642 Ga0213872_10040275
643 Ga0213872_10068029
644 Ga0209436_100250
645 Ga0209436_100756
646 Ga0209436_108653
647 Ga0209784_100002
648 Ga0209566_100003
649 Ga0209674_100004
650 Ga0209563_100006
651 Ga0207425_1000001
652 Ga0207425_1000048
653 Ga0207425_1000348
654 Ga0209646_1000007
655 Ga0209677_100003
656 Ga0209129_1000003
657 Ga0209129_1004586
658 Ga0209565_1000003
659 Ga0209565_1000805
660 Ga0209565_1001379
661 Ga0209565_1001575
662 Ga0209565_1025666
663 Ga0209455_1000026
664 Ga0209673_1000003
665 Ga0209673_1011104
666 Ga0209130_1000046
667 Ga0209130_1000352
668 Ga0209130_1003061
669 Ga0209675_1000003
670 Ga0209675_1001239
671 Ga0209675_1002418
672 Ga0209675_1005155
673 Ga0209564_1000002
674 Ga0209564_1000007
675 Ga0209564_1000012
676 Ga0209564_1000199
677 Ga0209564_1001406
678 Ga0209758_1000041
679 Ga0209758_1000470
680 Ga0209050_1000011
681 Ga0209050_1000089
682 Ga0209050_1001152
683 Ga0209050_1001629
684 Ga0209256_1000007
685 Ga0209256_1000112
686 Ga0209256_1000163
687 Ga0209256_1000329
688 Ga0209256_1000363
689 Ga0209256_1004265
690 Ga0207426_1019108
691 Ga0209257_1000003
692 Ga0209257_1004697
693 Ga0207655_1019615
694 Ga0207705_10039429
695 Ga0207695_10000035
696 Ga0207695_10046181
697 Ga0207695_10550461
698 Ga0207671_10000975
699 Ga0207671_10097026
700 Ga0207671_10124828
701 Ga0207657_10015080
702 Ga0207649_10007552
703 Ga0207649_10025906
704 Ga0207649_10025962
705 Ga0207694_10001160
706 Ga0207694_10031662
707 Ga0207694_10162239
708 Ga0207690_10001409
709 Ga0207661_10057177
710 Ga0207661_10131759
711 Ga0207679_10032279
712 Ga0207667_10000034
713 Ga0207667_10011234
714 Ga0207667_10035026
715 Ga0207667_10186653
716 Ga0207667_10330877
717 Ga0207640_10004292
718 Ga0207640_10165740
719 Ga0207639_10000059
720 Ga0207639_10213218
721 Ga0207702_10013852
722 Ga0207702_10070788
723 Ga0207674_10175775
724 Ga0207698_10000032
725 Ga0207698_10000334
726 Ga0207698_10043637
727 Ga0207698_10179039
728 Ga0207698_10252233
729 Ga0209281_1008419
730 Ga0209282_1000001
731 Ga0265326_10052639
732 Ga0265318_10064236
733 Ga0265336_10000609
734 Ga0265320_10226052
735 Ga0265329_10000502
736 Ga0307408_100000688
737 Ga0307408_100001045
738 Ga0307408_100001403
739 Ga0307408_100005812
740 Ga0307408_100153513
741 Ga0265314_10001371
742 Ga0265314_10056504
743 Ga0307416_100010055
744 Ga0316583_10009621
745 Ga0373933_0392509
746 Ga0395899_0005108
747 Ga0395900_0014999
748 Ga0395905_0001736
749 Ga0395905_0018887
750 Ga0395905_0216074
751 Ga0395905_0379034
752 Ga0395901_0052452
753 Ga0436361_0099651
754 Ga0436361_0173386
755 Ga0436361_0512515
756 Ga0436361_0552734
757 Ga0436361_0964441
758 Ga0436361_1133021
759 Ga0439435_0096264
760 Ga0466972_0000070
761 Ga0466972_0007711
762 Ga0466965_0004382
763 Ga0466966_0051708
764 Ga0466961_0056560
765 Ga0466964_0003338
766 Ga0466964_0016805
767 Ga0466971_0035944
768 Ga0466968_0002805
769 Ga0466968_0003180
770 Ga0466970_0009569
771 Ga0466960_0071573
772 Ga0466960_0149468
773 Ga0466959_0158986
774 Ga0451576_0958827
775 Ga0466967_0001419
776 Ga0495617_000033
777 Ga0495617_000938
778 Ga0495617_006140
779 Ga0495627_000001
780 Ga0495627_012878
781 Ga0495590_0000005
782 Ga0495590_0014880
783 Ga0495590_0021774
784 Ga0495638_0000436
785 Ga0495638_0004729
