F457752

General Info

Members Datasets Scaffolds Average Seq Length
514 242 1028 435

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001910|Ga0451577_0001910_22247_23698
Length 483
Sequence LTSFLSAVAAGPALLAETFSLPPGATYVLSFLVALGILIFVHEFGHFWVARRLGIGVTKFSFGFGPKLFGFTRGETEYLVSAIPFGGYVKMVGEGDADEVSDADRARSFHHKPVWVRMAVVAAGPAGNLIFAVFAFWIFLMLGVPVLSSRISVEPGGPAEKAGLLSGDRIVAVDGVPVSDYDGFDAAIAKGGAGRAASITVERGGARSTFPVTPAVEEFRNVFGEKVRRPGVGTSPFAPPRIGEVGPGSPAGKAGLRRDDLVVSIDNEAVSDWDGVATRIKADREGRPLRFVVKRDGAELPLVIVPRMDEVDGPDGKPRKEPRIGIGASPDTVVRSSGPLAAIPLAFARVWEMIALTAVGIXKLLARTVSTKELGGPLLIAKMAGDQARLGLGQFVNFLGFLSVNLGVLNLLPVPVLDGGHLLFFSIEGVLRRPLSERTRVYAQQVGLFLLLMLMVTVIYNDLARFSVFDAIGKALVNTFHGK

