F457760

General Info

Members Datasets Scaffolds Average Seq Length
514 271 514 215

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0096140|Ga0451576_0096140_1698_2489
Length 253
Sequence VLSQVPDGIASDTPHQRADQTIYDLKSLAWRPVNVNQESSMFSLFRPMKIGLLLAVSISSHVASALAESKVDTATTNLQTAVFAGGCFWGVDAVFKHVKGVASVESGYAGGSADKANYEAVSSGRTGHAEAVRVRFNPVQVSYQQLLQVFFIVAHDPTQLNRQGPDIGSQYRSAVFYSDPEQQKLAVAQIQQLSADHAFSKPVVTQITALQQFYPAEAYHQNYLALHPNQPYIVINDQPKIEHLRKQFPALYQ

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10030652 3300004799 Bacteria 957
2 Ga0058861_11501997 3300004800 Eukaryota 768
3 Ga0058862_10686863 3300004803 Bacteria 1276
4 Ga0058862_12556473 3300004803 Bacteria 960
5 Ga0070658_10037172 3300005327 Bacteria 3924
6 Ga0070676_10223785 3300005328 Bacteria 1244
7 Ga0070683_100030700 3300005329 Bacteria 4882
8 Ga0070683_100353508 3300005329 Bacteria 1399
9 Ga0070670_100175474 3300005331 Unclassified 1860
10 Ga0070677_10241492 3300005333 Bacteria 892
11 Ga0068869_100067651 3300005334 Bacteria 2636
12 Ga0070680_100024389 3300005336 Bacteria 4832
13 Ga0070680_100116697 3300005336 Bacteria 2225
14 Ga0070680_100244584 3300005336 Bacteria 1517
15 Ga0070680_100298083 3300005336 Bacteria 1367
16 Ga0068868_100015183 3300005338 Bacteria 5690
17 Ga0068868_100015658 3300005338 Bacteria 5616
18 Ga0070660_100049827 3300005339 Bacteria 3221
19 Ga0070660_100072589 3300005339 Bacteria 2690
20 Ga0070660_100114882 3300005339 Bacteria 2145
21 Ga0070660_100348659 3300005339 Bacteria 1219
22 Ga0070687_100041502 3300005343 Bacteria 2326
23 Ga0070661_100023255 3300005344 Bacteria 4440
24 Ga0070661_100036184 3300005344 Bacteria 3589
25 Ga0070661_100073424 3300005344 Bacteria 2519
26 Ga0070661_100669487 3300005344 Bacteria 844
27 Ga0070668_100067671 3300005347 Bacteria 2775
28 Ga0070669_100685869 3300005353 Bacteria 864
29 Ga0070669_100898044 3300005353 Bacteria 757
30 Ga0070675_100025943 3300005354 Bacteria 4700
31 Ga0070671_100019452 3300005355 Bacteria 5526
32 Ga0070671_100081351 3300005355 Unclassified 2708
33 Ga0070671_100352781 3300005355 Bacteria 1256
34 Ga0070673_100033378 3300005364 Bacteria 3886
35 Ga0070673_100149462 3300005364 Bacteria 1977
36 Ga0070688_100033499 3300005365 Bacteria 3106
37 Ga0070659_100010910 3300005366 Bacteria 6704
38 Ga0070659_100306700 3300005366 Bacteria 1325
39 Ga0070659_100367333 3300005366 Bacteria 1210
40 Ga0070667_100013293 3300005367 Bacteria 6799
41 Ga0070667_100026656 3300005367 Bacteria 4808
42 Ga0070703_10045237 3300005406 Bacteria 1388
43 Ga0070709_10113353 3300005434 Bacteria 1826
44 Ga0070714_100111535 3300005435 Bacteria 2422
45 Ga0070714_100131528 3300005435 Bacteria 2237
46 Ga0070714_100721811 3300005435 Bacteria 962
47 Ga0070714_100904194 3300005435 Bacteria 857
48 Ga0070713_100011865 3300005436 Bacteria 6368
49 Ga0070713_100164247 3300005436 Bacteria 1984
50 Ga0070710_10011234 3300005437 Bacteria 4421
51 Ga0070710_10206579 3300005437 Bacteria 1243
52 Ga0070710_10406989 3300005437 Bacteria 913
53 Ga0070701_10069412 3300005438 Bacteria 1880
54 Ga0070711_100064578 3300005439 Bacteria 2558
55 Ga0070705_100044107 3300005440 Bacteria 2560
56 Ga0070705_100064189 3300005440 Bacteria 2193
57 Ga0070705_100096826 3300005440 Bacteria 1853
58 Ga0070705_100113745 3300005440 Bacteria 1734
59 Ga0070694_100251751 3300005444 Bacteria 1336
60 Ga0070694_100620408 3300005444 Bacteria 872
61 Ga0070708_100015266 3300005445 Bacteria 6337
62 Ga0070708_100197721 3300005445 Bacteria 1881
63 Ga0070708_100269799 3300005445 Unclassified 1600
64 Ga0070708_100377133 3300005445 Bacteria 1337
65 Ga0070663_100002315 3300005455 Bacteria 10698
66 Ga0070678_100467443 3300005456 Bacteria 1107
67 Ga0070662_100001538 3300005457 Bacteria 14231
68 Ga0070681_10000369 3300005458 Bacteria 36274
69 Ga0070681_10000529 3300005458 Bacteria 31314
70 Ga0070681_10218553 3300005458 Bacteria 1821
71 Ga0070681_10327832 3300005458 Bacteria 1441
72 Ga0070681_10425986 3300005458 Bacteria 1239
73 Ga0068867_100397336 3300005459 Bacteria 1162
74 Ga0070706_100028375 3300005467 Bacteria 5153
75 Ga0070706_100312701 3300005467 Bacteria 1465
76 Ga0070706_100399985 3300005467 Bacteria 1279
77 Ga0070706_100542796 3300005467 Bacteria 1081
78 Ga0070706_100866135 3300005467 Bacteria 835
79 Ga0070707_100081916 3300005468 Bacteria 3116
80 Ga0070707_100265296 3300005468 Bacteria 1670
81 Ga0070698_100000323 3300005471 Bacteria 48831
82 Ga0070698_100050008 3300005471 Unclassified 4264
83 Ga0070698_100353969 3300005471 Bacteria 1400
84 Ga0070699_100011648 3300005518 Bacteria 7591
85 Ga0070699_100041734 3300005518 Bacteria 3971
86 Ga0070699_100048540 3300005518 Bacteria 3674
87 Ga0070699_100057431 3300005518 Bacteria 3371
88 Ga0070699_100165819 3300005518 Bacteria 1957
89 Ga0070699_100236245 3300005518 Bacteria 1630
90 Ga0070699_100272002 3300005518 Bacteria 1516
91 Ga0070679_100004795 3300005530 Bacteria 12474
92 Ga0070679_100136399 3300005530 Bacteria 2435
93 Ga0070679_100151378 3300005530 Bacteria 2296
94 Ga0070684_100014724 3300005535 Bacteria 6346
95 Ga0070684_100437168 3300005535 Bacteria 1208
96 Ga0070697_100004928 3300005536 Bacteria 10239
97 Ga0070697_100012227 3300005536 Bacteria 6722
98 Ga0070697_100071735 3300005536 Bacteria 2841
99 Ga0070697_100116643 3300005536 Bacteria 2230
100 Ga0070697_100399862 3300005536 Bacteria 1192
101 Ga0070697_100754442 3300005536 Bacteria 860
102 Ga0068853_100008601 3300005539 Bacteria 8206
103 Ga0068853_100208310 3300005539 Bacteria 1781
104 Ga0068853_100273229 3300005539 Bacteria 1557
105 Ga0068853_100456834 3300005539 Bacteria 1202
106 Ga0070672_100004570 3300005543 Bacteria 9058
107 Ga0070672_100390974 3300005543 Bacteria 1191
108 Ga0070686_100093528 3300005544 Bacteria 2016
109 Ga0070695_100013292 3300005545 Bacteria 4946
110 Ga0070695_100193374 3300005545 Bacteria 1449
111 Ga0070695_100283874 3300005545 Bacteria 1217
112 Ga0070696_100004798 3300005546 Bacteria 9038
113 Ga0070696_100111288 3300005546 Bacteria 1972
114 Ga0070693_100106100 3300005547 Bacteria 1720
115 Ga0070665_100014155 3300005548 Bacteria 8015
116 Ga0070704_100035376 3300005549 Bacteria 3394
117 Ga0068855_100004182 3300005563 Bacteria 17611
118 Ga0068855_100067253 3300005563 Bacteria 4175
119 Ga0068855_100181425 3300005563 Bacteria 2380
120 Ga0068855_100637389 3300005563 Bacteria 1146
121 Ga0070664_100004590 3300005564 Bacteria 11085
122 Ga0070664_100018767 3300005564 Bacteria 5689
123 Ga0070664_100046974 3300005564 Bacteria 3647
124 Ga0070664_100177382 3300005564 Bacteria 1892
125 Ga0070664_100181758 3300005564 Bacteria 1869
126 Ga0068857_100031557 3300005577 Bacteria 4682
127 Ga0068857_100158429 3300005577 Bacteria 2053
128 Ga0068857_100489721 3300005577 Bacteria 1153
129 Ga0068854_100004663 3300005578 Bacteria 8646
130 Ga0068854_100149797 3300005578 Bacteria 1798
131 Ga0068856_100000746 3300005614 Bacteria 35249
132 Ga0070702_100022724 3300005615 Bacteria 3322
133 Ga0068852_100042400 3300005616 Bacteria 3853
134 Ga0068852_100351796 3300005616 Bacteria 1439
135 Ga0068852_100528138 3300005616 Bacteria 1178
136 Ga0068859_100041705 3300005617 Bacteria 4610
137 Ga0068859_100077800 3300005617 Bacteria 3358
138 Ga0068864_100079009 3300005618 Bacteria 2880
139 Ga0068864_100096420 3300005618 Bacteria 2617
140 Ga0068866_10008881 3300005718 Bacteria 4250
