F457778

General Info

Members Datasets Scaffolds Average Seq Length
514 186 514 85

Family's Representative Sequence

Representative Sequence 3300047447|Ga0495685_053707|Ga0495685_053707_715_1029
Length 104
Sequence MLDSFAAQLLLQRRHFKEWPMNVPEGWTLEEGGKALTRTLKFKDFSEAFGFLTRVALYAEKADHHPEFTSVWNRVDFRLTSHDAGGVTDRDLKLAQTINELAPH

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001189 3300001904 Bacteria 4778
2 JGI24736J21556_1007099 3300001904 Bacteria 1887
3 JGI24740J21852_10012406 3300001979 Bacteria 3212
4 JGI24740J21852_10022394 3300001979 Bacteria 2176
5 JGI24740J21852_10022788 3300001979 Bacteria 2149
6 JGI24740J21852_10143801 3300001979 Bacteria 593
7 JGI24739J22299_10049041 3300001989 Bacteria 1370
8 JGI24737J22298_10000636 3300001990 Bacteria 12348
9 JGI24737J22298_10046383 3300001990 Bacteria 1326
10 JGI24737J22298_10062487 3300001990 Unclassified 1119
11 JGI24737J22298_10266151 3300001990 Bacteria 507
12 JGI24735J21928_10223687 3300002067 Bacteria 547
13 JGI24738J21930_10004295 3300002075 Bacteria 3506
14 Ga0065715_10016748 3300005293 Bacteria 2307
15 Ga0070658_10051194 3300005327 Bacteria 3347
16 Ga0070658_10199822 3300005327 Bacteria 1686
17 Ga0070658_10308359 3300005327 Bacteria 1350
18 Ga0070658_10467783 3300005327 Bacteria 1087
19 Ga0070676_10193689 3300005328 Bacteria 1329
20 Ga0070683_100036349 3300005329 Bacteria 4507
21 Ga0070683_100067719 3300005329 Bacteria 3325
22 Ga0070683_102407826 3300005329 Bacteria 505
23 Ga0070690_100041648 3300005330 Unclassified 2908
24 Ga0070670_100051669 3300005331 Bacteria 3529
25 Ga0070670_100063582 3300005331 Bacteria 3167
26 Ga0070670_101873703 3300005331 Bacteria 552
27 Ga0070677_10079455 3300005333 Bacteria 1400
28 Ga0068869_100187315 3300005334 Bacteria 1625
29 Ga0070666_10106918 3300005335 Bacteria 1933
30 Ga0070666_10131331 3300005335 Bacteria 1740
31 Ga0070680_100026458 3300005336 Bacteria 4640
32 Ga0070680_100071469 3300005336 Bacteria 2851
33 Ga0070680_100080684 3300005336 Bacteria 2683
34 Ga0070680_100162935 3300005336 Bacteria 1874
35 Ga0070682_100020530 3300005337 Bacteria 3888
36 Ga0070682_100044956 3300005337 Bacteria 2736
37 Ga0068868_100111310 3300005338 Bacteria 2225
38 Ga0070660_100011671 3300005339 Bacteria 6254
39 Ga0070660_100028930 3300005339 Bacteria 4149
40 Ga0070660_100050134 3300005339 Bacteria 3211
41 Ga0070660_100062576 3300005339 Bacteria 2891
42 Ga0070660_100083565 3300005339 Bacteria 2508
43 Ga0070660_100116913 3300005339 Bacteria 2126
44 Ga0070660_100306875 3300005339 Bacteria 1302
45 Ga0070660_101163306 3300005339 Bacteria 654
46 Ga0070689_100132189 3300005340 Bacteria 2002
47 Ga0070661_100042947 3300005344 Bacteria 3301
48 Ga0070661_100088145 3300005344 Bacteria 2296
49 Ga0070661_100108180 3300005344 Bacteria 2074
50 Ga0070661_100119959 3300005344 Bacteria 1969
51 Ga0070661_100130438 3300005344 Bacteria 1887
52 Ga0070661_100204841 3300005344 Bacteria 1508
53 Ga0070661_100228390 3300005344 Bacteria 1430
54 Ga0070661_100379850 3300005344 Bacteria 1113
55 Ga0070661_100449030 3300005344 Bacteria 1026
56 Ga0070692_10129904 3300005345 Bacteria 1415
57 Ga0070668_100180167 3300005347 Bacteria 1725
58 Ga0070668_100238425 3300005347 Bacteria 1506
59 Ga0070668_100255538 3300005347 Bacteria 1456
60 Ga0070668_100915193 3300005347 Unclassified 784