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.14
Rhizosphere 97.47
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0001910 3300042876 Bacteria 26415
2 Ga0065714_10075733 3300005288 Bacteria 2872
3 Ga0065704_10141561 3300005289 Bacteria 1503
4 Ga0065712_10068440 3300005290 Bacteria 10629
5 Ga0065712_10082766 3300005290 Bacteria 2887
6 Ga0065715_10000407 3300005293 Bacteria 12430
7 Ga0065715_10001923 3300005293 Bacteria 12252
8 Ga0065715_10002254 3300005293 Bacteria 10415
9 Ga0065707_10002034 3300005295 Bacteria 13249
10 Ga0065707_10108468 3300005295 Bacteria 2509
11 Ga0070658_10037343 3300005327 Bacteria 3916
12 Ga0070676_10023624 3300005328 Bacteria 3456
13 Ga0070683_100057351 3300005329 Bacteria 3618
14 Ga0070690_100020696 3300005330 Bacteria 4010
15 Ga0070690_100137990 3300005330 Bacteria 1653
16 Ga0070670_100000819 3300005331 Bacteria 24249
17 Ga0070670_100003459 3300005331 Bacteria 13107
18 Ga0070670_100006579 3300005331 Bacteria 9847
19 Ga0070670_100006965 3300005331 Bacteria 9581
20 Ga0070670_100137979 3300005331 Bacteria 2108
21 Ga0068869_100001337 3300005334 Bacteria 14607
22 Ga0068868_100061338 3300005338 Bacteria 2979
23 Ga0070660_100016534 3300005339 Bacteria 5356
24 Ga0070689_100044435 3300005340 Bacteria 3418
25 Ga0070691_10001464 3300005341 Bacteria 10125
26 Ga0070661_100027305 3300005344 Bacteria 4109
27 Ga0070668_100006636 3300005347 Bacteria 8578
28 Ga0070668_100096562 3300005347 Bacteria 2336
29 Ga0070669_100019845 3300005353 Bacteria 4803
30 Ga0070669_100020374 3300005353 Bacteria 4736
31 Ga0070669_100036684 3300005353 Bacteria 3554
32 Ga0070669_100060715 3300005353 Bacteria 2777
33 Ga0070669_100065156 3300005353 Bacteria 2684
34 Ga0070675_100002874 3300005354 Bacteria 12984
35 Ga0070675_100005204 3300005354 Bacteria 9922
36 Ga0070675_100020294 3300005354 Bacteria 5303
37 Ga0070675_100026028 3300005354 Bacteria 4692
38 Ga0070671_100053453 3300005355 Bacteria 3358
39 Ga0070673_100134253 3300005364 Bacteria 2081
40 Ga0070688_100001419 3300005365 Bacteria 11925
41 Ga0070688_100018359 3300005365 Bacteria 4035
42 Ga0070667_100018630 3300005367 Bacteria 5758
43 Ga0070667_100169902 3300005367 Bacteria 1925
44 Ga0070703_10032417 3300005406 Bacteria 1587
45 Ga0070705_100014698 3300005440 Bacteria 4033
46 Ga0070700_100005804 3300005441 Bacteria 6553
47 Ga0070700_100026859 3300005441 Bacteria 3406
48 Ga0070700_100080724 3300005441 Bacteria 2099
49 Ga0070700_100121059 3300005441 Unclassified 1754
50 Ga0070694_100056802 3300005444 Bacteria 2659
51 Ga0070708_100042053 3300005445 Bacteria 4009
52 Ga0070708_100164193 3300005445 Bacteria 2071
53 Ga0070662_100045085 3300005457 Bacteria 3162
54 Ga0070662_100084767 3300005457 Bacteria 2367
55 Ga0068867_100003053 3300005459 Bacteria 11801
56 Ga0068867_100003095 3300005459 Bacteria 11724
57 Ga0068867_100031732 3300005459 Bacteria 3817
58 Ga0070685_10003450 3300005466 Bacteria 8040
59 Ga0070685_10069364 3300005466 Bacteria 2085
60 Ga0070707_100054472 3300005468 Bacteria 3835
61 Ga0070698_100002882 3300005471 Bacteria 18925
62 Ga0070698_100014668 3300005471 Bacteria 8279
63 Ga0070699_100041060 3300005518 Bacteria 4004
64 Ga0070699_100060877 3300005518 Bacteria 3272
65 Ga0070679_100002683 3300005530 Bacteria 16214
66 Ga0070679_100057854 3300005530 Bacteria 3864
67 Ga0068853_100094578 3300005539 Bacteria 2633
68 Ga0070672_100020024 3300005543 Bacteria 4873
69 Ga0070686_100001968 3300005544 Bacteria 11409
70 Ga0070695_100004711 3300005545 Bacteria 8023
71 Ga0070695_100009577 3300005545 Bacteria 5771
72 Ga0070695_100014698 3300005545 Bacteria 4720
73 Ga0070693_100074331 3300005547 Bacteria 2010
74 Ga0070665_100001492 3300005548 Bacteria 27240
75 Ga0070665_100005070 3300005548 Bacteria 13668
76 Ga0070665_100035934 3300005548 Bacteria 4985
77 Ga0070665_100188730 3300005548 Bacteria 2062
78 Ga0070704_100090378 3300005549 Bacteria 2280
79 Ga0068855_100053144 3300005563 Bacteria 4767
80 Ga0070664_100065530 3300005564 Bacteria 3100
81 Ga0068857_100018868 3300005577 Bacteria 6051
82 Ga0068854_100037425 3300005578 Bacteria 3406
83 Ga0068856_100105849 3300005614 Bacteria 2807
84 Ga0070702_100004668 3300005615 Bacteria 6285
85 Ga0070702_100024001 3300005615 Bacteria 3248
86 Ga0068852_100263547 3300005616 Bacteria 1656
87 Ga0068859_100005220 3300005617 Bacteria 13200
88 Ga0068864_100000896 3300005618 Bacteria 25081
89 Ga0068864_100015602 3300005618 Bacteria 6319
90 Ga0068866_10011398 3300005718 Bacteria 3845
91 Ga0068861_100003453 3300005719 Bacteria 10493
92 Ga0068861_100014080 3300005719 Bacteria 5609
93 Ga0068861_100031957 3300005719 Bacteria 3872
94 Ga0068861_100076760 3300005719 Bacteria 2604
95 Ga0068861_100105099 3300005719 Unclassified 2254
96 Ga0068861_100152597 3300005719 Bacteria 1897
97 Ga0068870_10016044 3300005840 Bacteria 3570
98 Ga0068863_100012842 3300005841 Bacteria 8077
99 Ga0068863_100018557 3300005841 Bacteria 6658
100 Ga0068863_100107615 3300005841 Bacteria 2653
101 Ga0068858_100144024 3300005842 Bacteria 2238
102 Ga0068860_100054977 3300005843 Bacteria 3783
103 Ga0068862_100008202 3300005844 Bacteria 8636
104 Ga0068862_100012037 3300005844 Bacteria 7149
105 Ga0068862_100023014 3300005844 Bacteria 5217
106 Ga0081539_10005039 3300005985 Bacteria 13891
107 Ga0097621_100003221 3300006237 Bacteria 11217
108 Ga0097621_100005127 3300006237 Bacteria 9204
109 Ga0097621_100073222 3300006237 Bacteria 2836
110 Ga0068871_100022437 3300006358 Bacteria 4865
111 Ga0068871_100201609 3300006358 Bacteria 1718
112 Ga0075428_100000005 3300006844 Bacteria 326130
113 Ga0075428_100000995 3300006844 Bacteria 29993
114 Ga0075428_100004257 3300006844 Bacteria 15746
115 Ga0075428_100023548 3300006844 Bacteria 6817
116 Ga0075428_100159296 3300006844 Bacteria 2450
117 Ga0075430_100003168 3300006846 Bacteria 13771
118 Ga0075430_100006351 3300006846 Bacteria 9967
119 Ga0075430_100110388 3300006846 Bacteria 2293
120 Ga0075431_100015000 3300006847 Bacteria 7844
121 Ga0075431_100020775 3300006847 Bacteria 6710
122 Ga0075431_100026981 3300006847 Bacteria 5892
123 Ga0075431_100138215 3300006847 Bacteria 2512
124 Ga0075431_100266025 3300006847 Bacteria 1739
125 Ga0075433_10014211 3300006852 Bacteria 6499