141 Ga0068861_100103411 3300005719 Bacteria 2270
142 Ga0068851_10000378 3300005834 Bacteria 20201
143 Ga0068863_100006681 3300005841 Bacteria 11324
144 Ga0068858_100005189 3300005842 Bacteria 12759
145 Ga0068858_100099702 3300005842 Bacteria 2708
146 Ga0068858_100242660 3300005842 Bacteria 1710
147 Ga0068860_100006493 3300005843 Bacteria 11744
148 Ga0068860_100025165 3300005843 Bacteria 5744
149 Ga0081455_10103894 3300005937 Bacteria 2274
150 Ga0081539_10002497 3300005985 Bacteria 25807
151 Ga0070715_10018918 3300006163 Bacteria 2633
152 Ga0070716_100002954 3300006173 Bacteria 7921
153 Ga0070716_100619399 3300006173 Bacteria 816
154 Ga0070712_100011660 3300006175 Bacteria 5582
155 Ga0097621_100078320 3300006237 Bacteria 2746
156 Ga0068871_100269865 3300006358 Bacteria 1486
157 Ga0075431_100069567 3300006847 Bacteria 3632
158 Ga0075433_10001428 3300006852 Bacteria 17622
159 Ga0075433_10063821 3300006852 Bacteria 3228
160 Ga0075433_10176973 3300006852 Bacteria 1898
161 Ga0075434_100006694 3300006871 Bacteria 10584
162 Ga0075434_100006705 3300006871 Bacteria 10578
163 Ga0075434_100082212 3300006871 Bacteria 3218
164 Ga0075434_100229773 3300006871 Bacteria 1874
165 Ga0075434_100805452 3300006871 Bacteria 955
166 Ga0075429_100024924 3300006880 Bacteria 5193
167 Ga0075436_100006567 3300006914 Bacteria 7964
168 Ga0075436_100027469 3300006914 Bacteria 3916
169 Ga0075436_100151035 3300006914 Bacteria 1635
170 Ga0097620_100041704 3300006931 Bacteria 4610
171 Ga0097620_100077790 3300006931 Bacteria 3358
172 Ga0075435_100024762 3300007076 Bacteria 4663
173 Ga0075435_100209916 3300007076 Bacteria 1652
174 Ga0075435_100223103 3300007076 Bacteria 1600
175 Ga0075435_100554478 3300007076 Bacteria 995
176 Ga0099794_10074801 3300007265 Bacteria 1664
177 Ga0099794_10340909 3300007265 Bacteria 779
178 Ga0105240_10110290 3300009093 Bacteria 3331
179 Ga0105240_10146627 3300009093 Bacteria 2816
180 Ga0111539_10458338 3300009094 Bacteria 1485
181 Ga0105245_10001936 3300009098 Bacteria 18810
182 Ga0105245_10036167 3300009098 Bacteria 4385
183 Ga0114129_10056482 3300009147 Bacteria 5498
184 Ga0114129_10073909 3300009147 Bacteria 4749
185 Ga0114129_10172869 3300009147 Bacteria 2944
186 Ga0114129_10389400 3300009147 Unclassified 1839
187 Ga0114129_10539369 3300009147 Bacteria 1519
188 Ga0105241_10004933 3300009174 Bacteria 9838
189 Ga0105242_10024904 3300009176 Bacteria 4730
190 Ga0105248_10018972 3300009177 Bacteria 7605
191 Ga0105248_10185036 3300009177 Bacteria 2347
192 Ga0105248_10436847 3300009177 Bacteria 1474
193 Ga0105248_11232991 3300009177 Unclassified 846
194 Ga0105237_10110340 3300009545 Bacteria 2743
195 Ga0105237_10148527 3300009545 Bacteria 2339
196 Ga0105237_10873122 3300009545 Bacteria 906
197 Ga0105249_10042764 3300009553 Bacteria 4122
198 Ga0105239_10083766 3300010375 Bacteria 3512
199 Ga0105239_10304810 3300010375 Bacteria 1794
200 Ga0105239_10313296 3300010375 Bacteria 1769
201 Ga0105239_10772561 3300010375 Bacteria 1100
202 Ga0105246_10288274 3300011119 Bacteria 1320
203 Ga0157373_10534090 3300013100 Bacteria 849
204 Ga0157371_10001640 3300013102 Bacteria 22899
205 Ga0157371_10017865 3300013102 Bacteria 5258
206 Ga0157370_10064853 3300013104 Bacteria 3457
207 Ga0157370_10079226 3300013104 Bacteria 3094
208 Ga0157370_10092454 3300013104 Bacteria 2839
209 Ga0157370_10478885 3300013104 Bacteria 1144
210 Ga0157369_10065902 3300013105 Bacteria 3898
211 Ga0157369_10101127 3300013105 Bacteria 3073
212 Ga0157369_10204494 3300013105 Bacteria 2071
213 Ga0157369_10395910 3300013105 Bacteria 1433
214 Ga0157378_10192448 3300013297 Bacteria 1925
215 Ga0163162_10052037 3300013306 Bacteria 4111
216 Ga0163162_10359600 3300013306 Bacteria 1589
217 Ga0157372_10022097 3300013307 Bacteria 6881
218 Ga0157372_10324179 3300013307 Bacteria 1793
219 Ga0157372_10345829 3300013307 Bacteria 1733
220 Ga0157372_10643758 3300013307 Bacteria 1235
221 Ga0157375_10028482 3300013308 Bacteria 5236
222 Ga0157375_10196151 3300013308 Bacteria 2174
223 Ga0157375_10241389 3300013308 Bacteria 1966
224 Ga0163163_10306489 3300014325 Bacteria 1640
225 Ga0163163_10319779 3300014325 Bacteria 1605
226 Ga0157377_10079276 3300014745 Bacteria 1915
227 Ga0157379_10007952 3300014968 Bacteria 9197
228 Ga0163161_10178803 3300017792 Bacteria 1626
229 Ga0197907_10337531 3300020069 Bacteria 1313
230 Ga0206356_10778933 3300020070 Bacteria 3705
231 Ga0206352_11168908 3300020078 Bacteria 886
232 Ga0206354_10881869 3300020081 Bacteria 1859
233 Ga0213872_10002337 3300021361 Bacteria 11269
234 Ga0213872_10059636 3300021361 Bacteria 1726
235 Ga0224712_10064201 3300022467 Bacteria 1472
236 Ga0207656_10182026 3300025321 Bacteria 1009
237 Ga0207653_10001975 3300025885 Bacteria 6557
238 Ga0207692_10266269 3300025898 Bacteria 1032
239 Ga0207680_10016790 3300025903 Bacteria 3852
240 Ga0207680_10113198 3300025903 Bacteria 1764
241 Ga0207647_10114834 3300025904 Bacteria 1590
242 Ga0207685_10091820 3300025905 Bacteria 1280
243 Ga0207645_10074164 3300025907 Bacteria 2178
244 Ga0207645_10120299 3300025907 Bacteria 1704
245 Ga0207684_10035278 3300025910 Bacteria 4247
246 Ga0207684_10167860 3300025910 Bacteria 1891
247 Ga0207654_10382805 3300025911 Bacteria 975
248 Ga0207707_10007482 3300025912 Bacteria 9516
249 Ga0207707_10015852 3300025912 Bacteria 6572
250 Ga0207707_10063388 3300025912 Bacteria 3217
251 Ga0207707_10115907 3300025912 Bacteria 2341
252 Ga0207707_10326199 3300025912 Bacteria 1325
253 Ga0207695_10161595 3300025913 Bacteria 2171
254 Ga0207671_10067607 3300025914 Bacteria 2661
255 Ga0207693_10008601 3300025915 Bacteria 8353
256 Ga0207693_10319475 3300025915 Bacteria 1215
257 Ga0207693_10377422 3300025915 Bacteria 1109
258 Ga0207663_10050392 3300025916 Bacteria 2587
259 Ga0207660_10099067 3300025917 Bacteria 2174
260 Ga0207660_10331696 3300025917 Bacteria 1216
261 Ga0207662_10135270 3300025918 Bacteria 1557
262 Ga0207657_10000822 3300025919 Bacteria 32803
263 Ga0207657_10000888 3300025919 Bacteria 31632
264 Ga0207657_10011195 3300025919 Bacteria 8919
265 Ga0207657_10223816 3300025919 Bacteria 1506
266 Ga0207649_10042751 3300025920 Bacteria 2766
267 Ga0207649_10387396 3300025920 Bacteria 1043
268 Ga0207652_10001466 3300025921 Bacteria 20873
269 Ga0207652_10036631 3300025921 Bacteria 4147
270 Ga0207652_10110055 3300025921 Bacteria 2442
271 Ga0207646_10008872 3300025922 Bacteria 10015
272 Ga0207646_10014453 3300025922 Bacteria 7497
273 Ga0207646_10408985 3300025922 Bacteria 1225
274 Ga0207681_10050411 3300025923 Bacteria 2817
275 Ga0207694_10073613 3300025924 Bacteria 2673
276 Ga0207650_10108834 3300025925 Unclassified 2143
277 Ga0207659_10043994 3300025926 Bacteria 3140
278 Ga0207687_10013132 3300025927 Bacteria 5411
279 Ga0207687_10145112 3300025927 Bacteria 1805
280 Ga0207700_10075954 3300025928 Bacteria 2605
281 Ga0207664_10007052 3300025929 Bacteria 7785
282 Ga0207664_10018391 3300025929 Bacteria 5143
283 Ga0207664_10036084 3300025929 Bacteria 3819
284 Ga0207664_10275527 3300025929 Bacteria 1475
285 Ga0207644_10006054 3300025931 Bacteria 7890
286 Ga0207644_10029454 3300025931 Bacteria 3809
287 Ga0207644_10049797 3300025931 Bacteria 3001
288 Ga0207690_10003125 3300025932 Bacteria 9971
289 Ga0207690_10102417 3300025932 Bacteria 2047