61 Ga0070669_100044111 3300005353 Bacteria 3249
62 Ga0070669_100052547 3300005353 Bacteria 2982
63 Ga0070669_100554323 3300005353 Bacteria 959
64 Ga0070669_101027010 3300005353 Bacteria 708
65 Ga0070675_100149565 3300005354 Bacteria 2001
66 Ga0070671_100025495 3300005355 Bacteria 4852
67 Ga0070671_100054189 3300005355 Bacteria 3334
68 Ga0070671_100075610 3300005355 Bacteria 2814
69 Ga0070671_100096409 3300005355 Bacteria 2480
70 Ga0070671_101829295 3300005355 Bacteria 540
71 Ga0070674_100118013 3300005356 Bacteria 1960
72 Ga0070674_100467037 3300005356 Bacteria 1045
73 Ga0070674_100868340 3300005356 Bacteria 784
74 Ga0070673_100086124 3300005364 Bacteria 2559
75 Ga0070673_100427964 3300005364 Bacteria 1188
76 Ga0070673_100952242 3300005364 Bacteria 798
77 Ga0070673_101117000 3300005364 Bacteria 737
78 Ga0070673_101476939 3300005364 Unclassified 641
79 Ga0070673_101524091 3300005364 Bacteria 631
80 Ga0070659_100017184 3300005366 Bacteria 5438
81 Ga0070659_100045351 3300005366 Bacteria 3443
82 Ga0070659_100137647 3300005366 Bacteria 1986
83 Ga0070659_100226808 3300005366 Bacteria 1543
84 Ga0070659_100404073 3300005366 Bacteria 1153
85 Ga0070659_101881399 3300005366 Bacteria 536
86 Ga0070667_100006173 3300005367 Bacteria 9961
87 Ga0070667_100046959 3300005367 Bacteria 3633
88 Ga0070667_101053075 3300005367 Bacteria 760
89 Ga0070663_100017373 3300005455 Bacteria 4694
90 Ga0070663_100021677 3300005455 Bacteria 4278
91 Ga0070663_100032144 3300005455 Bacteria 3614
92 Ga0070663_100051901 3300005455 Bacteria 2923
93 Ga0070663_100271075 3300005455 Bacteria 1349
94 Ga0070663_100349009 3300005455 Unclassified 1198
95 Ga0070663_101042172 3300005455 Bacteria 713
96 Ga0070663_101229507 3300005455 Bacteria 659
97 Ga0070678_100057492 3300005456 Bacteria 2850
98 Ga0070678_100176052 3300005456 Bacteria 1747
99 Ga0070662_100010637 3300005457 Bacteria 6050
100 Ga0070662_100056965 3300005457 Bacteria 2838
101 Ga0070662_100248195 3300005457 Unclassified 1430
102 Ga0070662_100506132 3300005457 Bacteria 1008
103 Ga0070681_10087681 3300005458 Bacteria 3065
104 Ga0070681_10121410 3300005458 Bacteria 2547
105 Ga0070681_10772041 3300005458 Bacteria 878
106 Ga0070681_10965488 3300005458 Bacteria 771
107 Ga0070679_100291023 3300005530 Bacteria 1585
108 Ga0070679_100526097 3300005530 Bacteria 1126
109 Ga0070679_100977476 3300005530 Bacteria 790
110 Ga0070684_100025006 3300005535 Bacteria 5014
111 Ga0070684_100153624 3300005535 Bacteria 2086
112 Ga0070684_100384381 3300005535 Bacteria 1293
113 Ga0070684_100677362 3300005535 Bacteria 961
114 Ga0068853_100051542 3300005539 Bacteria 3542
115 Ga0068853_100054561 3300005539 Bacteria 3444
116 Ga0068853_100119979 3300005539 Bacteria 2344
117 Ga0068853_100260381 3300005539 Bacteria 1594
118 Ga0070672_100136073 3300005543 Bacteria 2024
119 Ga0070672_100893541 3300005543 Bacteria 784
120 Ga0070695_100376796 3300005545 Bacteria 1070
121 Ga0070696_100220094 3300005546 Bacteria 1424
122 Ga0070693_100013265 3300005547 Bacteria 4194
123 Ga0070665_100054307 3300005548 Bacteria 4018
124 Ga0070665_100207543 3300005548 Bacteria 1960
125 Ga0070665_100375089 3300005548 Bacteria 1430
126 Ga0070665_100500749 3300005548 Bacteria 1226
127 Ga0068855_100001613 3300005563 Bacteria 28302