126 Ga0075434_100000141 3300006871 Bacteria 43904
127 Ga0075434_100001702 3300006871 Bacteria 18830
128 Ga0075434_100047183 3300006871 Bacteria 4275
129 Ga0075429_100001657 3300006880 Bacteria 18416
130 Ga0075429_100005510 3300006880 Bacteria 10899
131 Ga0075429_100008216 3300006880 Bacteria 9074
132 Ga0068865_100016508 3300006881 Bacteria 4727
133 Ga0068865_100069158 3300006881 Bacteria 2498
134 Ga0075436_100000461 3300006914 Bacteria 26318
135 Ga0075436_100022324 3300006914 Bacteria 4346
136 Ga0097620_100005219 3300006931 Bacteria 13200
137 Ga0075435_100000062 3300007076 Bacteria 55669
138 Ga0075435_100031022 3300007076 Bacteria 4208
139 Ga0075435_100062250 3300007076 Bacteria 3028
140 Ga0075435_100116476 3300007076 Bacteria 2226
141 Ga0105240_10013034 3300009093 Bacteria 11444
142 Ga0105240_10315245 3300009093 Bacteria 1784
143 Ga0111539_10000008 3300009094 Bacteria 382609
144 Ga0111539_10000201 3300009094 Bacteria 70327
145 Ga0111539_10000326 3300009094 Bacteria 58218
146 Ga0111539_10016826 3300009094 Bacteria 9057
147 Ga0111539_10020699 3300009094 Bacteria 8100
148 Ga0111539_10184574 3300009094 Bacteria 2436
149 Ga0111539_10210108 3300009094 Bacteria 2268
150 Ga0111539_10401605 3300009094 Bacteria 1596
151 Ga0105245_10036033 3300009098 Bacteria 4393
152 Ga0105245_10160153 3300009098 Bacteria 2135
153 Ga0114129_10000751 3300009147 Bacteria 41232
154 Ga0114129_10001192 3300009147 Bacteria 34525
155 Ga0114129_10004292 3300009147 Bacteria 20145
156 Ga0114129_10011232 3300009147 Bacteria 12768
157 Ga0114129_10036568 3300009147 Bacteria 6933
158 Ga0114129_10041879 3300009147 Bacteria 6448
159 Ga0114129_10117501 3300009147 Bacteria 3664
160 Ga0105243_10063809 3300009148 Bacteria 2953
161 Ga0105243_10073609 3300009148 Bacteria 2768
162 Ga0105241_10115001 3300009174 Bacteria 2159
163 Ga0105241_10198559 3300009174 Bacteria 1674
164 Ga0105242_10003253 3300009176 Bacteria 12673
165 Ga0105242_10012431 3300009176 Bacteria 6553
166 Ga0105242_10021810 3300009176 Bacteria 5033
167 Ga0105242_10069279 3300009176 Bacteria 2921
168 Ga0105242_10200884 3300009176 Bacteria 1771
169 Ga0105248_10018657 3300009177 Bacteria 7669
170 Ga0105248_10041623 3300009177 Bacteria 5151
171 Ga0105248_10078143 3300009177 Bacteria 3721
172 Ga0105248_10095610 3300009177 Bacteria 3345
173 Ga0105248_10097485 3300009177 Bacteria 3312
174 Ga0105248_10145079 3300009177 Bacteria 2679
175 Ga0105248_10189680 3300009177 Bacteria 2316
176 Ga0105248_10338540 3300009177 Bacteria 1694
177 Ga0105249_10167299 3300009553 Bacteria 2129
178 Ga0105249_10270816 3300009553 Bacteria 1692
179 Ga0157374_10017181 3300013296 Bacteria 6369
180 Ga0157374_10121912 3300013296 Bacteria 2517
181 Ga0157374_10225608 3300013296 Bacteria 1840
182 Ga0157378_10003271 3300013297 Bacteria 14401
183 Ga0157378_10103278 3300013297 Bacteria 2604
184 Ga0157378_10118475 3300013297 Bacteria 2437
185 Ga0163162_10083676 3300013306 Bacteria 3265
186 Ga0163162_10113755 3300013306 Bacteria 2805
187 Ga0163162_10162738 3300013306 Bacteria 2354
188 Ga0157375_10120990 3300013308 Bacteria 2727
189 Ga0157375_10309309 3300013308 Bacteria 1744
190 Ga0163163_10020089 3300014325 Bacteria 6287
191 Ga0163163_10029465 3300014325 Bacteria 5280
192 Ga0163163_10039262 3300014325 Bacteria 4620
193 Ga0163163_10046856 3300014325 Bacteria 4247
194 Ga0163163_10220319 3300014325 Bacteria 1946
195 Ga0157380_10008082 3300014326 Bacteria 7494
196 Ga0157380_10034035 3300014326 Bacteria 3928
197 Ga0157380_10078741 3300014326 Bacteria 2690
198 Ga0157380_10112488 3300014326 Bacteria 2291
199 Ga0157379_10012371 3300014968 Bacteria 7455
200 Ga0157379_10047701 3300014968 Bacteria 3822
201 Ga0157379_10092373 3300014968 Bacteria 2715
202 Ga0157376_10024124 3300014969 Bacteria 4771
203 Ga0157376_10208862 3300014969 Unclassified 1801
204 Ga0163161_10004912 3300017792 Bacteria 9306
205 Ga0207653_10022784 3300025885 Bacteria 1992
206 Ga0207682_10012706 3300025893 Bacteria 3284
207 Ga0207642_10008490 3300025899 Bacteria 3528
208 Ga0207680_10028981 3300025903 Bacteria 3105
209 Ga0207699_10053945 3300025906 Bacteria 2386
210 Ga0207645_10000630 3300025907 Bacteria 29240
211 Ga0207645_10020447 3300025907 Bacteria 4333
212 Ga0207705_10040576 3300025909 Bacteria 3339
213 Ga0207654_10124713 3300025911 Bacteria 1622
214 Ga0207707_10178275 3300025912 Bacteria 1855
215 Ga0207695_10120499 3300025913 Bacteria 2592
216 Ga0207657_10002909 3300025919 Bacteria 18389
217 Ga0207649_10027285 3300025920 Bacteria 3349
218 Ga0207649_10066633 3300025920 Unclassified 2283
219 Ga0207652_10044402 3300025921 Bacteria 3786
220 Ga0207646_10014996 3300025922 Bacteria 7335
221 Ga0207681_10016848 3300025923 Bacteria 4581
222 Ga0207681_10067603 3300025923 Bacteria 2478
223 Ga0207681_10067690 3300025923 Bacteria 2477
224 Ga0207650_10005986 3300025925 Bacteria 8299
225 Ga0207650_10006087 3300025925 Bacteria 8226
226 Ga0207650_10009814 3300025925 Bacteria 6547
227 Ga0207650_10066732 3300025925 Bacteria 2698
228 Ga0207650_10094447 3300025925 Bacteria 2291
229 Ga0207659_10003772 3300025926 Bacteria 9138
230 Ga0207659_10011203 3300025926 Bacteria 5658
231 Ga0207659_10012882 3300025926 Bacteria 5340
232 Ga0207659_10019775 3300025926 Bacteria 4438
233 Ga0207659_10024986 3300025926 Bacteria 4010
234 Ga0207659_10184452 3300025926 Bacteria 1656
235 Ga0207687_10032049 3300025927 Bacteria 3557
236 Ga0207687_10052935 3300025927 Bacteria 2834
237 Ga0207687_10053097 3300025927 Bacteria 2830
238 Ga0207706_10022246 3300025933 Bacteria 5689
239 Ga0207706_10087143 3300025933 Bacteria 2745
240 Ga0207686_10001907 3300025934 Bacteria 11544
241 Ga0207686_10010265 3300025934 Bacteria 5094
242 Ga0207709_10005224 3300025935 Bacteria 7389
243 Ga0207709_10129245 3300025935 Bacteria 1719
244 Ga0207670_10110214 3300025936 Unclassified 1982
245 Ga0207669_10008973 3300025937 Bacteria 4729
246 Ga0207704_10004147 3300025938 Bacteria 6606
247 Ga0207704_10012843 3300025938 Bacteria 4169
248 Ga0207704_10036101 3300025938 Bacteria 2841
249 Ga0207691_10008850 3300025940 Bacteria 9659
250 Ga0207691_10019555 3300025940 Bacteria 6407
251 Ga0207691_10027834 3300025940 Bacteria 5297
252 Ga0207711_10012316 3300025941 Bacteria 7108
253 Ga0207711_10054410 3300025941 Bacteria 3434