290 Ga0207706_10000149 3300025933 Bacteria 76532
291 Ga0207706_10121035 3300025933 Bacteria 2301
292 Ga0207686_10020899 3300025934 Bacteria 3747
293 Ga0207704_10193240 3300025938 Bacteria 1482
294 Ga0207665_10006105 3300025939 Bacteria 8001
295 Ga0207665_10042715 3300025939 Bacteria 3030
296 Ga0207691_10016655 3300025940 Bacteria 6980
297 Ga0207691_10347690 3300025940 Bacteria 1269
298 Ga0207711_10003939 3300025941 Bacteria 12769
299 Ga0207711_10023846 3300025941 Bacteria 5122
300 Ga0207711_10456627 3300025941 Bacteria 1189
301 Ga0207689_10052314 3300025942 Bacteria 3365
302 Ga0207689_10139638 3300025942 Bacteria 1996
303 Ga0207661_10017012 3300025944 Bacteria 5371
304 Ga0207661_10197400 3300025944 Bacteria 1767
305 Ga0207661_10363436 3300025944 Bacteria 1308
306 Ga0207679_10001327 3300025945 Bacteria 15634
307 Ga0207679_10149873 3300025945 Bacteria 1897
308 Ga0207679_10197720 3300025945 Bacteria 1677
309 Ga0207667_10001211 3300025949 Bacteria 32264
310 Ga0207667_10006496 3300025949 Bacteria 14142
311 Ga0207667_10039969 3300025949 Bacteria 4994
312 Ga0207667_10044932 3300025949 Bacteria 4679
313 Ga0207667_10272046 3300025949 Bacteria 1732
314 Ga0207667_10701265 3300025949 Bacteria 1015
315 Ga0207651_10009783 3300025960 Bacteria 5273
316 Ga0207651_10208485 3300025960 Bacteria 1571
317 Ga0207651_10449014 3300025960 Bacteria 1106
318 Ga0207712_10041557 3300025961 Bacteria 3161
319 Ga0207640_10010335 3300025981 Bacteria 5255
320 Ga0207640_10642008 3300025981 Bacteria 903
321 Ga0207658_10024732 3300025986 Bacteria 4202
322 Ga0207677_10042649 3300026023 Bacteria 3010
323 Ga0207677_10094764 3300026023 Bacteria 2180
324 Ga0207677_10354753 3300026023 Bacteria 1230
325 Ga0207703_10002933 3300026035 Bacteria 14508
326 Ga0207703_10093820 3300026035 Bacteria 2528
327 Ga0207703_10477686 3300026035 Bacteria 1168
328 Ga0207639_10024964 3300026041 Bacteria 4330
329 Ga0207639_10412657 3300026041 Bacteria 1219
330 Ga0207639_10646556 3300026041 Bacteria 978
331 Ga0207678_10003959 3300026067 Bacteria 13325
332 Ga0207702_10004548 3300026078 Bacteria 12292
333 Ga0207702_10026028 3300026078 Bacteria 4857
334 Ga0207702_10466720 3300026078 Bacteria 1227
335 Ga0207648_10131536 3300026089 Bacteria 2203
336 Ga0207648_10146253 3300026089 Bacteria 2084
337 Ga0207676_10076370 3300026095 Bacteria 2706
338 Ga0207676_11122947 3300026095 Bacteria 777
339 Ga0207674_10000273 3300026116 Bacteria 65119
340 Ga0207674_10041616 3300026116 Bacteria 4750
341 Ga0207674_10047647 3300026116 Bacteria 4392
342 Ga0207674_10361665 3300026116 Bacteria 1403
343 Ga0207675_100254447 3300026118 Bacteria 1700
344 Ga0207698_10013035 3300026142 Bacteria 5470
345 Ga0207698_10065737 3300026142 Bacteria 2850
346 Ga0207698_10115869 3300026142 Bacteria 2257
347 Ga0207698_11188650 3300026142 Bacteria 776
348 Ga0209969_1008158 3300027360 Bacteria 1484
349 Ga0209981_1014564 3300027378 Bacteria 1098
350 Ga0209996_1024424 3300027395 Bacteria 861
351 Ga0209995_1012936 3300027471 Bacteria 1365
352 Ga0209999_1022652 3300027543 Bacteria 1156
353 Ga0209588_1029312 3300027671 Bacteria 1755
354 Ga0209998_10033150 3300027717 Bacteria 1150
355 Ga0209974_10000954 3300027876 Bacteria 10118
356 Ga0268266_10039645 3300028379 Bacteria 4012
357 Ga0268264_10005145 3300028381 Bacteria 11083
358 Ga0268264_10028239 3300028381 Bacteria 4587
359 Ga0265336_10000650 3300028666 Bacteria 18953
360 Ga0265336_10047899 3300028666 Bacteria 1297
361 Ga0265324_10000004 3300029957 Bacteria 356972
362 Ga0265324_10003508 3300029957 Bacteria 7418
363 Ga0265760_10000006 3300031090 Bacteria 143747
364 Ga0265325_10001049 3300031241 Bacteria 19900
365 Ga0265325_10009779 3300031241 Bacteria 5586
366 Ga0265331_10086233 3300031250 Bacteria 1455
367 Ga0265327_10008902 3300031251 Bacteria 7369
368 Ga0265316_10053446 3300031344 Bacteria 3165
369 Ga0265316_10129589 3300031344 Bacteria 1901
370 Ga0307408_100022815 3300031548 Bacteria 4257
371 Ga0316575_10000017 3300031665 Bacteria 43424
372 Ga0265314_10001003 3300031711 Bacteria 33063
373 Ga0265314_10042409 3300031711 Bacteria 3246
374 Ga0265314_10219914 3300031711 Bacteria 1109
375 Ga0307405_10270228 3300031731 Bacteria 1274
376 Ga0307413_10001534 3300031824 Bacteria 8864
377 Ga0307410_10001817 3300031852 Bacteria 9908
378 Ga0307406_10043672 3300031901 Bacteria 2804
379 Ga0307406_10147341 3300031901 Bacteria 1675
380 Ga0307407_10005443 3300031903 Bacteria 5526
381 Ga0307412_10036348 3300031911 Bacteria 3154
382 Ga0307409_100121811 3300031995 Bacteria 2210
383 Ga0307416_100199648 3300032002 Bacteria 1896
384 Ga0307414_10381126 3300032004 Bacteria 1219
385 Ga0307411_10007322 3300032005 Bacteria 5607
386 Ga0307415_100189603 3300032126 Bacteria 1621
387 Ga0316583_10006413 3300032133 Bacteria 4224
388 Ga0373926_0011980 3300035083 Bacteria 2927
389 Ga0373934_0004565 3300035086 Bacteria 5116
390 Ga0373944_0052303 3300035089 Bacteria 1290
391 Ga0373936_0024501 3300035113 Bacteria 2356
392 Ga0373945_0272525 3300035116 Bacteria 719
393 Ga0373953_0014289 3300035117 Bacteria 2853
394 Ga0373954_0005532 3300035118 Bacteria 5468
395 Ga0373954_0038675 3300035118 Bacteria 2219
396 Ga0373956_0054026 3300035119 Bacteria 1809
397 Ga0373957_0073592 3300035120 Bacteria 1340
398 Ga0373943_0022289 3300035170 Bacteria 2933
399 Ga0373943_0025391 3300035170 Bacteria 2769
400 Ga0373943_0055506 3300035170 Bacteria 1963
401 Ga0373946_0047386 3300035171 Bacteria 1785
402 Ga0373955_0001011 3300035172 Bacteria 11950
403 Ga0373955_0074867 3300035172 Bacteria 1901
404 Ga0373955_0092373 3300035172 Bacteria 1727
405 Ga0373955_0212073 3300035172 Bacteria 1155
406 Ga0373924_0164975 3300035410 Bacteria 972
407 Ga0373935_0345126 3300035692 Bacteria 1060
408 Ga0373927_0059099 3300035695 Bacteria 2480
409 Ga0373927_0072538 3300035695 Bacteria 2228
410 Ga0373933_0091013 3300035724 Bacteria 1882
411 Ga0373933_0165618 3300035724 Bacteria 1405
412 Ga0373947_0381052 3300035725 Bacteria 949
413 Ga0373937_0000482 3300036401 Bacteria 36556
414 Ga0373937_0064361 3300036401 Bacteria 3372
415 Ga0373937_0164904 3300036401 Bacteria 2077
416 Ga0373937_0289128 3300036401 Bacteria 1548
417 Ga0373925_0530412 3300037068 Bacteria 967
418 Ga0436360_0124020 3300039438 Unclassified 1600
419 Ga0436361_0022074 3300039447 Bacteria 5867
420 Ga0436361_0272349 3300039447 Bacteria 22942
421 Ga0451853_3170273 3300041512 Bacteria 800
422 Ga0450893_0018262 3300042532 Bacteria 1195
423 Ga0451577_0007940 3300042876 Bacteria 10367
424 Ga0451577_0136821 3300042876 Bacteria 2200
425 Ga0451577_0493844 3300042876 Bacteria 1111
426 Ga0453683_0085670 3300044673 Bacteria 1974
427 Ga0453683_0137159 3300044673 Archaea 1543
428 Ga0466963_0239073 3300044694 Bacteria 1273
429 Ga0466963_0271536 3300044694 Bacteria 1191
430 Ga0453684_0000731 3300044712 Bacteria 115326
431 Ga0451576_0000034 3300045051 Bacteria 390778
432 Ga0451576_0002024 3300045051 Bacteria 32030
433 Ga0451576_0007031 3300045051 Bacteria 13600
434 Ga0451576_0089284 3300045051 Unclassified 3205
435 Ga0451576_0096140 3300045051 Bacteria 3081
436 Ga0451576_0157148 3300045051 Bacteria 2372
437 Ga0451576_0182286 3300045051 Bacteria 2192
438 Ga0466967_0404627 3300045976 Bacteria 1328
439 Ga0495592_0069706 3300046454 Bacteria 2563
440 Ga0495629_0031236 3300046459 Bacteria 3772