128 Ga0068855_100009002 3300005563 Bacteria 12062
129 Ga0068855_100347496 3300005563 Bacteria 1634
130 Ga0068855_100439305 3300005563 Bacteria 1425
131 Ga0068855_100487202 3300005563 Bacteria 1341
132 Ga0070664_100008740 3300005564 Bacteria 8202
133 Ga0070664_100010024 3300005564 Bacteria 7679
134 Ga0070664_100033467 3300005564 Bacteria 4305
135 Ga0070664_100058212 3300005564 Bacteria 3286
136 Ga0070664_100117107 3300005564 Bacteria 2330
137 Ga0070664_100484404 3300005564 Bacteria 1139
138 Ga0068857_100120054 3300005577 Bacteria 2366
139 Ga0068857_100234638 3300005577 Bacteria 1678
140 Ga0068857_101384115 3300005577 Unclassified 684
141 Ga0068854_100016489 3300005578 Bacteria 4927
142 Ga0068854_100081220 3300005578 Bacteria 2394
143 Ga0068854_100204701 3300005578 Bacteria 1553
144 Ga0068854_100507190 3300005578 Bacteria 1017
145 Ga0068856_100008781 3300005614 Bacteria 9830
146 Ga0068856_100017430 3300005614 Bacteria 6959
147 Ga0068856_100055013 3300005614 Bacteria 3927
148 Ga0068856_100225513 3300005614 Bacteria 1889
149 Ga0068856_100423814 3300005614 Bacteria 1351
150 Ga0068856_101131860 3300005614 Bacteria 800
151 Ga0068852_100008341 3300005616 Bacteria 7630
152 Ga0068852_100014847 3300005616 Bacteria 6018
153 Ga0068852_100038343 3300005616 Bacteria 4026
154 Ga0068852_100040329 3300005616 Bacteria 3938
155 Ga0068852_100053095 3300005616 Bacteria 3487
156 Ga0068852_101043263 3300005616 Bacteria 837
157 Ga0068852_101822071 3300005616 Bacteria 631
158 Ga0068859_100134598 3300005617 Bacteria 2543
159 Ga0068859_100986682 3300005617 Bacteria 925
160 Ga0068864_100012818 3300005618 Bacteria 6932
161 Ga0068864_100230670 3300005618 Bacteria 1712
162 Ga0068864_100777707 3300005618 Bacteria 939
163 Ga0068864_100933821 3300005618 Bacteria 858
164 Ga0068851_10093487 3300005834 Unclassified 1586
165 Ga0068851_10249398 3300005834 Bacteria 1007
166 Ga0068851_10478621 3300005834 Bacteria 744
167 Ga0068863_100290562 3300005841 Bacteria 1585
168 Ga0068863_100753025 3300005841 Bacteria 970
169 Ga0068858_100103202 3300005842 Bacteria 2660
170 Ga0068858_100152572 3300005842 Bacteria 2172
171 Ga0068858_100899686 3300005842 Bacteria 865
172 Ga0068862_100083631 3300005844 Bacteria 2771
173 Ga0097621_101073576 3300006237 Bacteria 755
174 Ga0068871_100632921 3300006358 Bacteria 975
175 Ga0075428_100755243 3300006844 Bacteria 1035
176 Ga0075433_10214454 3300006852 Bacteria 1710
177 Ga0075434_100581083 3300006871 Bacteria 1139
178 Ga0068865_100297361 3300006881 Bacteria 1291
179 Ga0075436_100954096 3300006914 Bacteria 643
180 Ga0097620_100134607 3300006931 Bacteria 2543
181 Ga0097620_100986709 3300006931 Bacteria 925
182 Ga0105240_10051295 3300009093 Bacteria 5193
183 Ga0105240_10072531 3300009093 Bacteria 4255
184 Ga0105245_11282309 3300009098 Bacteria 781
185 Ga0105241_10028204 3300009174 Bacteria 4183
186 Ga0105241_10143674 3300009174 Bacteria 1946
187 Ga0105248_10000516 3300009177 Bacteria 43895
188 Ga0105248_10022750 3300009177 Bacteria 6955
189 Ga0105248_10023976 3300009177 Bacteria 6783
190 Ga0105248_10391156 3300009177 Bacteria 1565
191 Ga0105238_10089598 3300009551 Bacteria 3063
192 Ga0105238_10161081 3300009551 Bacteria 2219
193 Ga0105238_10937245 3300009551 Bacteria 885
194 Ga0105249_11430435 3300009553 Unclassified 763