254 Ga0207711_10059381 3300025941 Bacteria 3293
255 Ga0207711_10124571 3300025941 Bacteria 2304
256 Ga0207689_10000951 3300025942 Bacteria 27860
257 Ga0207661_10146031 3300025944 Bacteria 2041
258 Ga0207679_10030575 3300025945 Bacteria 3762
259 Ga0207651_10083059 3300025960 Bacteria 2315
260 Ga0207712_10188491 3300025961 Bacteria 1626
261 Ga0207668_10078530 3300025972 Bacteria 2384
262 Ga0207640_10050452 3300025981 Bacteria 2700
263 Ga0207658_10037017 3300025986 Bacteria 3502
264 Ga0207677_10011084 3300026023 Bacteria 5124
265 Ga0207677_10086220 3300026023 Bacteria 2269
266 Ga0207703_10043473 3300026035 Bacteria 3606
267 Ga0207703_10200291 3300026035 Bacteria 1774
268 Ga0207708_10000978 3300026075 Bacteria 21433
269 Ga0207708_10006430 3300026075 Bacteria 8707
270 Ga0207708_10038180 3300026075 Bacteria 3658
271 Ga0207702_10184417 3300026078 Bacteria 1924
272 Ga0207641_10002668 3300026088 Bacteria 16296
273 Ga0207641_10019286 3300026088 Bacteria 5597
274 Ga0207641_10023900 3300026088 Bacteria 5038
275 Ga0207641_10221758 3300026088 Bacteria 1754
276 Ga0207648_10000864 3300026089 Bacteria 34096
277 Ga0207648_10004331 3300026089 Bacteria 14617
278 Ga0207648_10021936 3300026089 Bacteria 5737
279 Ga0207676_10012878 3300026095 Bacteria 6006
280 Ga0207676_10013024 3300026095 Bacteria 5972
281 Ga0207676_10024972 3300026095 Bacteria 4430
282 Ga0207674_10016324 3300026116 Bacteria 8133
283 Ga0207675_100002071 3300026118 Bacteria 19965
284 Ga0207675_100003564 3300026118 Bacteria 15160
285 Ga0207675_100008014 3300026118 Bacteria 9957
286 Ga0207675_100017351 3300026118 Bacteria 6720
287 Ga0207675_100035498 3300026118 Bacteria 4650
288 Ga0207675_100068728 3300026118 Bacteria 3310
289 Ga0207675_100074297 3300026118 Bacteria 3181
290 Ga0207675_100173557 3300026118 Bacteria 2061
291 Ga0207683_10004748 3300026121 Bacteria 11711
292 Ga0207683_10082279 3300026121 Bacteria 2860
293 Ga0207683_10087299 3300026121 Bacteria 2774
294 Ga0207698_10147298 3300026142 Bacteria 2038
295 Ga0207428_10000019 3300027907 Bacteria 276945
296 Ga0207428_10000089 3300027907 Bacteria 127333
297 Ga0207428_10000445 3300027907 Bacteria 50527
298 Ga0207428_10005407 3300027907 Bacteria 11912
299 Ga0207428_10013293 3300027907 Bacteria 7197
300 Ga0268266_10003785 3300028379 Bacteria 14810
301 Ga0268266_10025136 3300028379 Bacteria 5069
302 Ga0268266_10034425 3300028379 Bacteria 4308
303 Ga0268266_10063501 3300028379 Bacteria 3188
304 Ga0268266_10153686 3300028379 Bacteria 2077
305 Ga0268265_10035478 3300028380 Bacteria 3644
306 Ga0268265_10053159 3300028380 Bacteria 3067
307 Ga0265327_10000002 3300031251 Bacteria 856593
308 Ga0307408_100034485 3300031548 Bacteria 3545
309 Ga0307408_100050328 3300031548 Bacteria 2996
310 Ga0307408_100162594 3300031548 Bacteria 1774
311 Ga0307408_100224784 3300031548 Bacteria 1534
312 Ga0307405_10008956 3300031731 Bacteria 5109
313 Ga0307405_10016877 3300031731 Bacteria 3993
314 Ga0307413_10030381 3300031824 Bacteria 3035
315 Ga0307413_10065019 3300031824 Bacteria 2269
316 Ga0307413_10066016 3300031824 Bacteria 2256
317 Ga0307413_10220580 3300031824 Bacteria 1385
318 Ga0307410_10007119 3300031852 Bacteria 6100
319 Ga0307410_10030587 3300031852 Bacteria 3443
320 Ga0307410_10037722 3300031852 Bacteria 3159
321 Ga0307410_10046804 3300031852 Bacteria 2887
322 Ga0307410_10123499 3300031852 Bacteria 1892
323 Ga0307406_10025740 3300031901 Bacteria 3525
324 Ga0307407_10011216 3300031903 Bacteria 4255
325 Ga0307407_10036694 3300031903 Bacteria 2703
326 Ga0307407_10054072 3300031903 Bacteria 2313
327 Ga0307407_10065910 3300031903 Bacteria 2134
328 Ga0307412_10075129 3300031911 Bacteria 2317
329 Ga0307412_10189779 3300031911 Bacteria 1553
330 Ga0307409_100052878 3300031995 Bacteria 3117
331 Ga0307416_100014176 3300032002 Bacteria 5448
332 Ga0307416_100025312 3300032002 Bacteria 4348
333 Ga0307416_100037081 3300032002 Bacteria 3747
334 Ga0307416_100189025 3300032002 Bacteria 1940
335 Ga0307414_10022760 3300032004 Bacteria 3960
336 Ga0307414_10048495 3300032004 Bacteria 2930
337 Ga0307411_10015118 3300032005 Bacteria 4323
338 Ga0307411_10025449 3300032005 Bacteria 3546
339 Ga0307411_10025714 3300032005 Bacteria 3532
340 Ga0307411_10122697 3300032005 Bacteria 1883
341 Ga0307415_100011076 3300032126 Bacteria 5141
342 Ga0307415_100102851 3300032126 Bacteria 2100
343 Ga0307415_100201534 3300032126 Bacteria 1580
344 Ga0373948_0000324 3300034817 Bacteria 5790
345 Ga0373950_0001494 3300034818 Bacteria 3062
346 Ga0373958_0002051 3300034819 Bacteria 2780
347 Ga0373938_0000838 3300034957 Bacteria 4965
348 Ga0373928_0000702 3300035084 Bacteria 6558
349 Ga0373929_0000840 3300035085 Bacteria 5976
350 Ga0373940_0001078 3300035088 Bacteria 4728
351 Ga0373949_0001825 3300035090 Bacteria 5814
352 Ga0373951_0000905 3300035091 Bacteria 7975
353 Ga0373932_0001171 3300035112 Bacteria 7511
354 Ga0373939_0000509 3300035114 Bacteria 9740
355 Ga0373941_0004882 3300035115 Bacteria 3125
356 Ga0373960_0000630 3300035121 Bacteria 7228
357 Ga0373955_0024161 3300035172 Bacteria 3105
358 Ga0373955_0038910 3300035172 Unclassified 2536
359 Ga0373955_0079225 3300035172 Bacteria 1853
360 Ga0373942_0000868 3300035207 Bacteria 8272
361 Ga0373961_0004152 3300035241 Bacteria 3519
362 Ga0373962_0000189 3300035242 Bacteria 12957
363 Ga0373931_0029806 3300035691 Bacteria 2804
364 Ga0373935_0129254 3300035692 Bacteria 1696
365 Ga0373937_0009496 3300036401 Bacteria 8456
366 Ga0373937_0014933 3300036401 Bacteria 6859
367 Ga0373937_0074581 3300036401 Bacteria 3131
368 Ga0373937_0135678 3300036401 Bacteria 2301
369 Ga0450894_002030 3300042131 Bacteria 2790
370 Ga0439434_0035578 3300042435 Bacteria 1522
371 Ga0439435_0000954 3300042436 Bacteria 5027
372 Ga0439435_0009585 3300042436 Bacteria 2275
373 Ga0439444_0004475 3300042437 Bacteria 2034
374 Ga0450918_001664 3300042531 Bacteria 4356
375 Ga0451577_0000074 3300042876 Bacteria 232698
376 Ga0451577_0005601 3300042876 Bacteria 12775
377 Ga0451577_0012810 3300042876 Bacteria 7870
378 Ga0453683_0102092 3300044673 Bacteria 1801
379 Ga0466963_0188977 3300044694 Bacteria 1439
380 Ga0453684_0000229 3300044712 Bacteria 241494
381 Ga0453684_0000482 3300044712 Bacteria 158296