441 Ga0495653_0036849 3300046463 Bacteria 3849
442 Ga0495580_0121343 3300046472 Bacteria 1814
443 Ga0495582_0005280 3300046473 Bacteria 7220
444 Ga0495664_0002346 3300046477 Bacteria 10142
445 Ga0495664_0052772 3300046477 Bacteria 2417
446 Ga0495618_0119650 3300046514 Bacteria 1687
447 Ga0495628_0003471 3300046516 Bacteria 14098
448 Ga0495628_0023357 3300046516 Bacteria 5077
449 Ga0495630_0052317 3300046517 Bacteria 3057
450 Ga0495630_0224340 3300046517 Bacteria 1435
451 Ga0495652_0029182 3300046529 Bacteria 4846
452 Ga0495665_0045725 3300046531 Bacteria 2325
453 Ga0495665_0059308 3300046531 Bacteria 2020
454 Ga0495587_0001820 3300046536 Bacteria 14233
455 Ga0495587_0020349 3300046536 Bacteria 4097
456 Ga0495621_0003699 3300046539 Bacteria 4231
457 Ga0495645_0001365 3300046543 Bacteria 16497
458 Ga0495645_0005102 3300046543 Bacteria 8997
459 Ga0495645_0239207 3300046543 Bacteria 1212
460 Ga0495667_0007982 3300046559 Bacteria 7179
461 Ga0495634_0022575 3300046642 Bacteria 4433
462 Ga0495599_0008294 3300046678 Bacteria 6319
463 Ga0495623_0001793 3300046679 Bacteria 14433
464 Ga0495623_0095622 3300046679 Bacteria 1816
465 Ga0495646_0023115 3300046680 Bacteria 3914
466 Ga0495658_0382631 3300046683 Bacteria 896
467 Ga0495600_0057031 3300046809 Bacteria 2552
468 Ga0495600_0089777 3300046809 Bacteria 2004
469 Ga0495600_0226586 3300046809 Bacteria 1194
470 Ga0495581_0008739 3300047315 Bacteria 5867
471 Ga0495581_0110325 3300047315 Bacteria 1600
472 Ga0495604_0042564 3300047317 Bacteria 3559
473 Ga0495604_0065129 3300047317 Bacteria 2775
474 Ga0495674_0196365 3300047319 Bacteria 1676
475 Ga0495674_0208014 3300047319 Bacteria 1621
476 Ga0495674_0302080 3300047319 Bacteria 1307
477 Ga0495674_0652112 3300047319 Unclassified 830
478 Ga0495675_0041558 3300047444 Bacteria 2930
479 Ga0495684_0008930 3300047471 Bacteria 7741
480 Ga0495602_0010584 3300048088 Bacteria 9567
481 Ga0495602_0081144 3300048088 Bacteria 2728
482 Ga0496101_0042019 3300048904 Bacteria 3263
483 Ga0496102_0033765 3300048905 Bacteria 4600
484 Ga0496103_0021478 3300048906 Bacteria 3884
485 Ga0496105_0139277 3300048908 Bacteria 1998
486 Ga0496106_0000594 3300048909 Bacteria 25897
487 Ga0496106_0447851 3300048909 Bacteria 1037
488 Ga0496107_0080576 3300048910 Bacteria 2374
489 Ga0496109_0078232 3300048912 Bacteria 3045
490 Ga0496112_0029636 3300048915 Bacteria 5293
491 Ga0496113_0438875 3300048916 Bacteria 1049
492 nmdc:mga05p37_187292_c1 3300050507 Bacteria 2516
493 nmdc:mga05p37_4918_c1 3300050507 Bacteria 15652
494 nmdc:mga09592_17814_c1 3300050508 Bacteria 5820
495 nmdc:mga06r32_180130_c1 3300050510 Bacteria 2099
496 nmdc:mga0n895_1485_c1 3300050512 Bacteria 17590
497 nmdc:mga0n895_17215_c1 3300050512 Bacteria 6659
498 nmdc:mga0n895_364_c1 3300050512 Bacteria 30516
499 nmdc:mga0n895_477981_c1 3300050512 Bacteria 1257
500 nmdc:mga0rr50_166138_c1 3300050513 Bacteria 1794
501 nmdc:mga0rr50_195237_c1 3300050513 Bacteria 1661
502 nmdc:mga0rr50_204463_c1 3300050513 Bacteria 1624
503 nmdc:mga0rr50_612671_c1 3300050513 Bacteria 928
504 nmdc:mga08x19_10311_c1 3300050514 Bacteria 5609
505 nmdc:mga08x19_247699_c1 3300050514 Bacteria 1230
506 nmdc:mga08x19_32550_c1 3300050514 Bacteria 3287
507 nmdc:mga08x19_62655_c1 3300050514 Bacteria 2412
508 nmdc:mga0a205_2675_c1 3300050515 Bacteria 15756
509 nmdc:mga0a205_30477_c1 3300050515 Bacteria 5165
510 nmdc:mga0a205_703_c1 3300050515 Bacteria 26810
511 nmdc:mga0a205_76598_c1 3300050515 Bacteria 3233
512 Ga0495595_0140519 3300053084 Bacteria 1184
513 Ga0495619_0175522 3300053085 Bacteria 1482
514 Ga0587128_008085 3300059630 Bacteria 1350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10873122 Ga0105237_108731221 188
2 3300005518 Ga0070699_100041734 Ga0070699_1000417344 189
3 3300005406 Ga0070703_10045237 Ga0070703_100452372 190
4 3300005440 Ga0070705_100064189 Ga0070705_1000641893 190
5 3300005467 Ga0070706_100866135 Ga0070706_1008661351 190
6 3300005536 Ga0070697_100399862 Ga0070697_1003998621 190
7 3300050514 nmdc:mga08x19_10311_c1 nmdc:mga08x19_10311_c1_4649_5266 190
8 3300042876 Ga0451577_0136821 Ga0451577_0136821_66_677 191
9 3300045051 Ga0451576_0000034 Ga0451576_0000034_350494_351105 191
10 3300045051 Ga0451576_0002024 Ga0451576_0002024_17767_18381 191
11 3300045051 Ga0451576_0007031 Ga0451576_0007031_3946_4560 191
12 3300005334 Ga0068869_100067651 Ga0068869_1000676512 192
13 3300005347 Ga0070668_100067671 Ga0070668_1000676712 192
14 3300005459 Ga0068867_100397336 Ga0068867_1003973361 192
15 3300007265 Ga0099794_10340909 Ga0099794_103409091 192
16 3300025942 Ga0207689_10139638 Ga0207689_101396382 192
17 3300031250 Ga0265331_10086233 Ga0265331_100862332 192
18 3300032133 Ga0316583_10006413 Ga0316583_100064134 192
19 3300028666 Ga0265336_10000650 Ga0265336_1000065017 193
20 3300028666 Ga0265336_10047899 Ga0265336_100478991 193
21 3300029957 Ga0265324_10000004 Ga0265324_10000004174 193
22 3300029957 Ga0265324_10003508 Ga0265324_100035083 193
23 3300031241 Ga0265325_10001049 Ga0265325_1000104919 193
24 3300031241 Ga0265325_10009779 Ga0265325_100097796 193
25 3300031344 Ga0265316_10053446 Ga0265316_100534461 193
26 3300031711 Ga0265314_10001003 Ga0265314_100010038 193
27 3300031711 Ga0265314_10042409 Ga0265314_100424093 193
28 3300044673 Ga0453683_0085670 Ga0453683_0085670_857_1486 194
29 3300005367 Ga0070667_100026656 Ga0070667_1000266564 195
30 3300005518 Ga0070699_100165819 Ga0070699_1001658193 195
31 3300005536 Ga0070697_100754442 Ga0070697_1007544421 195
32 3300005617 Ga0068859_100077800 Ga0068859_1000778003 195
33 3300005618 Ga0068864_100096420 Ga0068864_1000964202 195
34 3300005842 Ga0068858_100099702 Ga0068858_1000997022 195
35 3300005843 Ga0068860_100025165 Ga0068860_1000251653 195
36 3300006237 Ga0097621_100078320 Ga0097621_1000783203 195
37 3300006358 Ga0068871_100269865 Ga0068871_1002698651 195
38 3300006931 Ga0097620_100077790 Ga0097620_1000777903 195
39 3300009177 Ga0105248_10436847 Ga0105248_104368472 195
40 3300009553 Ga0105249_10042764 Ga0105249_100427644 195
41 3300013297 Ga0157378_10192448 Ga0157378_101924482 195
42 3300013306 Ga0163162_10052037 Ga0163162_100520374 195
43 3300013308 Ga0157375_10028482 Ga0157375_100284824 195
44 3300014325 Ga0163163_10319779 Ga0163163_103197792 195
45 3300025961 Ga0207712_10041557 Ga0207712_100415572 195
46 3300026035 Ga0207703_10093820 Ga0207703_100938202 195
47 3300026089 Ga0207648_10146253 Ga0207648_101462531 195
48 3300026095 Ga0207676_11122947 Ga0207676_111229471 195
49 3300028381 Ga0268264_10028239 Ga0268264_100282394 195
50 3300031251 Ga0265327_10008902 Ga0265327_100089027 195
51 3300031665 Ga0316575_10000017 Ga0316575_1000001713 195
52 3300042876 Ga0451577_0493844 Ga0451577_0493844_274_903 195
53 3300021361 Ga0213872_10002337 Ga0213872_100023375 197
54 3300021361 Ga0213872_10059636 Ga0213872_100596362 197
55 3300039447 Ga0436361_0022074 Ga0436361_0022074_403_1056 197
56 3300039447 Ga0436361_0272349 Ga0436361_0272349_6989_7627 197
57 3300042876 Ga0451577_0007940 Ga0451577_0007940_3562_4209 197
58 3300045051 Ga0451576_0157148 Ga0451576_0157148_1562_2209 197
59 3300045051 Ga0451576_0096140 Ga0451576_0096140_1698_2489 198
60 3300004803 Ga0058862_10686863 Ga0058862_106868632 199
61 3300006847 Ga0075431_100069567 Ga0075431_1000695672 200