195 Ga0105239_13172696 3300010375 Bacteria 535
196 Ga0105246_10183731 3300011119 Bacteria 1612
197 Ga0157373_10042381 3300013100 Unclassified 3253
198 Ga0157373_10062749 3300013100 Bacteria 2632
199 Ga0157373_10260089 3300013100 Bacteria 1228
200 Ga0157373_10615410 3300013100 Bacteria 791
201 Ga0157371_10017279 3300013102 Bacteria 5365
202 Ga0157371_10101165 3300013102 Bacteria 2045
203 Ga0157371_10117740 3300013102 Bacteria 1888
204 Ga0157371_10150906 3300013102 Bacteria 1657
205 Ga0157371_10161600 3300013102 Bacteria 1600
206 Ga0157371_10229530 3300013102 Bacteria 1334
207 Ga0157371_10407761 3300013102 Bacteria 995
208 Ga0157371_10954505 3300013102 Bacteria 652
209 Ga0157371_11060265 3300013102 Bacteria 620
210 Ga0157370_10056182 3300013104 Bacteria 3746
211 Ga0157370_10098929 3300013104 Bacteria 2734
212 Ga0157370_10224077 3300013104 Bacteria 1741
213 Ga0157370_10379558 3300013104 Bacteria 1302
214 Ga0157369_10000385 3300013105 Bacteria 58590
215 Ga0157369_10121134 3300013105 Bacteria 2776
216 Ga0157369_10206322 3300013105 Bacteria 2061
217 Ga0157369_10336086 3300013105 Bacteria 1569
218 Ga0157369_10422006 3300013105 Bacteria 1383
219 Ga0157369_10444864 3300013105 Bacteria 1342
220 Ga0157369_10675353 3300013105 Bacteria 1064
221 Ga0157374_10006752 3300013296 Bacteria 9754
222 Ga0157374_10096662 3300013296 Bacteria 2825
223 Ga0157374_10978382 3300013296 Bacteria 865
224 Ga0157378_10169374 3300013297 Bacteria 2047
225 Ga0163162_12251976 3300013306 Bacteria 626
226 Ga0157372_10338321 3300013307 Bacteria 1753
227 Ga0157372_10459393 3300013307 Bacteria 1484
228 Ga0157372_10673750 3300013307 Bacteria 1204
229 Ga0157372_10756211 3300013307 Bacteria 1130
230 Ga0157372_12902890 3300013307 Bacteria 549
231 Ga0157375_10337632 3300013308 Bacteria 1672
232 Ga0157375_10475933 3300013308 Bacteria 1414
233 Ga0157375_10597467 3300013308 Bacteria 1263
234 Ga0157375_10671341 3300013308 Bacteria 1191
235 Ga0163163_10013300 3300014325 Bacteria 7530
236 Ga0163163_10321634 3300014325 Bacteria 1601
237 Ga0157380_11543130 3300014326 Bacteria 718
238 Ga0157380_13238450 3300014326 Unclassified 520
239 Ga0157377_10023595 3300014745 Bacteria 3262
240 Ga0157379_10120624 3300014968 Unclassified 2358
241 Ga0224712_10612992 3300022467 Bacteria 532
242 Ga0207697_10197511 3300025315 Bacteria 884
243 Ga0207656_10139602 3300025321 Bacteria 1141
244 Ga0207682_10184742 3300025893 Bacteria 953
245 Ga0207710_10046389 3300025900 Bacteria 1940
246 Ga0207688_10020909 3300025901 Bacteria 3572
247 Ga0207680_10578051 3300025903 Bacteria 803
248 Ga0207647_10007590 3300025904 Bacteria 7816
249 Ga0207647_10033358 3300025904 Bacteria 3297
250 Ga0207647_10068892 3300025904 Bacteria 2140
251 Ga0207705_10000059 3300025909 Bacteria 155683
252 Ga0207705_10001692 3300025909 Bacteria 17538
253 Ga0207705_10031663 3300025909 Bacteria 3776
254 Ga0207705_10082959 3300025909 Bacteria 2338
255 Ga0207705_10494066 3300025909 Bacteria 950
256 Ga0207705_10641590 3300025909 Bacteria 826
257 Ga0207654_10909050 3300025911 Bacteria 638
258 Ga0207707_10090918 3300025912 Bacteria 2667
259 Ga0207707_10152410 3300025912 Bacteria 2021
260 Ga0207707_10221095 3300025912 Bacteria 1648
261 Ga0207707_10252336 3300025912 Bacteria 1532
262 Ga0207695_10006706 3300025913 Bacteria 14858