382 Ga0453684_0010417 3300044712 Bacteria 15906
383 Ga0453684_0100108 3300044712 Bacteria 3548
384 Ga0453684_0162004 3300044712 Bacteria 2645
385 Ga0453684_0219828 3300044712 Bacteria 2201
386 Ga0451576_0000451 3300045051 Bacteria 93335
387 Ga0451576_0012814 3300045051 Bacteria 9408
388 Ga0451576_0277004 3300045051 Bacteria 1754
389 Ga0495653_0141567 3300046463 Bacteria 1691
390 Ga0495628_0183191 3300046516 Bacteria 1583
391 Ga0495621_0008280 3300046539 Bacteria 3111
392 Ga0495645_0005003 3300046543 Bacteria 9084
393 Ga0495635_0078688 3300046663 Bacteria 2257
394 Ga0495659_0042145 3300046664 Bacteria 1633
395 Ga0495623_0046130 3300046679 Bacteria 2767
396 Ga0495658_0032993 3300046683 Bacteria 2832
397 Ga0495613_0054558 3300046689 Bacteria 2938
398 Ga0495613_0110411 3300046689 Bacteria 1982
399 Ga0495684_0128365 3300047471 Unclassified 1906
400 Ga0496104_0002051 3300048907 Bacteria 17496
401 Ga0496105_0197946 3300048908 Bacteria 1641
402 Ga0496106_0226772 3300048909 Bacteria 1491
403 Ga0496107_0289691 3300048910 Bacteria 1219
404 Ga0496109_0002729 3300048912 Bacteria 14802
405 Ga0496110_0047169 3300048913 Bacteria 3771
406 Ga0496110_0079424 3300048913 Unclassified 2921
407 Ga0496112_0006991 3300048915 Bacteria 9962
408 Ga0496113_0006098 3300048916 Bacteria 7604
409 Ga0496114_0029265 3300048917 Bacteria 4525
410 Ga0496114_0040851 3300048917 Bacteria 3842
411 Ga0501031_0066923 3300049568 Bacteria 2341
412 Ga0501031_0113484 3300049568 Bacteria 1770
413 Ga0501033_0024988 3300049570 Bacteria 4502
414 Ga0501036_0059342 3300049572 Bacteria 3242
415 Ga0501036_0106234 3300049572 Bacteria 2374
416 Ga0501038_0131730 3300049574 Bacteria 2052
417 Ga0501038_0216839 3300049574 Unclassified 1529
418 Ga0501039_0055350 3300049575 Bacteria 3072
419 Ga0501039_0096401 3300049575 Bacteria 2306
420 Ga0501039_0140453 3300049575 Bacteria 1897
421 Ga0501040_0002974 3300049576 Bacteria 10966
422 Ga0501040_0024499 3300049576 Bacteria 4050
423 Ga0501040_0120940 3300049576 Bacteria 1837
424 Ga0501040_0131241 3300049576 Bacteria 1762
425 Ga0501041_0008354 3300049577 Bacteria 6089
426 Ga0501041_0113331 3300049577 Bacteria 1683
427 Ga0501042_0002230 3300049578 Bacteria 11833
428 Ga0501042_0025810 3300049578 Bacteria 4129
429 Ga0501042_0059006 3300049578 Bacteria 2740
430 Ga0501043_0238206 3300049579 Bacteria 1404
431 Ga0501046_0105349 3300049580 Bacteria 2160
432 Ga0501047_0037243 3300049581 Bacteria 4703
433 Ga0501048_0016739 3300049582 Bacteria 5405
434 Ga0501048_0063438 3300049582 Bacteria 2613
435 Ga0501048_0107357 3300049582 Bacteria 1971
436 Ga0501071_0014003 3300049587 Bacteria 5480
437 Ga0501071_0081312 3300049587 Bacteria 2371
438 Ga0501071_0106881 3300049587 Bacteria 2066
439 Ga0501072_0013227 3300049588 Bacteria 6320
440 Ga0501072_0013363 3300049588 Bacteria 6285
441 Ga0501072_0040809 3300049588 Bacteria 3645
442 Ga0501072_0045301 3300049588 Bacteria 3458
443 Ga0501072_0055883 3300049588 Bacteria 3111
444 Ga0501072_0068831 3300049588 Bacteria 2794
445 Ga0501075_0000537 3300049591 Bacteria 22963
446 Ga0501075_0035134 3300049591 Bacteria 3737
447 Ga0501076_0010915 3300049592 Bacteria 6758
448 Ga0501076_0012889 3300049592 Bacteria 6257
449 Ga0501076_0027925 3300049592 Bacteria 4378
450 Ga0501076_0068187 3300049592 Bacteria 2841
451 Ga0501076_0076614 3300049592 Bacteria 2682
452 Ga0501077_0033979 3300049593 Bacteria 3245
453 Ga0501225_0027757 3300049705 Bacteria 1556
454 Ga0501079_0009228 3300049741 Bacteria 7472
455 Ga0501079_0103456 3300049741 Bacteria 2209
456 Ga0501080_0218597 3300049742 Bacteria 1744
457 Ga0501081_0005170 3300049743 Bacteria 8399
458 Ga0501081_0022648 3300049743 Bacteria 4205
459 Ga0501081_0158825 3300049743 Bacteria 1628
460 Ga0501283_007329 3300049779 Bacteria 1568
461 Ga0501044_0005862 3300049823 Bacteria 13610
462 Ga0501045_0000849 3300049824 Bacteria 19812
463 Ga0501045_0004716 3300049824 Bacteria 9410
464 Ga0501045_0008833 3300049824 Bacteria 7038
465 Ga0501045_0055733 3300049824 Bacteria 2891
466 Ga0501045_0104156 3300049824 Bacteria 2102
467 nmdc:mga05p37_125494_c1 3300050507 Bacteria 3152
468 nmdc:mga05p37_14704_c1 3300050507 Bacteria 9403
469 nmdc:mga05p37_19231_c1 3300050507 Bacteria 8261
470 nmdc:mga05p37_45349_c1 3300050507 Bacteria 5408
471 nmdc:mga05p37_46858_c1 3300050507 Bacteria 5315
472 nmdc:mga05p37_638_c1 3300050507 Bacteria 38795
473 nmdc:mga05p37_9543_c1 3300050507 Bacteria 11492
474 nmdc:mga09592_2104_c1 3300050508 Bacteria 16079
475 nmdc:mga09592_43849_c1 3300050508 Bacteria 3763
476 nmdc:mga09592_6319_c1 3300050508 Bacteria 9655
477 nmdc:mga0qj67_1418_c1 3300050509 Bacteria 16781
478 nmdc:mga0qj67_92166_c1 3300050509 Bacteria 2436
479 nmdc:mga06r32_145508_c1 3300050510 Bacteria 2347
480 nmdc:mga06r32_15354_c1 3300050510 Bacteria 6958
481 nmdc:mga06r32_242405_c1 3300050510 Bacteria 1790
482 nmdc:mga06r32_3661_c1 3300050510 Bacteria 13540
483 nmdc:mga06r32_7742_c1 3300050510 Bacteria 9661
484 nmdc:mga08y16_173018_c1 3300050511 Bacteria 2243
485 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
486 nmdc:mga08y16_19192_c1 3300050511 Bacteria 7203
487 nmdc:mga08y16_22957_c1 3300050511 Bacteria 6586
488 nmdc:mga08y16_4743_c1 3300050511 Bacteria 14177
489 nmdc:mga0n895_264_c1 3300050512 Bacteria 34123
490 nmdc:mga0n895_285377_c1 3300050512 Bacteria 1674
491 nmdc:mga0n895_6198_c1 3300050512 Bacteria 10115
492 nmdc:mga0rr50_14628_c1 3300050513 Bacteria 5153
493 nmdc:mga0rr50_76637_c1 3300050513 Bacteria 2567
494 nmdc:mga0rr50_77_c1 3300050513 Bacteria 55683
495 nmdc:mga08x19_105815_c1 3300050514 Bacteria 1871
496 nmdc:mga08x19_289_c1 3300050514 Bacteria 37059
497 nmdc:mga08x19_41215_c1 3300050514 Bacteria 2941
498 nmdc:mga08x19_51619_c1 3300050514 Bacteria 2643
499 nmdc:mga0a205_33624_c1 3300050515 Bacteria 4916
500 Ga0495601_0050345 3300053077 Bacteria 2627
501 Ga0495595_0026391 3300053084 Bacteria 2581
502 Ga0495619_0059022 3300053085 Bacteria 2548
503 Ga0500555_000560 3300053103 Bacteria 14765
504 Ga0500645_000401 3300053730 Bacteria 30362
505 Ga0501084_0036596 3300054114 Bacteria 4100
506 Ga0501084_0176865 3300054114 Bacteria 1801
507 Ga0590075_000029 3300059424 Bacteria 38953
508 Ga0590075_000237 3300059424 Bacteria 15504