62 3300006852 Ga0075433_10063821 Ga0075433_100638213 200
63 3300006871 Ga0075434_100006705 Ga0075434_1000067054 200
64 3300006880 Ga0075429_100024924 Ga0075429_1000249246 200
65 3300006914 Ga0075436_100006567 Ga0075436_1000065673 200
66 3300007076 Ga0075435_100554478 Ga0075435_1005544782 200
67 3300009147 Ga0114129_10389400 Ga0114129_103894003 200
68 3300039438 Ga0436360_0124020 Ga0436360_0124020_684_1319 200
69 3300044673 Ga0453683_0137159 Ga0453683_0137159_107_724 200
70 3300045051 Ga0451576_0089284 Ga0451576_0089284_582_1199 200
71 3300045051 Ga0451576_0182286 Ga0451576_0182286_1332_1949 200
72 3300047317 Ga0495604_0042564 Ga0495604_0042564_2464_3087 200
73 3300047319 Ga0495674_0652112 Ga0495674_0652112_25_648 200
74 3300048088 Ga0495602_0010584 Ga0495602_0010584_5706_6329 200
75 3300050507 nmdc:mga05p37_187292_c1 nmdc:mga05p37_187292_c1_1462_2079 200
76 3300050508 nmdc:mga09592_17814_c1 nmdc:mga09592_17814_c1_4319_4936 200
77 3300050510 nmdc:mga06r32_180130_c1 nmdc:mga06r32_180130_c1_1043_1660 200
78 3300050512 nmdc:mga0n895_364_c1 nmdc:mga0n895_364_c1_9096_9713 200
79 3300050514 nmdc:mga08x19_247699_c1 nmdc:mga08x19_247699_c1_170_787 200
80 3300050515 nmdc:mga0a205_2675_c1 nmdc:mga0a205_2675_c1_9187_9804 200
81 3300005471 Ga0070698_100000323 Ga0070698_10000032336 201
82 3300005518 Ga0070699_100057431 Ga0070699_1000574312 201
83 3300025910 Ga0207684_10167860 Ga0207684_101678602 201
84 3300025922 Ga0207646_10408985 Ga0207646_104089852 201
85 3300005616 Ga0068852_100042400 Ga0068852_1000424004 202
86 3300026142 Ga0207698_10013035 Ga0207698_100130352 202
87 3300005329 Ga0070683_100353508 Ga0070683_1003535081 203
88 3300005445 Ga0070708_100015266 Ga0070708_1000152665 203
89 3300005535 Ga0070684_100014724 Ga0070684_1000147241 203
90 3300005577 Ga0068857_100031557 Ga0068857_1000315574 203
91 3300006871 Ga0075434_100229773 Ga0075434_1002297733 203
92 3300006871 Ga0075434_100805452 Ga0075434_1008054521 203
93 3300006914 Ga0075436_100027469 Ga0075436_1000274696 203
94 3300007076 Ga0075435_100223103 Ga0075435_1002231031 203
95 3300025944 Ga0207661_10017012 Ga0207661_100170123 203
96 3300026116 Ga0207674_10041616 Ga0207674_100416164 203
97 3300044712 Ga0453684_0000731 Ga0453684_0000731_113913_114554 203
98 3300050512 nmdc:mga0n895_477981_c1 nmdc:mga0n895_477981_c1_485_1120 203
99 3300050513 nmdc:mga0rr50_195237_c1 nmdc:mga0rr50_195237_c1_178_813 203
100 3300050514 nmdc:mga08x19_32550_c1 nmdc:mga08x19_32550_c1_1394_2029 203
101 3300005336 Ga0070680_100298083 Ga0070680_1002980833 205
102 3300005344 Ga0070661_100023255 Ga0070661_1000232553 205
103 3300005353 Ga0070669_100685869 Ga0070669_1006858691 205
104 3300005354 Ga0070675_100025943 Ga0070675_1000259434 205
105 3300005355 Ga0070671_100019452 Ga0070671_1000194527 205
106 3300005457 Ga0070662_100001538 Ga0070662_1000015383 205
107 3300005539 Ga0068853_100008601 Ga0068853_1000086017 205
108 3300005543 Ga0070672_100390974 Ga0070672_1003909743 205
109 3300005563 Ga0068855_100004182 Ga0068855_1000041826 205
110 3300005564 Ga0070664_100004590 Ga0070664_10000459010 205
111 3300005577 Ga0068857_100489721 Ga0068857_1004897211 205
112 3300005578 Ga0068854_100149797 Ga0068854_1001497972 205
113 3300005614 Ga0068856_100000746 Ga0068856_10000074637 205
114 3300010375 Ga0105239_10083766 Ga0105239_100837662 205
115 3300013102 Ga0157371_10001640 Ga0157371_1000164020 205
116 3300013105 Ga0157369_10101127 Ga0157369_101011274 205
117 3300013307 Ga0157372_10022097 Ga0157372_100220976 205
118 3300014745 Ga0157377_10079276 Ga0157377_100792763 205
119 3300025321 Ga0207656_10182026 Ga0207656_101820261 205
120 3300025903 Ga0207680_10113198 Ga0207680_101131983 205
121 3300025904 Ga0207647_10114834 Ga0207647_101148343 205
122 3300025907 Ga0207645_10074164 Ga0207645_100741643 205
123 3300025917 Ga0207660_10331696 Ga0207660_103316962 205
124 3300025919 Ga0207657_10000822 Ga0207657_1000082232 205
125 3300025923 Ga0207681_10050411 Ga0207681_100504113 205
126 3300025926 Ga0207659_10043994 Ga0207659_100439942 205
127 3300025931 Ga0207644_10029454 Ga0207644_100294545 205
128 3300025932 Ga0207690_10003125 Ga0207690_100031253 205
129 3300025933 Ga0207706_10000149 Ga0207706_1000014944 205
130 3300025940 Ga0207691_10347690 Ga0207691_103476903 205
131 3300025945 Ga0207679_10001327 Ga0207679_1000132713 205
132 3300025949 Ga0207667_10006496 Ga0207667_100064963 205
133 3300025960 Ga0207651_10449014 Ga0207651_104490142 205
134 3300026041 Ga0207639_10024964 Ga0207639_100249646 205
135 3300026078 Ga0207702_10004548 Ga0207702_1000454810 205
136 3300026116 Ga0207674_10361665 Ga0207674_103616651 205
137 3300046463 Ga0495653_0036849 Ga0495653_0036849_1310_1957 205
138 3300046477 Ga0495664_0002346 Ga0495664_0002346_2407_3054 205
139 3300046514 Ga0495618_0119650 Ga0495618_0119650_294_941 205
140 3300046516 Ga0495628_0003471 Ga0495628_0003471_1763_2410 205
141 3300046517 Ga0495630_0052317 Ga0495630_0052317_1593_2240 205
142 3300046529 Ga0495652_0029182 Ga0495652_0029182_3637_4284 205
143 3300046536 Ga0495587_0020349 Ga0495587_0020349_712_1359 205
144 3300046543 Ga0495645_0001365 Ga0495645_0001365_8741_9388 205
145 3300046559 Ga0495667_0007982 Ga0495667_0007982_5682_6329 205
146 3300046679 Ga0495623_0095622 Ga0495623_0095622_783_1430 205
147 3300046680 Ga0495646_0023115 Ga0495646_0023115_2671_3318 205
148 3300047315 Ga0495581_0110325 Ga0495581_0110325_413_1060 205
149 3300047317 Ga0495604_0065129 Ga0495604_0065129_1188_1835 205
150 3300047444 Ga0495675_0041558 Ga0495675_0041558_1347_1994 205
151 3300048088 Ga0495602_0081144 Ga0495602_0081144_738_1385 205
152 3300048904 Ga0496101_0042019 Ga0496101_0042019_2017_2667 205
153 3300048905 Ga0496102_0033765 Ga0496102_0033765_3862_4512 205
154 3300048906 Ga0496103_0021478 Ga0496103_0021478_1288_1938 205
155 3300048909 Ga0496106_0000594 Ga0496106_0000594_2452_3102 205
156 3300005539 Ga0068853_100273229 Ga0068853_1002732292 206
157 3300006852 Ga0075433_10001428 Ga0075433_1000142810 206
158 3300006871 Ga0075434_100006694 Ga0075434_1000066946 206
159 3300009177 Ga0105248_11232991 Ga0105248_112329911 206
160 3300013308 Ga0157375_10196151 Ga0157375_101961512 206
161 3300046454 Ga0495592_0069706 Ga0495592_0069706_1483_2133 206
162 3300046531 Ga0495665_0059308 Ga0495665_0059308_65_715 206
163 3300046642 Ga0495634_0022575 Ga0495634_0022575_1360_2010 206
164 3300046809 Ga0495600_0226586 Ga0495600_0226586_387_1037 206
165 3300047319 Ga0495674_0208014 Ga0495674_0208014_677_1327 206
166 3300050512 nmdc:mga0n895_17215_c1 nmdc:mga0n895_17215_c1_1793_2422 206
167 3300050515 nmdc:mga0a205_703_c1 nmdc:mga0a205_703_c1_5337_5966 206
168 3300005331 Ga0070670_100175474 Ga0070670_1001754742 207
169 3300005336 Ga0070680_100244584 Ga0070680_1002445842 207
170 3300005355 Ga0070671_100081351 Ga0070671_1000813513 207
171 3300005458 Ga0070681_10000369 Ga0070681_1000036920 207
172 3300005563 Ga0068855_100637389 Ga0068855_1006373892 207
173 3300005564 Ga0070664_100018767 Ga0070664_1000187673 207
174 3300007076 Ga0075435_100209916 Ga0075435_1002099162 207
175 3300009147 Ga0114129_10056482 Ga0114129_100564822 207
176 3300013100 Ga0157373_10534090 Ga0157373_105340901 207
177 3300025912 Ga0207707_10063388 Ga0207707_100633885 207
178 3300025915 Ga0207693_10319475 Ga0207693_103194753 207