786 Ga0495638_0222389
787 Ga0495653_0000040
788 Ga0495653_0442198
789 Ga0495650_0000648
790 Ga0495650_0000671
791 Ga0495650_0000909
792 Ga0495650_0001166
793 Ga0495650_0001520
794 Ga0495650_0001915
795 Ga0495605_0000038
796 Ga0495605_0001338
797 Ga0495639_0079489
798 Ga0495584_0000001
799 Ga0495584_0000153
800 Ga0495584_0018466
801 Ga0495584_0026562
802 Ga0495585_0000126
803 Ga0495585_0000161
804 Ga0495585_0001373
805 Ga0495585_0020013
806 Ga0495607_0004488
807 Ga0495607_0016028
808 Ga0495607_0024238
809 Ga0495607_0041047
810 Ga0495607_0070821
811 Ga0495607_0097342
812 Ga0495583_0000396
813 Ga0495583_0000709
814 Ga0495583_0075876
815 Ga0495606_0000053
816 Ga0495606_0000087
817 Ga0495606_0000239
818 Ga0495606_0001006
819 Ga0495606_0001197
820 Ga0495606_0002091
821 Ga0495606_0002153
822 Ga0495606_0005743
823 Ga0495606_0028914
824 Ga0495606_0038588
825 Ga0495606_0047939
826 Ga0495606_0162404
827 Ga0495610_0000008
828 Ga0495610_0000181
829 Ga0495610_0002193
830 Ga0495610_0007214
831 Ga0495610_0007266
832 Ga0495610_0021235
833 Ga0495610_0055307
834 Ga0495616_0001925
835 Ga0495616_0005793
836 Ga0495616_0016633
837 Ga0495616_0065421
838 Ga0495620_0063748
839 Ga0495637_0000207
840 Ga0495643_0000195
841 Ga0495643_0000516
842 Ga0495643_0131038
843 Ga0495644_0001337
844 Ga0495644_0011198
845 Ga0495648_0000002
846 Ga0495648_0000202
847 Ga0495648_0001252
848 Ga0495648_0004914
849 Ga0495648_0005930
850 Ga0495642_0011501
851 Ga0495642_0017332
852 Ga0495642_0049387
853 Ga0495654_0000002
854 Ga0495654_0006038
855 Ga0495654_0017629
856 Ga0495609_0000921
857 Ga0495609_0002005
858 Ga0495609_0038883
859 Ga0495597_0000322
860 Ga0495597_0000936
861 Ga0495597_0006967
862 Ga0495622_0000041
863 Ga0495622_0019057
864 Ga0495633_0000348
865 Ga0495633_0000382
866 Ga0495633_0000567
867 Ga0495633_0010401
868 Ga0495633_0010459
869 Ga0495633_0014109
870 Ga0495633_0103827
871 Ga0495633_0135223
872 Ga0495656_0166053
873 Ga0495668_0000006
874 Ga0495668_0000931
875 Ga0495668_0001037
876 Ga0495668_0002867
877 Ga0495668_0007419
878 Ga0495668_0353582
879 Ga0495611_0002916
880 Ga0495611_0028657
881 Ga0495625_0000124
882 Ga0495625_0000468
883 Ga0495625_0006500
884 Ga0495625_0011094
885 Ga0495625_0012382
886 Ga0495625_0021041
887 Ga0495625_0078723
888 Ga0495659_0000244
889 Ga0495659_0000262
890 Ga0495661_0009588
891 Ga0495661_0033649
892 Ga0495661_0160454
893 Ga0495669_0024047
894 Ga0495670_0005867
895 Ga0495671_0000002
896 Ga0495671_0000379
897 Ga0495671_0003948
898 Ga0495671_0010942
899 Ga0495671_0057401
900 Ga0495649_0071406
901 Ga0495649_0098484
902 Ga0495660_0000364
903 Ga0495660_0000790
904 Ga0495660_0000883
905 Ga0495660_0063143
906 Ga0495660_0117912
907 Ga0495660_0195168
908 Ga0495636_0000382
909 Ga0495636_0087075
910 Ga0495672_0000022
911 Ga0495672_0000368
912 Ga0495672_0000398
913 Ga0495672_0004744
914 Ga0495672_0009362
915 Ga0495683_0005191
916 Ga0495683_0013073
917 Ga0495683_0036173
918 Ga0495687_000768
919 Ga0495687_004259
920 Ga0495687_006536
921 Ga0495687_014815
922 Ga0495677_0013933
923 Ga0495677_0039708
924 Ga0495679_038842
925 Ga0495679_046268
926 Ga0495685_000636
927 Ga0495685_024685
928 Ga0495673_0000005
929 Ga0495673_0000067
930 Ga0495673_0000199
931 Ga0495673_0013652