263 Ga0207695_10126505 3300025913 Bacteria 2517
264 Ga0207695_10213824 3300025913 Bacteria 1838
265 Ga0207660_10028730 3300025917 Bacteria 3807
266 Ga0207660_10605796 3300025917 Bacteria 892
267 Ga0207660_11493349 3300025917 Bacteria 546
268 Ga0207657_10011122 3300025919 Bacteria 8946
269 Ga0207657_10059003 3300025919 Bacteria 3300
270 Ga0207657_10096242 3300025919 Bacteria 2463
271 Ga0207657_10107785 3300025919 Bacteria 2304
272 Ga0207657_10193174 3300025919 Bacteria 1641
273 Ga0207657_10845809 3300025919 Bacteria 706
274 Ga0207649_10010690 3300025920 Bacteria 5046
275 Ga0207649_10014810 3300025920 Bacteria 4374
276 Ga0207649_10092605 3300025920 Bacteria 1982
277 Ga0207649_10133589 3300025920 Bacteria 1689
278 Ga0207649_10136018 3300025920 Bacteria 1675
279 Ga0207649_10267266 3300025920 Bacteria 1238
280 Ga0207649_10344710 3300025920 Bacteria 1101
281 Ga0207649_10349169 3300025920 Bacteria 1094
282 Ga0207649_10361407 3300025920 Bacteria 1077
283 Ga0207652_10030193 3300025921 Bacteria 4536
284 Ga0207652_10033611 3300025921 Bacteria 4319
285 Ga0207652_10066916 3300025921 Bacteria 3115
286 Ga0207652_10424067 3300025921 Bacteria 1200
287 Ga0207652_11515356 3300025921 Bacteria 575
288 Ga0207681_10042703 3300025923 Bacteria 3030
289 Ga0207681_10705017 3300025923 Bacteria 839
290 Ga0207694_10167385 3300025924 Bacteria 1778
291 Ga0207694_10590959 3300025924 Bacteria 933
292 Ga0207650_10004442 3300025925 Bacteria 9580
293 Ga0207650_10123768 3300025925 Bacteria 2016
294 Ga0207659_10035674 3300025926 Bacteria 3440
295 Ga0207687_10104607 3300025927 Bacteria 2090
296 Ga0207644_10002867 3300025931 Bacteria 11114
297 Ga0207644_10111928 3300025931 Bacteria 2065
298 Ga0207644_11139928 3300025931 Bacteria 655
299 Ga0207690_10002543 3300025932 Bacteria 11026
300 Ga0207690_10003550 3300025932 Bacteria 9290
301 Ga0207690_10064763 3300025932 Bacteria 2497
302 Ga0207690_10113515 3300025932 Bacteria 1955
303 Ga0207690_10331788 3300025932 Bacteria 1198
304 Ga0207706_10026411 3300025933 Bacteria 5198
305 Ga0207706_10044853 3300025933 Bacteria 3917
306 Ga0207706_10051085 3300025933 Bacteria 3652
307 Ga0207706_10083283 3300025933 Bacteria 2812
308 Ga0207669_10236914 3300025937 Bacteria 1350
309 Ga0207669_10258203 3300025937 Bacteria 1302
310 Ga0207704_10252222 3300025938 Bacteria 1325
311 Ga0207691_10029081 3300025940 Bacteria 5169
312 Ga0207711_10264122 3300025941 Bacteria 1583
313 Ga0207689_10099503 3300025942 Bacteria 2389
314 Ga0207661_10072094 3300025944 Bacteria 2825
315 Ga0207661_10652534 3300025944 Bacteria 967
316 Ga0207679_10005285 3300025945 Bacteria 8098
317 Ga0207679_10007146 3300025945 Bacteria 7071
318 Ga0207679_10079136 3300025945 Bacteria 2506
319 Ga0207679_10446427 3300025945 Bacteria 1146
320 Ga0207667_10041974 3300025949 Bacteria 4864
321 Ga0207667_10070757 3300025949 Bacteria 3630
322 Ga0207667_10140403 3300025949 Bacteria 2487
323 Ga0207667_10206811 3300025949 Bacteria 2012
324 Ga0207667_10222811 3300025949 Bacteria 1932
325 Ga0207667_11441611 3300025949 Unclassified 661
326 Ga0207651_10123114 3300025960 Bacteria 1971
327 Ga0207651_10199802 3300025960 Bacteria 1601
328 Ga0207651_10710513 3300025960 Bacteria 886
329 Ga0207668_10510240 3300025972 Bacteria 1036