179 3300025921 Ga0207652_10110055 Ga0207652_101100553 207
180 3300025925 Ga0207650_10108834 Ga0207650_101088342 207
181 3300025931 Ga0207644_10049797 Ga0207644_100497973 207
182 3300025945 Ga0207679_10149873 Ga0207679_101498732 207
183 3300025949 Ga0207667_10044932 Ga0207667_100449325 207
184 3300035083 Ga0373926_0011980 Ga0373926_0011980_1409_2077 207
185 3300035089 Ga0373944_0052303 Ga0373944_0052303_248_916 207
186 3300035170 Ga0373943_0022289 Ga0373943_0022289_966_1634 207
187 3300035171 Ga0373946_0047386 Ga0373946_0047386_798_1466 207
188 3300035724 Ga0373933_0165618 Ga0373933_0165618_227_895 207
189 3300046459 Ga0495629_0031236 Ga0495629_0031236_1898_2566 207
190 3300046472 Ga0495580_0121343 Ga0495580_0121343_445_1113 207
191 3300046473 Ga0495582_0005280 Ga0495582_0005280_3252_3920 207
192 3300046517 Ga0495630_0224340 Ga0495630_0224340_30_698 207
193 3300046531 Ga0495665_0045725 Ga0495665_0045725_65_733 207
194 3300046809 Ga0495600_0057031 Ga0495600_0057031_672_1340 207
195 3300047315 Ga0495581_0008739 Ga0495581_0008739_1594_2262 207
196 3300047471 Ga0495684_0008930 Ga0495684_0008930_2449_3117 207
197 3300050513 nmdc:mga0rr50_612671_c1 nmdc:mga0rr50_612671_c1_117_767 207
198 3300004800 Ga0058861_11501997 Ga0058861_115019971 208
199 3300004803 Ga0058862_12556473 Ga0058862_125564732 208
200 3300005328 Ga0070676_10223785 Ga0070676_102237851 208
201 3300005333 Ga0070677_10241492 Ga0070677_102414921 208
202 3300005336 Ga0070680_100024389 Ga0070680_1000243893 208
203 3300005338 Ga0068868_100015183 Ga0068868_1000151832 208
204 3300005343 Ga0070687_100041502 Ga0070687_1000415023 208
205 3300005353 Ga0070669_100898044 Ga0070669_1008980441 208
206 3300005364 Ga0070673_100149462 Ga0070673_1001494622 208
207 3300005365 Ga0070688_100033499 Ga0070688_1000334993 208
208 3300005367 Ga0070667_100013293 Ga0070667_1000132932 208
209 3300005434 Ga0070709_10113353 Ga0070709_101133532 208
210 3300005436 Ga0070713_100164247 Ga0070713_1001642472 208
211 3300005438 Ga0070701_10069412 Ga0070701_100694122 208
212 3300005439 Ga0070711_100064578 Ga0070711_1000645782 208
213 3300005456 Ga0070678_100467443 Ga0070678_1004674431 208
214 3300005458 Ga0070681_10000529 Ga0070681_100005297 208
215 3300005530 Ga0070679_100004795 Ga0070679_1000047955 208
216 3300005539 Ga0068853_100456834 Ga0068853_1004568342 208
217 3300005544 Ga0070686_100093528 Ga0070686_1000935281 208
218 3300005548 Ga0070665_100014155 Ga0070665_1000141555 208
219 3300005615 Ga0070702_100022724 Ga0070702_1000227242 208
220 3300005617 Ga0068859_100041705 Ga0068859_1000417054 208
221 3300005618 Ga0068864_100079009 Ga0068864_1000790092 208
222 3300005718 Ga0068866_10008881 Ga0068866_100088812 208
223 3300005719 Ga0068861_100103411 Ga0068861_1001034112 208
224 3300005841 Ga0068863_100006681 Ga0068863_10000668110 208
225 3300005842 Ga0068858_100005189 Ga0068858_1000051891 208
226 3300005842 Ga0068858_100242660 Ga0068858_1002426602 208
227 3300005843 Ga0068860_100006493 Ga0068860_1000064933 208
228 3300005937 Ga0081455_10103894 Ga0081455_101038942 208
229 3300005985 Ga0081539_10002497 Ga0081539_100024975 208
230 3300006163 Ga0070715_10018918 Ga0070715_100189183 208
231 3300006173 Ga0070716_100619399 Ga0070716_1006193991 208
232 3300006175 Ga0070712_100011660 Ga0070712_1000116605 208
233 3300006931 Ga0097620_100041704 Ga0097620_1000417044 208
234 3300009098 Ga0105245_10001936 Ga0105245_100019366 208
235 3300009176 Ga0105242_10024904 Ga0105242_100249042 208
236 3300010375 Ga0105239_10313296 Ga0105239_103132962 208
237 3300011119 Ga0105246_10288274 Ga0105246_102882742 208
238 3300013308 Ga0157375_10241389 Ga0157375_102413893 208
239 3300014325 Ga0163163_10306489 Ga0163163_103064892 208
240 3300014968 Ga0157379_10007952 Ga0157379_100079525 208
241 3300017792 Ga0163161_10178803 Ga0163161_101788032 208
242 3300025903 Ga0207680_10016790 Ga0207680_100167904 208
243 3300025905 Ga0207685_10091820 Ga0207685_100918202 208
244 3300025907 Ga0207645_10120299 Ga0207645_101202992 208
245 3300025912 Ga0207707_10015852 Ga0207707_100158525 208
246 3300025915 Ga0207693_10008601 Ga0207693_100086012 208
247 3300025916 Ga0207663_10050392 Ga0207663_100503922 208
248 3300025918 Ga0207662_10135270 Ga0207662_101352702 208
249 3300025921 Ga0207652_10001466 Ga0207652_100014665 208
250 3300025927 Ga0207687_10145112 Ga0207687_101451121 208
251 3300025928 Ga0207700_10075954 Ga0207700_100759543 208
252 3300025931 Ga0207644_10006054 Ga0207644_100060547 208
253 3300025934 Ga0207686_10020899 Ga0207686_100208992 208
254 3300025938 Ga0207704_10193240 Ga0207704_101932401 208
255 3300025939 Ga0207665_10042715 Ga0207665_100427153 208
256 3300025941 Ga0207711_10023846 Ga0207711_100238464 208
257 3300025942 Ga0207689_10052314 Ga0207689_100523143 208
258 3300025960 Ga0207651_10208485 Ga0207651_102084852 208
259 3300025986 Ga0207658_10024732 Ga0207658_100247321 208
260 3300026023 Ga0207677_10354753 Ga0207677_103547532 208
261 3300026035 Ga0207703_10002933 Ga0207703_100029334 208
262 3300026035 Ga0207703_10477686 Ga0207703_104776861 208
263 3300026041 Ga0207639_10412657 Ga0207639_104126571 208
264 3300026078 Ga0207702_10026028 Ga0207702_100260285 208
265 3300026089 Ga0207648_10131536 Ga0207648_101315364 208
266 3300026095 Ga0207676_10076370 Ga0207676_100763704 208
267 3300026142 Ga0207698_11188650 Ga0207698_111886501 208
268 3300028379 Ga0268266_10039645 Ga0268266_100396452 208
269 3300028381 Ga0268264_10005145 Ga0268264_100051458 208
270 3300031344 Ga0265316_10129589 Ga0265316_101295892 208
271 3300035113 Ga0373936_0024501 Ga0373936_0024501_441_1112 208
272 3300035116 Ga0373945_0272525 Ga0373945_0272525_22_693 208
273 3300035118 Ga0373954_0038675 Ga0373954_0038675_1383_2096 208
274 3300035170 Ga0373943_0025391 Ga0373943_0025391_1596_2267 208
275 3300035172 Ga0373955_0074867 Ga0373955_0074867_1019_1690 208
276 3300035410 Ga0373924_0164975 Ga0373924_0164975_207_878 208
277 3300035692 Ga0373935_0345126 Ga0373935_0345126_161_832 208
278 3300035695 Ga0373927_0072538 Ga0373927_0072538_1328_1999 208
279 3300035725 Ga0373947_0381052 Ga0373947_0381052_53_724 208
280 3300036401 Ga0373937_0064361 Ga0373937_0064361_752_1465 208
281 3300037068 Ga0373925_0530412 Ga0373925_0530412_193_864 208
282 3300046477 Ga0495664_0052772 Ga0495664_0052772_422_1093 208
283 3300046539 Ga0495621_0003699 Ga0495621_0003699_2557_3228 208
284 3300046543 Ga0495645_0239207 Ga0495645_0239207_88_759 208
285 3300047319 Ga0495674_0196365 Ga0495674_0196365_92_763 208
286 3300048908 Ga0496105_0139277 Ga0496105_0139277_1271_1984 208
287 3300048909 Ga0496106_0447851 Ga0496106_0447851_383_1018 208
288 3300048910 Ga0496107_0080576 Ga0496107_0080576_1405_2076 208
289 3300048912 Ga0496109_0078232 Ga0496109_0078232_1902_2615 208
290 3300048915 Ga0496112_0029636 Ga0496112_0029636_3337_4008 208
291 3300048916 Ga0496113_0438875 Ga0496113_0438875_394_1029 208
292 3300050513 nmdc:mga0rr50_204463_c1 nmdc:mga0rr50_204463_c1_416_1102 208
293 3300005339 Ga0070660_100348659 Ga0070660_1003486592 209
294 3300005364 Ga0070673_100033378 Ga0070673_1000333785 209
295 3300005437 Ga0070710_10206579 Ga0070710_102065792 209
296 3300005440 Ga0070705_100044107 Ga0070705_1000441071 209
297 3300005440 Ga0070705_100096826 Ga0070705_1000968263 209