509 Ga0590077_000036 3300059426 Bacteria 30851
510 Ga0590077_001831 3300059426 Bacteria 4727
511 Ga0501082_0034422 3300060353 Bacteria 4367
512 Ga0530510_0000360 3300061734 Bacteria 29492
513 Ga0530510_0016031 3300061734 Bacteria 5296
514 Ga0530510_0059643 3300061734 Bacteria 2760
515 Ga0451577_0001910
516 Ga0065714_10075733
517 Ga0065704_10141561
518 Ga0065712_10068440
519 Ga0065712_10082766
520 Ga0065715_10000407
521 Ga0065715_10001923
522 Ga0065715_10002254
523 Ga0065707_10002034
524 Ga0065707_10108468
525 Ga0070658_10037343
526 Ga0070676_10023624
527 Ga0070683_100057351
528 Ga0070690_100020696
529 Ga0070690_100137990
530 Ga0070670_100000819
531 Ga0070670_100003459
532 Ga0070670_100006579
533 Ga0070670_100006965
534 Ga0070670_100137979
535 Ga0068869_100001337
536 Ga0068868_100061338
537 Ga0070660_100016534
538 Ga0070689_100044435
539 Ga0070691_10001464
540 Ga0070661_100027305
541 Ga0070668_100006636
542 Ga0070668_100096562
543 Ga0070669_100019845
544 Ga0070669_100020374
545 Ga0070669_100036684
546 Ga0070669_100060715
547 Ga0070669_100065156
548 Ga0070675_100002874
549 Ga0070675_100005204
550 Ga0070675_100020294
551 Ga0070675_100026028
552 Ga0070671_100053453
553 Ga0070673_100134253
554 Ga0070688_100001419
555 Ga0070688_100018359
556 Ga0070667_100018630
557 Ga0070667_100169902
558 Ga0070703_10032417
559 Ga0070705_100014698
560 Ga0070700_100005804
561 Ga0070700_100026859
562 Ga0070700_100080724
563 Ga0070700_100121059
564 Ga0070694_100056802
565 Ga0070708_100042053
566 Ga0070708_100164193
567 Ga0070662_100045085
568 Ga0070662_100084767
569 Ga0068867_100003053
570 Ga0068867_100003095
571 Ga0068867_100031732
572 Ga0070685_10003450
573 Ga0070685_10069364
574 Ga0070707_100054472
575 Ga0070698_100002882
576 Ga0070698_100014668
577 Ga0070699_100041060
578 Ga0070699_100060877
579 Ga0070679_100002683
580 Ga0070679_100057854
581 Ga0068853_100094578
582 Ga0070672_100020024
583 Ga0070686_100001968
584 Ga0070695_100004711
585 Ga0070695_100009577
586 Ga0070695_100014698
587 Ga0070693_100074331
588 Ga0070665_100001492
589 Ga0070665_100005070
590 Ga0070665_100035934
591 Ga0070665_100188730
592 Ga0070704_100090378
593 Ga0068855_100053144
594 Ga0070664_100065530
595 Ga0068857_100018868
596 Ga0068854_100037425
597 Ga0068856_100105849
598 Ga0070702_100004668
599 Ga0070702_100024001
600 Ga0068852_100263547
601 Ga0068859_100005220
602 Ga0068864_100000896
603 Ga0068864_100015602
604 Ga0068866_10011398
605 Ga0068861_100003453
606 Ga0068861_100014080
607 Ga0068861_100031957
608 Ga0068861_100076760
609 Ga0068861_100105099
610 Ga0068861_100152597
611 Ga0068870_10016044
612 Ga0068863_100012842
613 Ga0068863_100018557
614 Ga0068863_100107615
615 Ga0068858_100144024
616 Ga0068860_100054977
617 Ga0068862_100008202
618 Ga0068862_100012037
619 Ga0068862_100023014
620 Ga0081539_10005039
621 Ga0097621_100003221
622 Ga0097621_100005127
623 Ga0097621_100073222
624 Ga0068871_100022437
625 Ga0068871_100201609
626 Ga0075428_100000005
627 Ga0075428_100000995
628 Ga0075428_100004257
629 Ga0075428_100023548
630 Ga0075428_100159296
631 Ga0075430_100003168
632 Ga0075430_100006351
633 Ga0075430_100110388
634 Ga0075431_100015000
635 Ga0075431_100020775
636 Ga0075431_100026981
637 Ga0075431_100138215
638 Ga0075431_100266025
639 Ga0075433_10014211
640 Ga0075434_100000141
641 Ga0075434_100001702
642 Ga0075434_100047183
643 Ga0075429_100001657
644 Ga0075429_100005510
645 Ga0075429_100008216
646 Ga0068865_100016508
647 Ga0068865_100069158
648 Ga0075436_100000461
649 Ga0075436_100022324
650 Ga0097620_100005219
651 Ga0075435_100000062
652 Ga0075435_100031022
653 Ga0075435_100062250
654 Ga0075435_100116476
655 Ga0105240_10013034
656 Ga0105240_10315245
657 Ga0111539_10000008
658 Ga0111539_10000201
659 Ga0111539_10000326
660 Ga0111539_10016826
661 Ga0111539_10020699
662 Ga0111539_10184574
663 Ga0111539_10210108
664 Ga0111539_10401605
665 Ga0105245_10036033
666 Ga0105245_10160153
667 Ga0114129_10000751
668 Ga0114129_10001192
669 Ga0114129_10004292
670 Ga0114129_10011232
671 Ga0114129_10036568
672 Ga0114129_10041879
673 Ga0114129_10117501
674 Ga0105243_10063809
675 Ga0105243_10073609
676 Ga0105241_10115001
677 Ga0105241_10198559
678 Ga0105242_10003253
679 Ga0105242_10012431
680 Ga0105242_10021810
681 Ga0105242_10069279
682 Ga0105242_10200884
683 Ga0105248_10018657
684 Ga0105248_10041623
685 Ga0105248_10078143
686 Ga0105248_10095610
687 Ga0105248_10097485
688 Ga0105248_10145079
689 Ga0105248_10189680
690 Ga0105248_10338540
691 Ga0105249_10167299
692 Ga0105249_10270816
693 Ga0157374_10017181
694 Ga0157374_10121912
695 Ga0157374_10225608
696 Ga0157378_10003271
697 Ga0157378_10103278
698 Ga0157378_10118475
699 Ga0163162_10083676
700 Ga0163162_10113755
701 Ga0163162_10162738
702 Ga0157375_10120990
703 Ga0157375_10309309
704 Ga0163163_10020089
705 Ga0163163_10029465
706 Ga0163163_10039262
707 Ga0163163_10046856
708 Ga0163163_10220319
709 Ga0157380_10008082
710 Ga0157380_10034035
711 Ga0157380_10078741
712 Ga0157380_10112488
713 Ga0157379_10012371
714 Ga0157379_10047701
715 Ga0157379_10092373
716 Ga0157376_10024124
717 Ga0157376_10208862
718 Ga0163161_10004912
719 Ga0207653_10022784
720 Ga0207682_10012706
721 Ga0207642_10008490
722 Ga0207680_10028981
723 Ga0207699_10053945
724 Ga0207645_10000630
725 Ga0207645_10020447
726 Ga0207705_10040576
727 Ga0207654_10124713
728 Ga0207707_10178275
729 Ga0207695_10120499
730 Ga0207657_10002909
731 Ga0207649_10027285
732 Ga0207649_10066633
733 Ga0207652_10044402
734 Ga0207646_10014996
735 Ga0207681_10016848
736 Ga0207681_10067603
737 Ga0207681_10067690
738 Ga0207650_10005986
739 Ga0207650_10006087
740 Ga0207650_10009814
741 Ga0207650_10066732
742 Ga0207650_10094447
743 Ga0207659_10003772
744 Ga0207659_10011203
745 Ga0207659_10012882
746 Ga0207659_10019775
747 Ga0207659_10024986
748 Ga0207659_10184452
749 Ga0207687_10032049
750 Ga0207687_10052935
751 Ga0207687_10053097
752 Ga0207706_10022246
753 Ga0207706_10087143
754 Ga0207686_10001907
755 Ga0207686_10010265
756 Ga0207709_10005224
757 Ga0207709_10129245
758 Ga0207670_10110214
759 Ga0207669_10008973
760 Ga0207704_10004147
761 Ga0207704_10012843
762 Ga0207704_10036101
763 Ga0207691_10008850
764 Ga0207691_10019555