330 Ga0207668_10637317 3300025972 Bacteria 932
331 Ga0207668_11212660 3300025972 Bacteria 678
332 Ga0207640_10000423 3300025981 Bacteria 26221
333 Ga0207640_10029533 3300025981 Bacteria 3366
334 Ga0207640_10507684 3300025981 Bacteria 1005
335 Ga0207640_10533171 3300025981 Bacteria 983
336 Ga0207640_10731836 3300025981 Bacteria 851
337 Ga0207677_10170187 3300026023 Bacteria 1702
338 Ga0207703_10022556 3300026035 Bacteria 4939
339 Ga0207703_10208459 3300026035 Bacteria 1741
340 Ga0207703_11720929 3300026035 Unclassified 603
341 Ga0207639_10526302 3300026041 Bacteria 1083
342 Ga0207639_10608444 3300026041 Bacteria 1008
343 Ga0207639_11461043 3300026041 Bacteria 642
344 Ga0207678_10077304 3300026067 Bacteria 2851
345 Ga0207678_10078016 3300026067 Bacteria 2837
346 Ga0207678_10141268 3300026067 Bacteria 2055
347 Ga0207678_10159084 3300026067 Bacteria 1929
348 Ga0207678_10174518 3300026067 Bacteria 1835
349 Ga0207678_10630307 3300026067 Bacteria 941
350 Ga0207678_12018848 3300026067 Bacteria 502
351 Ga0207702_10147410 3300026078 Bacteria 2137
352 Ga0207702_10153119 3300026078 Bacteria 2099
353 Ga0207702_10239259 3300026078 Bacteria 1700
354 Ga0207702_10273514 3300026078 Bacteria 1594
355 Ga0207702_10469899 3300026078 Bacteria 1223
356 Ga0207641_10828147 3300026088 Bacteria 916
357 Ga0207641_11683927 3300026088 Bacteria 636
358 Ga0207676_10007170 3300026095 Bacteria 7890
359 Ga0207676_10183333 3300026095 Bacteria 1835
360 Ga0207676_10868795 3300026095 Bacteria 883
361 Ga0207674_11044377 3300026116 Bacteria 786
362 Ga0207674_11163145 3300026116 Bacteria 741
363 Ga0207683_10095648 3300026121 Bacteria 2648
364 Ga0207683_10155005 3300026121 Bacteria 2069
365 Ga0207698_10005828 3300026142 Bacteria 7652
366 Ga0207698_10025187 3300026142 Bacteria 4186
367 Ga0207698_10040747 3300026142 Bacteria 3455
368 Ga0207698_10361896 3300026142 Bacteria 1374
369 Ga0207698_10508149 3300026142 Bacteria 1174
370 Ga0207698_11045724 3300026142 Bacteria 828
371 Ga0268266_10263002 3300028379 Bacteria 1599
372 Ga0268265_10024930 3300028380 Bacteria 4239
373 Ga0268265_10132271 3300028380 Bacteria 2075
374 Ga0307408_100083965 3300031548 Bacteria 2387
375 Ga0307408_101704811 3300031548 Bacteria 600
376 Ga0307405_10188573 3300031731 Bacteria 1487
377 Ga0307405_10582443 3300031731 Bacteria 910
378 Ga0307413_10107170 3300031824 Bacteria 1861
379 Ga0307413_10277850 3300031824 Bacteria 1258
380 Ga0307413_10765204 3300031824 Bacteria 808
381 Ga0307413_11005242 3300031824 Bacteria 715
382 Ga0307410_10105133 3300031852 Bacteria 2031
383 Ga0307410_10143338 3300031852 Bacteria 1770
384 Ga0307410_10231216 3300031852 Bacteria 1428
385 Ga0307410_10946133 3300031852 Bacteria 740
386 Ga0307410_10957226 3300031852 Bacteria 736
387 Ga0307410_11481331 3300031852 Bacteria 597
388 Ga0307406_10178290 3300031901 Bacteria 1544
389 Ga0307406_10190050 3300031901 Bacteria 1502
390 Ga0307406_10332051 3300031901 Bacteria 1181
391 Ga0307406_11849860 3300031901 Bacteria 537
392 Ga0307407_10055358 3300031903 Bacteria 2291
393 Ga0307407_10283392 3300031903 Bacteria 1149
394 Ga0307407_10889499 3300031903 Bacteria 683
395 Ga0307412_10095657 3300031911 Bacteria 2088
396 Ga0307412_11236098 3300031911 Bacteria 670
397 Ga0307409_100329059 3300031995 Bacteria 1433
398 Ga0307409_100760455 3300031995 Bacteria 973