298 3300005440 Ga0070705_100113745 Ga0070705_1001137453 209
299 3300005444 Ga0070694_100251751 Ga0070694_1002517512 209
300 3300005444 Ga0070694_100620408 Ga0070694_1006204081 209
301 3300005445 Ga0070708_100197721 Ga0070708_1001977212 209
302 3300005445 Ga0070708_100269799 Ga0070708_1002697992 209
303 3300005445 Ga0070708_100377133 Ga0070708_1003771332 209
304 3300005467 Ga0070706_100028375 Ga0070706_1000283755 209
305 3300005467 Ga0070706_100312701 Ga0070706_1003127011 209
306 3300005467 Ga0070706_100399985 Ga0070706_1003999852 209
307 3300005467 Ga0070706_100542796 Ga0070706_1005427962 209
308 3300005468 Ga0070707_100081916 Ga0070707_1000819163 209
309 3300005468 Ga0070707_100265296 Ga0070707_1002652962 209
310 3300005471 Ga0070698_100353969 Ga0070698_1003539692 209
311 3300005518 Ga0070699_100048540 Ga0070699_1000485404 209
312 3300005518 Ga0070699_100236245 Ga0070699_1002362453 209
313 3300005518 Ga0070699_100272002 Ga0070699_1002720022 209
314 3300005536 Ga0070697_100004928 Ga0070697_1000049288 209
315 3300005536 Ga0070697_100071735 Ga0070697_1000717353 209
316 3300005536 Ga0070697_100116643 Ga0070697_1001166432 209
317 3300005543 Ga0070672_100004570 Ga0070672_1000045705 209
318 3300005545 Ga0070695_100013292 Ga0070695_1000132923 209
319 3300005545 Ga0070695_100193374 Ga0070695_1001933741 209
320 3300005545 Ga0070695_100283874 Ga0070695_1002838742 209
321 3300005546 Ga0070696_100111288 Ga0070696_1001112883 209
322 3300005549 Ga0070704_100035376 Ga0070704_1000353763 209
323 3300005616 Ga0068852_100351796 Ga0068852_1003517963 209
324 3300006173 Ga0070716_100002954 Ga0070716_1000029544 209
325 3300006852 Ga0075433_10176973 Ga0075433_101769731 209
326 3300006871 Ga0075434_100082212 Ga0075434_1000822125 209
327 3300006914 Ga0075436_100151035 Ga0075436_1001510352 209
328 3300007076 Ga0075435_100024762 Ga0075435_1000247624 209
329 3300007265 Ga0099794_10074801 Ga0099794_100748012 209
330 3300009147 Ga0114129_10073909 Ga0114129_100739094 209
331 3300009147 Ga0114129_10539369 Ga0114129_105393692 209
332 3300009177 Ga0105248_10018972 Ga0105248_100189725 209
333 3300013306 Ga0163162_10359600 Ga0163162_103596003 209
334 3300025885 Ga0207653_10001975 Ga0207653_100019755 209
335 3300025910 Ga0207684_10035278 Ga0207684_100352784 209
336 3300025922 Ga0207646_10008872 Ga0207646_100088727 209
337 3300025922 Ga0207646_10014453 Ga0207646_100144535 209
338 3300025933 Ga0207706_10121035 Ga0207706_101210354 209
339 3300025939 Ga0207665_10006105 Ga0207665_100061054 209
340 3300025940 Ga0207691_10016655 Ga0207691_100166555 209
341 3300025941 Ga0207711_10003939 Ga0207711_100039399 209
342 3300025960 Ga0207651_10009783 Ga0207651_100097833 209
343 3300025981 Ga0207640_10642008 Ga0207640_106420081 209
344 3300026023 Ga0207677_10094764 Ga0207677_100947642 209
345 3300026118 Ga0207675_100254447 Ga0207675_1002544472 209
346 3300026142 Ga0207698_10065737 Ga0207698_100657374 209
347 3300027671 Ga0209588_1029312 Ga0209588_10293122 209
348 3300035086 Ga0373934_0004565 Ga0373934_0004565_4315_5004 209
349 3300035117 Ga0373953_0014289 Ga0373953_0014289_171_860 209
350 3300035118 Ga0373954_0005532 Ga0373954_0005532_4316_5005 209
351 3300035119 Ga0373956_0054026 Ga0373956_0054026_775_1464 209
352 3300035120 Ga0373957_0073592 Ga0373957_0073592_632_1321 209
353 3300035172 Ga0373955_0001011 Ga0373955_0001011_1085_1774 209
354 3300035724 Ga0373933_0091013 Ga0373933_0091013_291_980 209
355 3300036401 Ga0373937_0000482 Ga0373937_0000482_24669_25358 209
356 3300044694 Ga0466963_0239073 Ga0466963_0239073_342_1061 209
357 3300046516 Ga0495628_0023357 Ga0495628_0023357_1582_2271 209
358 3300046536 Ga0495587_0001820 Ga0495587_0001820_7658_8347 209
359 3300046543 Ga0495645_0005102 Ga0495645_0005102_392_1081 209
360 3300046678 Ga0495599_0008294 Ga0495599_0008294_3980_4669 209
361 3300046679 Ga0495623_0001793 Ga0495623_0001793_2316_3005 209
362 3300046809 Ga0495600_0089777 Ga0495600_0089777_1275_1964 209
363 3300047319 Ga0495674_0302080 Ga0495674_0302080_578_1267 209
364 3300050507 nmdc:mga05p37_4918_c1 nmdc:mga05p37_4918_c1_13934_14572 209
365 3300050512 nmdc:mga0n895_1485_c1 nmdc:mga0n895_1485_c1_1354_1992 209
366 3300050514 nmdc:mga08x19_62655_c1 nmdc:mga08x19_62655_c1_855_1493 209
367 3300050515 nmdc:mga0a205_30477_c1 nmdc:mga0a205_30477_c1_1768_2406 209
368 3300050515 nmdc:mga0a205_76598_c1 nmdc:mga0a205_76598_c1_2414_3052 209
369 3300053084 Ga0495595_0140519 Ga0495595_0140519_281_970 209
370 3300053085 Ga0495619_0175522 Ga0495619_0175522_653_1342 209
371 3300004799 Ga0058863_10030652 Ga0058863_100306521 210
372 3300005327 Ga0070658_10037172 Ga0070658_100371724 210
373 3300005329 Ga0070683_100030700 Ga0070683_1000307004 210
374 3300005336 Ga0070680_100116697 Ga0070680_1001166973 210
375 3300005338 Ga0068868_100015658 Ga0068868_1000156585 210
376 3300005339 Ga0070660_100049827 Ga0070660_1000498273 210
377 3300005339 Ga0070660_100072589 Ga0070660_1000725892 210
378 3300005339 Ga0070660_100114882 Ga0070660_1001148823 210
379 3300005344 Ga0070661_100036184 Ga0070661_1000361845 210
380 3300005344 Ga0070661_100073424 Ga0070661_1000734243 210
381 3300005344 Ga0070661_100669487 Ga0070661_1006694871 210
382 3300005355 Ga0070671_100352781 Ga0070671_1003527812 210
383 3300005366 Ga0070659_100010910 Ga0070659_1000109104 210
384 3300005366 Ga0070659_100306700 Ga0070659_1003067002 210
385 3300005366 Ga0070659_100367333 Ga0070659_1003673332 210
386 3300005435 Ga0070714_100111535 Ga0070714_1001115353 210
387 3300005435 Ga0070714_100131528 Ga0070714_1001315283 210
388 3300005435 Ga0070714_100721811 Ga0070714_1007218112 210
389 3300005435 Ga0070714_100904194 Ga0070714_1009041941 210
390 3300005436 Ga0070713_100011865 Ga0070713_1000118653 210
391 3300005437 Ga0070710_10011234 Ga0070710_100112345 210
392 3300005437 Ga0070710_10406989 Ga0070710_104069892 210
393 3300005455 Ga0070663_100002315 Ga0070663_1000023157 210
394 3300005458 Ga0070681_10218553 Ga0070681_102185533 210
395 3300005458 Ga0070681_10327832 Ga0070681_103278323 210
396 3300005458 Ga0070681_10425986 Ga0070681_104259861 210
397 3300005471 Ga0070698_100050008 Ga0070698_1000500082 210
398 3300005518 Ga0070699_100011648 Ga0070699_1000116484 210
399 3300005530 Ga0070679_100136399 Ga0070679_1001363992 210
400 3300005530 Ga0070679_100151378 Ga0070679_1001513781 210
401 3300005535 Ga0070684_100437168 Ga0070684_1004371682 210
402 3300005536 Ga0070697_100012227 Ga0070697_1000122273 210
403 3300005539 Ga0068853_100208310 Ga0068853_1002083103 210
404 3300005546 Ga0070696_100004798 Ga0070696_1000047987 210
405 3300005547 Ga0070693_100106100 Ga0070693_1001061003 210
406 3300005563 Ga0068855_100067253 Ga0068855_1000672534 210
407 3300005563 Ga0068855_100181425 Ga0068855_1001814252 210
408 3300005564 Ga0070664_100046974 Ga0070664_1000469744 210
409 3300005564 Ga0070664_100177382 Ga0070664_1001773822 210
410 3300005564 Ga0070664_100181758 Ga0070664_1001817582 210
411 3300005577 Ga0068857_100158429 Ga0068857_1001584293 210
412 3300005578 Ga0068854_100004663 Ga0068854_1000046636 210
413 3300005616 Ga0068852_100528138 Ga0068852_1005281381 210
414 3300005834 Ga0068851_10000378 Ga0068851_1000037813 210
415 3300009093 Ga0105240_10110290 Ga0105240_101102904 210
416 3300009093 Ga0105240_10146627 Ga0105240_101466273 210