765 Ga0207691_10027834
766 Ga0207711_10012316
767 Ga0207711_10054410
768 Ga0207711_10059381
769 Ga0207711_10124571
770 Ga0207689_10000951
771 Ga0207661_10146031
772 Ga0207679_10030575
773 Ga0207651_10083059
774 Ga0207712_10188491
775 Ga0207668_10078530
776 Ga0207640_10050452
777 Ga0207658_10037017
778 Ga0207677_10011084
779 Ga0207677_10086220
780 Ga0207703_10043473
781 Ga0207703_10200291
782 Ga0207708_10000978
783 Ga0207708_10006430
784 Ga0207708_10038180
785 Ga0207702_10184417
786 Ga0207641_10002668
787 Ga0207641_10019286
788 Ga0207641_10023900
789 Ga0207641_10221758
790 Ga0207648_10000864
791 Ga0207648_10004331
792 Ga0207648_10021936
793 Ga0207676_10012878
794 Ga0207676_10013024
795 Ga0207676_10024972
796 Ga0207674_10016324
797 Ga0207675_100002071
798 Ga0207675_100003564
799 Ga0207675_100008014
800 Ga0207675_100017351
801 Ga0207675_100035498
802 Ga0207675_100068728
803 Ga0207675_100074297
804 Ga0207675_100173557
805 Ga0207683_10004748
806 Ga0207683_10082279
807 Ga0207683_10087299
808 Ga0207698_10147298
809 Ga0207428_10000019
810 Ga0207428_10000089
811 Ga0207428_10000445
812 Ga0207428_10005407
813 Ga0207428_10013293
814 Ga0268266_10003785
815 Ga0268266_10025136
816 Ga0268266_10034425
817 Ga0268266_10063501
818 Ga0268266_10153686
819 Ga0268265_10035478
820 Ga0268265_10053159
821 Ga0265327_10000002
822 Ga0307408_100034485
823 Ga0307408_100050328
824 Ga0307408_100162594
825 Ga0307408_100224784
826 Ga0307405_10008956
827 Ga0307405_10016877
828 Ga0307413_10030381
829 Ga0307413_10065019
830 Ga0307413_10066016
831 Ga0307413_10220580
832 Ga0307410_10007119
833 Ga0307410_10030587
834 Ga0307410_10037722
835 Ga0307410_10046804
836 Ga0307410_10123499
837 Ga0307406_10025740
838 Ga0307407_10011216
839 Ga0307407_10036694
840 Ga0307407_10054072
841 Ga0307407_10065910
842 Ga0307412_10075129
843 Ga0307412_10189779
844 Ga0307409_100052878
845 Ga0307416_100014176
846 Ga0307416_100025312
847 Ga0307416_100037081
848 Ga0307416_100189025
849 Ga0307414_10022760
850 Ga0307414_10048495
851 Ga0307411_10015118
852 Ga0307411_10025449
853 Ga0307411_10025714
854 Ga0307411_10122697
855 Ga0307415_100011076
856 Ga0307415_100102851
857 Ga0307415_100201534
858 Ga0373948_0000324
859 Ga0373950_0001494
860 Ga0373958_0002051
861 Ga0373938_0000838
862 Ga0373928_0000702
863 Ga0373929_0000840
864 Ga0373940_0001078
865 Ga0373949_0001825
866 Ga0373951_0000905
867 Ga0373932_0001171
868 Ga0373939_0000509
869 Ga0373941_0004882
870 Ga0373960_0000630
871 Ga0373955_0024161
872 Ga0373955_0038910
873 Ga0373955_0079225
874 Ga0373942_0000868
875 Ga0373961_0004152
876 Ga0373962_0000189
877 Ga0373931_0029806
878 Ga0373935_0129254
879 Ga0373937_0009496
880 Ga0373937_0014933
881 Ga0373937_0074581
882 Ga0373937_0135678
883 Ga0450894_002030
884 Ga0439434_0035578
885 Ga0439435_0000954
886 Ga0439435_0009585
887 Ga0439444_0004475
888 Ga0450918_001664
889 Ga0451577_0000074
890 Ga0451577_0005601
891 Ga0451577_0012810
892 Ga0453683_0102092
893 Ga0466963_0188977
894 Ga0453684_0000229
895 Ga0453684_0000482
896 Ga0453684_0010417
897 Ga0453684_0100108
898 Ga0453684_0162004
899 Ga0453684_0219828
900 Ga0451576_0000451
901 Ga0451576_0012814
902 Ga0451576_0277004
903 Ga0495653_0141567
904 Ga0495628_0183191
905 Ga0495621_0008280
906 Ga0495645_0005003
907 Ga0495635_0078688
908 Ga0495659_0042145
909 Ga0495623_0046130
910 Ga0495658_0032993
911 Ga0495613_0054558
912 Ga0495613_0110411
913 Ga0495684_0128365
914 Ga0496104_0002051
915 Ga0496105_0197946
916 Ga0496106_0226772
917 Ga0496107_0289691
918 Ga0496109_0002729
919 Ga0496110_0047169
920 Ga0496110_0079424
921 Ga0496112_0006991
922 Ga0496113_0006098
923 Ga0496114_0029265
924 Ga0496114_0040851
925 Ga0501031_0066923
926 Ga0501031_0113484
927 Ga0501033_0024988
928 Ga0501036_0059342
929 Ga0501036_0106234
930 Ga0501038_0131730
931 Ga0501038_0216839
932 Ga0501039_0055350
933 Ga0501039_0096401
934 Ga0501039_0140453
935 Ga0501040_0002974
936 Ga0501040_0024499
937 Ga0501040_0120940
938 Ga0501040_0131241
939 Ga0501041_0008354
940 Ga0501041_0113331
941 Ga0501042_0002230
942 Ga0501042_0025810
943 Ga0501042_0059006
944 Ga0501043_0238206
945 Ga0501046_0105349
946 Ga0501047_0037243
947 Ga0501048_0016739
948 Ga0501048_0063438
949 Ga0501048_0107357
950 Ga0501071_0014003
951 Ga0501071_0081312
952 Ga0501071_0106881
953 Ga0501072_0013227
954 Ga0501072_0013363
955 Ga0501072_0040809
956 Ga0501072_0045301
957 Ga0501072_0055883
958 Ga0501072_0068831
959 Ga0501075_0000537
960 Ga0501075_0035134
961 Ga0501076_0010915
962 Ga0501076_0012889
963 Ga0501076_0027925
964 Ga0501076_0068187
965 Ga0501076_0076614
966 Ga0501077_0033979
967 Ga0501225_0027757
968 Ga0501079_0009228
969 Ga0501079_0103456
970 Ga0501080_0218597
971 Ga0501081_0005170
972 Ga0501081_0022648
973 Ga0501081_0158825
974 Ga0501283_007329
975 Ga0501044_0005862
976 Ga0501045_0000849
977 Ga0501045_0004716
978 Ga0501045_0008833
979 Ga0501045_0055733
980 Ga0501045_0104156
981 nmdc:mga05p37_125494_c1
982 nmdc:mga05p37_14704_c1
983 nmdc:mga05p37_19231_c1
984 nmdc:mga05p37_45349_c1
985 nmdc:mga05p37_46858_c1
986 nmdc:mga05p37_638_c1
987 nmdc:mga05p37_9543_c1
988 nmdc:mga09592_2104_c1
989 nmdc:mga09592_43849_c1
990 nmdc:mga09592_6319_c1
991 nmdc:mga0qj67_1418_c1
992 nmdc:mga0qj67_92166_c1
993 nmdc:mga06r32_145508_c1
994 nmdc:mga06r32_15354_c1
995 nmdc:mga06r32_242405_c1
996 nmdc:mga06r32_3661_c1
997 nmdc:mga06r32_7742_c1
998 nmdc:mga08y16_173018_c1
999 nmdc:mga08y16_17_c1
1000 nmdc:mga08y16_19192_c1
1001 nmdc:mga08y16_22957_c1
1002 nmdc:mga08y16_4743_c1
1003 nmdc:mga0n895_264_c1
1004 nmdc:mga0n895_285377_c1
1005 nmdc:mga0n895_6198_c1
1006 nmdc:mga0rr50_14628_c1
1007 nmdc:mga0rr50_76637_c1
1008 nmdc:mga0rr50_77_c1
1009 nmdc:mga08x19_105815_c1
1010 nmdc:mga08x19_289_c1
1011 nmdc:mga08x19_41215_c1
1012 nmdc:mga08x19_51619_c1
1013 nmdc:mga0a205_33624_c1
1014 Ga0495601_0050345
1015 Ga0495595_0026391
1016 Ga0495619_0059022
1017 Ga0500555_000560
1018 Ga0500645_000401
1019 Ga0501084_0036596
1020 Ga0501084_0176865
1021 Ga0590075_000029
1022 Ga0590075_000237
1023 Ga0590077_000036
1024 Ga0590077_001831
1025 Ga0501082_0034422
1026 Ga0530510_0000360
1027 Ga0530510_0016031
1028 Ga0530510_0059643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02163