932 Ga0495681_0010110
933 Ga0495681_0011342
934 Ga0495686_0001694
935 Ga0495686_0004510
936 Ga0495686_0050407
937 Ga0495686_0134042
938 Ga0496101_0228534
939 Ga0496101_0547347
940 Ga0496103_0002526
941 Ga0496108_0048499
942 Ga0496111_0051061
943 Ga0496111_0401533
944 Ga0496114_0481276
945 Ga0496115_0065486
946 Ga0496116_0016994
947 Ga0496117_0000001
948 Ga0496118_0000002
949 Ga0496121_0004709
950 Ga0496121_0037150
951 Ga0496121_0139433
952 Ga0496121_0140697
953 Ga0496122_0002892
954 Ga0496122_0089752
955 Ga0496122_0153599
956 Ga0496123_0001347
957 Ga0496123_0008053
958 Ga0496124_0005245
959 Ga0496124_0104298
960 Ga0496125_0004450
961 Ga0496125_0144721
962 Ga0496126_0006570
963 Ga0496126_0205869
964 Ga0495678_000002
965 Ga0495678_000291
966 Ga0495678_020340
967 Ga0495678_021434
968 Ga0495678_033443
969 Ga0495678_106477
970 Ga0495682_0000649
971 Ga0495682_0001105
972 Ga0495682_0013087
973 Ga0495682_0023577
974 Ga0501037_0013172
975 Ga0501043_0020163
976 Ga0501070_0624947
977 Ga0501222_021508
978 Ga0501238_002866
979 Ga0501249_003800
980 Ga0501080_0523491
981 Ga0501269_000121
982 Ga0501035_0037109
983 Ga0500618_000332
984 Ga0500618_004336
985 Ga0500586_000195
986 Ga0500586_045700
987 Ga0500622_0014356
988 Ga0466962_0123099
989 2511385135
990 2601668102
991 2643792313
992 2644212195
993 2644253443
994 2644355509
995 2738737369
996 2738828088
997 2738841598
998 2739151884
999 2739194095
1000 2739272469
1001 2739320280
1002 2739338812
1003 2739341513
1004 2765569885
1005 2808981805
1006 2809131433
1007 2809151055
1008 2819614038
1009 2821132640
1010 2839097171
1011 2842716503
1012 2852622665
1013 2857549854
1014 2857557327
1015 2857560110
1016 2857566709
1017 2885081487
1018 2904424360
1019 2904443970
1020 2904534481
1021 2904584372
1022 2904590840
1023 2904603319
1024 2919080676
1025 2919477969
1026 2928132013
1027 2932411807
1028 2932418626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

198

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9646 6 227
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9581 6 227
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9531 8 231
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.953 8 225
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9509 9 231
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9749 4 227 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9675 8 227 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 35 227 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9656 7 230 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9588 1 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D2CRM9-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9853 7 231 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A6L4YFH5-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9843 7 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A089I4Y8-F1-model_v4 ABC transporter ATP-binding protein 0.9841 9 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2D4VMT8-F1-model_v4 ABC transporter 0.9798 6 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A3M1CG20-F1-model_v4 ABC transporter ATP-binding protein 0.9777 9 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map