399 Ga0307409_102690138 3300031995 Bacteria 526
400 Ga0307416_100006793 3300032002 Bacteria 7195
401 Ga0307416_100163898 3300032002 Bacteria 2059
402 Ga0307416_101121292 3300032002 Bacteria 891
403 Ga0307414_10249054 3300032004 Bacteria 1475
404 Ga0307414_10349049 3300032004 Bacteria 1269
405 Ga0307414_10504874 3300032004 Bacteria 1071
406 Ga0307414_11220797 3300032004 Bacteria 696
407 Ga0307414_11221344 3300032004 Bacteria 696
408 Ga0307414_11530125 3300032004 Unclassified 621
409 Ga0307411_10066627 3300032005 Bacteria 2420
410 Ga0307411_10127528 3300032005 Bacteria 1853
411 Ga0307411_10409217 3300032005 Bacteria 1123
412 Ga0307411_10433199 3300032005 Bacteria 1095
413 Ga0307411_11119575 3300032005 Unclassified 710
414 Ga0307415_100025803 3300032126 Bacteria 3696
415 Ga0307415_100104498 3300032126 Bacteria 2086
416 Ga0307415_100917498 3300032126 Bacteria 808
417 Ga0307415_100942575 3300032126 Bacteria 798
418 Ga0395899_0010253 3300037312 Bacteria 7182
419 Ga0395899_0114827 3300037312 Bacteria 1933
420 Ga0395899_0279962 3300037312 Unclassified 1135
421 Ga0395899_0556327 3300037312 Bacteria 736
422 Ga0395899_0665464 3300037312 Bacteria 656
423 Ga0395900_0000564 3300037418 Bacteria 51387
424 Ga0395900_0029417 3300037418 Bacteria 5635
425 Ga0395900_0050105 3300037418 Bacteria 4301
426 Ga0395900_0067290 3300037418 Bacteria 3680
427 Ga0395900_0067719 3300037418 Bacteria 3668
428 Ga0395900_0368632 3300037418 Bacteria 1406
429 Ga0395900_0558540 3300037418 Bacteria 1088
430 Ga0395900_1440407 3300037418 Bacteria 601
431 Ga0395900_1839064 3300037418 Bacteria 516
432 Ga0395898_0000941 3300037466 Bacteria 46344
433 Ga0395898_0016800 3300037466 Bacteria 7478
434 Ga0395898_0072812 3300037466 Bacteria 3319
435 Ga0395898_0073073 3300037466 Bacteria 3312
436 Ga0395898_0137221 3300037466 Bacteria 2342
437 Ga0395898_0744749 3300037466 Bacteria 921
438 Ga0395905_0058580 3300037471 Bacteria 3601
439 Ga0395905_0080119 3300037471 Bacteria 3060
440 Ga0395905_0186530 3300037471 Bacteria 1946
441 Ga0395905_0260637 3300037471 Bacteria 1619
442 Ga0395905_0331824 3300037471 Bacteria 1412
443 Ga0395905_0347097 3300037471 Bacteria 1376
444 Ga0395905_0433038 3300037471 Bacteria 1212
445 Ga0395905_0518390 3300037471 Bacteria 1093
446 Ga0395905_0576331 3300037471 Bacteria 1027
447 Ga0395905_0752658 3300037471 Bacteria 877
448 Ga0395905_0866016 3300037471 Bacteria 806
449 Ga0395905_1014591 3300037471 Bacteria 733
450 Ga0395901_0042757 3300038443 Bacteria 4699
451 Ga0395901_0102263 3300038443 Bacteria 3007
452 Ga0395901_0108848 3300038443 Bacteria 2909
453 Ga0395901_0193763 3300038443 Bacteria 2131
454 Ga0395901_0195729 3300038443 Bacteria 2119
455 Ga0395901_1971563 3300038443 Bacteria 530
456 Ga0436365_0324202 3300039437 Bacteria 10090
457 Ga0436363_0070737 3300039450 Bacteria 1477
458 Ga0439439_0087781 3300041406 Bacteria 847
459 Ga0451853_0183747 3300041512 Bacteria 606
460 Ga0466972_0456354 3300044658 Bacteria 600
461 Ga0466965_0489557 3300044683 Bacteria 689
462 Ga0466965_0890606 3300044683 Bacteria 519
463 Ga0466966_0000052 3300044684 Bacteria 88472
464 Ga0466966_0471492 3300044684 Bacteria 755
465 Ga0466961_0328671 3300044693 Bacteria 932
466 Ga0466961_0496082 3300044693 Bacteria 737