417 3300009094 Ga0111539_10458338 Ga0111539_104583382 210
418 3300009098 Ga0105245_10036167 Ga0105245_100361676 210
419 3300009147 Ga0114129_10172869 Ga0114129_101728692 210
420 3300009174 Ga0105241_10004933 Ga0105241_100049339 210
421 3300009177 Ga0105248_10185036 Ga0105248_101850362 210
422 3300009545 Ga0105237_10110340 Ga0105237_101103404 210
423 3300009545 Ga0105237_10148527 Ga0105237_101485274 210
424 3300010375 Ga0105239_10304810 Ga0105239_103048102 210
425 3300010375 Ga0105239_10772561 Ga0105239_107725611 210
426 3300013102 Ga0157371_10017865 Ga0157371_100178654 210
427 3300013104 Ga0157370_10064853 Ga0157370_100648534 210
428 3300013104 Ga0157370_10079226 Ga0157370_100792263 210
429 3300013104 Ga0157370_10092454 Ga0157370_100924542 210
430 3300013104 Ga0157370_10478885 Ga0157370_104788852 210
431 3300013105 Ga0157369_10065902 Ga0157369_100659022 210
432 3300013105 Ga0157369_10204494 Ga0157369_102044942 210
433 3300013105 Ga0157369_10395910 Ga0157369_103959102 210
434 3300013307 Ga0157372_10324179 Ga0157372_103241792 210
435 3300013307 Ga0157372_10345829 Ga0157372_103458293 210
436 3300013307 Ga0157372_10643758 Ga0157372_106437582 210
437 3300020069 Ga0197907_10337531 Ga0197907_103375312 210
438 3300020070 Ga0206356_10778933 Ga0206356_107789332 210
439 3300020078 Ga0206352_11168908 Ga0206352_111689081 210
440 3300020081 Ga0206354_10881869 Ga0206354_108818692 210
441 3300022467 Ga0224712_10064201 Ga0224712_100642011 210
442 3300025898 Ga0207692_10266269 Ga0207692_102662691 210
443 3300025911 Ga0207654_10382805 Ga0207654_103828052 210
444 3300025912 Ga0207707_10007482 Ga0207707_100074827 210
445 3300025912 Ga0207707_10115907 Ga0207707_101159073 210
446 3300025912 Ga0207707_10326199 Ga0207707_103261992 210
447 3300025913 Ga0207695_10161595 Ga0207695_101615953 210
448 3300025914 Ga0207671_10067607 Ga0207671_100676074 210
449 3300025915 Ga0207693_10377422 Ga0207693_103774221 210
450 3300025917 Ga0207660_10099067 Ga0207660_100990672 210
451 3300025919 Ga0207657_10000888 Ga0207657_1000088816 210
452 3300025919 Ga0207657_10011195 Ga0207657_100111954 210
453 3300025919 Ga0207657_10223816 Ga0207657_102238162 210
454 3300025920 Ga0207649_10042751 Ga0207649_100427512 210
455 3300025920 Ga0207649_10387396 Ga0207649_103873961 210
456 3300025921 Ga0207652_10036631 Ga0207652_100366314 210
457 3300025924 Ga0207694_10073613 Ga0207694_100736132 210
458 3300025927 Ga0207687_10013132 Ga0207687_100131329 210
459 3300025929 Ga0207664_10007052 Ga0207664_100070526 210
460 3300025929 Ga0207664_10018391 Ga0207664_100183915 210
461 3300025929 Ga0207664_10036084 Ga0207664_100360843 210
462 3300025929 Ga0207664_10275527 Ga0207664_102755271 210
463 3300025932 Ga0207690_10102417 Ga0207690_101024172 210
464 3300025941 Ga0207711_10456627 Ga0207711_104566272 210
465 3300025944 Ga0207661_10197400 Ga0207661_101974003 210
466 3300025944 Ga0207661_10363436 Ga0207661_103634362 210
467 3300025945 Ga0207679_10197720 Ga0207679_101977203 210
468 3300025949 Ga0207667_10001211 Ga0207667_1000121110 210
469 3300025949 Ga0207667_10039969 Ga0207667_100399693 210
470 3300025949 Ga0207667_10272046 Ga0207667_102720462 210
471 3300025949 Ga0207667_10701265 Ga0207667_107012652 210
472 3300025981 Ga0207640_10010335 Ga0207640_100103355 210
473 3300026023 Ga0207677_10042649 Ga0207677_100426493 210
474 3300026041 Ga0207639_10646556 Ga0207639_106465561 210
475 3300026067 Ga0207678_10003959 Ga0207678_100039599 210
476 3300026078 Ga0207702_10466720 Ga0207702_104667202 210
477 3300026116 Ga0207674_10000273 Ga0207674_1000027356 210
478 3300026116 Ga0207674_10047647 Ga0207674_100476473 210
479 3300026142 Ga0207698_10115869 Ga0207698_101158691 210
480 3300027360 Ga0209969_1008158 Ga0209969_10081582 210
481 3300027378 Ga0209981_1014564 Ga0209981_10145642 210
482 3300027395 Ga0209996_1024424 Ga0209996_10244241 210
483 3300027471 Ga0209995_1012936 Ga0209995_10129363 210
484 3300027543 Ga0209999_1022652 Ga0209999_10226522 210
485 3300027717 Ga0209998_10033150 Ga0209998_100331502 210
486 3300027876 Ga0209974_10000954 Ga0209974_100009545 210
487 3300031090 Ga0265760_10000006 Ga0265760_1000000677 210
488 3300031548 Ga0307408_100022815 Ga0307408_1000228155 210
489 3300031711 Ga0265314_10219914 Ga0265314_102199142 210
490 3300031731 Ga0307405_10270228 Ga0307405_102702281 210
491 3300031824 Ga0307413_10001534 Ga0307413_100015342 210
492 3300031852 Ga0307410_10001817 Ga0307410_1000181710 210
493 3300031901 Ga0307406_10043672 Ga0307406_100436722 210
494 3300031901 Ga0307406_10147341 Ga0307406_101473412 210
495 3300031903 Ga0307407_10005443 Ga0307407_100054436 210
496 3300031911 Ga0307412_10036348 Ga0307412_100363482 210
497 3300031995 Ga0307409_100121811 Ga0307409_1001218111 210
498 3300032002 Ga0307416_100199648 Ga0307416_1001996481 210
499 3300032004 Ga0307414_10381126 Ga0307414_103811262 210
500 3300032005 Ga0307411_10007322 Ga0307411_100073226 210
501 3300032126 Ga0307415_100189603 Ga0307415_1001896031 210
502 3300035170 Ga0373943_0055506 Ga0373943_0055506_1091_1732 210
503 3300035172 Ga0373955_0092373 Ga0373955_0092373_750_1391 210
504 3300035172 Ga0373955_0212073 Ga0373955_0212073_448_1101 210
505 3300035695 Ga0373927_0059099 Ga0373927_0059099_1729_2370 210
506 3300036401 Ga0373937_0164904 Ga0373937_0164904_839_1480 210
507 3300036401 Ga0373937_0289128 Ga0373937_0289128_301_942 210
508 3300041512 Ga0451853_3170273 Ga0451853_3170273_69_710 210
509 3300042532 Ga0450893_0018262 Ga0450893_0018262_529_1179 210
510 3300044694 Ga0466963_0271536 Ga0466963_0271536_452_1090 210
511 3300045976 Ga0466967_0404627 Ga0466967_0404627_606_1244 210
512 3300046683 Ga0495658_0382631 Ga0495658_0382631_73_714 210
513 3300050513 nmdc:mga0rr50_166138_c1 nmdc:mga0rr50_166138_c1_909_1580 210
514 3300059630 Ga0587128_008085 Ga0587128_008085_633_1265 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

80

234

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9649 32 185
3bqe-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (reduced form) 0.9626 33 185
5fa9-assembly1.cif.gz_A bifunctional methionine sulfoxide reductase ab (msrab) from treponema denticola 0.962 33 184
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9618 35 185
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.96 33 185
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9699 35 182 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9674 34 185 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9565 33 188 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9506 35 182 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9499 35 185 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A2E5ZMT9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9871 35 209 GO:0008113
GO:0036211
AF-A0A1E5T2G1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9866 33 209 GO:0008113
GO:0033744
GO:0036211
AF-A0A7Y7TQV5-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9862 34 209 GO:0008113
GO:0033743
GO:0036211
AF-A0A3B8RJY0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9857 36 209 GO:0008113
GO:0033744
GO:0036211
AF-A0A7Y3V4U1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9855 33 209 GO:0008113
GO:0036211

Feature Viewer

pLDDT pTM Quality
91.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map