Peptidase_M50

Peptidase family M50

30

454

0.98

PF17820

PDZ_6

PDZ domain

151

203

0.97

PF13180

PDZ_2

PDZ domain

232

304

0.94

PF13180

PDZ_2

PDZ domain

120

213

0.91

PF17820

PDZ_6

PDZ domain

241

295

0.89

PF00595

PDZ

PDZ domain

151

202

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3id3-assembly1.cif.gz_B crystal structure of rsep pdz2 i304a domain 0.9381 129 211
7w70-assembly1.cif.gz_B crystal structure of the pdz-c domain fragment of kangiella koreensis rsep orthologue 0.9367 130 211
7xft-assembly1.cif.gz_A-2 mucp pdz2 domain 0.9363 128 210
3pv4-assembly1.cif.gz_A structure of legionella fallonii degq (delta-pdz2 variant) 0.9302 132 197
3id2-assembly1.cif.gz_B crystal structure of rsep pdz2 domain 0.9228 128 211
ID Description Score Start End Superfamily
af_P0C0V0_287_387_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9451 134 194 2.30.42.10
3id3B00 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9381 129 211 2.30.42.10
3pv4A03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9302 132 197 2.30.42.10
3wkmB02 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9291 129 211 2.30.42.10
af_A0A0P0VNU6_285_398_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9219 132 194 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A0B2C669-F1-model_v4 deleted 0.9684 296 424
AF-A0A836P347-F1-model_v4 Zinc metalloprotease 0.9577 301 424 GO:0004222
GO:0006508
GO:0016020
AF-A0A352MV81-F1-model_v4 Peptidase M50 domain-containing protein 0.9479 9 104 GO:0004222
GO:0006508
GO:0016020
AF-A0A3B9I3X8-F1-model_v4 RIP metalloprotease RseP 0.9471 1 112 GO:0004222
GO:0006508
GO:0016020
AF-A0A3C1TND1-F1-model_v4 RIP metalloprotease RseP 0.9469 293 425 GO:0004222
GO:0006508
GO:0016020

Map