467 Ga0466963_0054003 3300044694 Bacteria 2669
468 Ga0466963_0138958 3300044694 Bacteria 1682
469 Ga0466963_0141917 3300044694 Bacteria 1664
470 Ga0466964_0171144 3300044706 Bacteria 1023
471 Ga0466964_0254841 3300044706 Bacteria 867
472 Ga0466971_0071053 3300044719 Bacteria 1581
473 Ga0466957_0150528 3300044842 Bacteria 1505
474 Ga0466957_0325831 3300044842 Bacteria 1037
475 Ga0466960_0130821 3300044901 Bacteria 1324
476 Ga0466959_0560668 3300045049 Bacteria 770
477 Ga0466958_0105941 3300045836 Bacteria 1753
478 Ga0466967_0099604 3300045976 Bacteria 2655
479 Ga0466967_0576552 3300045976 Bacteria 1109
480 Ga0466967_0640599 3300045976 Bacteria 1050
481 Ga0495663_0138423 3300046525 Bacteria 825
482 Ga0495642_0041984 3300046528 Bacteria 1862
483 Ga0495598_0029692 3300046537 Bacteria 1526
484 Ga0495621_0000065 3300046539 Bacteria 20486
485 Ga0495621_0008845 3300046539 Bacteria 3034
486 Ga0495633_0024149 3300046558 Bacteria 3006
487 Ga0495668_0050159 3300046616 Bacteria 2313
488 Ga0495669_0026244 3300046684 Bacteria 2545
489 Ga0495669_0060341 3300046684 Bacteria 1714
490 Ga0495669_0076543 3300046684 Bacteria 1531
491 Ga0495669_0085879 3300046684 Bacteria 1448
492 Ga0495669_0156989 3300046684 Bacteria 1078
493 Ga0495670_0000467 3300046691 Bacteria 19301
494 Ga0495670_0368091 3300046691 Bacteria 774
495 Ga0495670_0650105 3300046691 Bacteria 575
496 Ga0495670_0749773 3300046691 Bacteria 532
497 Ga0495677_0016171 3300047445 Bacteria 2708
498 Ga0495677_0037561 3300047445 Bacteria 1769
499 Ga0495677_0067772 3300047445 Bacteria 1328
500 Ga0495677_0395191 3300047445 Bacteria 547
501 Ga0495685_053707 3300047447 Bacteria 1364
502 Ga0496100_1270292 3300048903 Bacteria 581
503 Ga0496101_0388103 3300048904 Bacteria 1099
504 Ga0496109_0304046 3300048912 Bacteria 1504
505 Ga0496110_0029386 3300048913 Bacteria 4730
506 Ga0496111_0044338 3300048914 Bacteria 3197
507 Ga0496112_0025925 3300048915 Bacteria 5634
508 Ga0496114_0030935 3300048917 Bacteria 4404
509 Ga0501225_0169792 3300049705 Bacteria 676
510 nmdc:mga0n895_858806_c1 3300050512 Bacteria 895
511 nmdc:mga0rr50_253428_c1 3300050513 Bacteria 1462
512 nmdc:mga08x19_159254_c1 3300050514 Bacteria 1532
513 nmdc:mga0a205_101691_c1 3300050515 Bacteria 2773
514 Ga0590075_131216 3300059424 Bacteria 658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_13238450 Ga0157380_132384501 82
2 3300025923 Ga0207681_10705017 Ga0207681_107050172 82
3 3300001979 JGI24740J21852_10143801 JGI24740J21852_101438012 83
4 3300001990 JGI24737J22298_10062487 JGI24737J22298_100624872 83
5 3300002067 JGI24735J21928_10223687 JGI24735J21928_102236871 83
6 3300002075 JGI24738J21930_10004295 JGI24738J21930_100042956 83
7 3300005327 Ga0070658_10051194 Ga0070658_100511941 83
8 3300005327 Ga0070658_10308359 Ga0070658_103083592 83
9 3300005329 Ga0070683_100036349 Ga0070683_1000363494 83
10 3300005329 Ga0070683_102407826 Ga0070683_1024078261 83
11 3300005330 Ga0070690_100041648 Ga0070690_1000416484 83
12 3300005331 Ga0070670_100051669 Ga0070670_1000516696 83
13 3300005335 Ga0070666_10131331 Ga0070666_101313312 83
14 3300005337 Ga0070682_100020530 Ga0070682_1000205302 83
15 3300005339 Ga0070660_100011671 Ga0070660_1000116714 83
16 3300005344 Ga0070661_100119959 Ga0070661_1001199592 83
17 3300005344 Ga0070661_100449030 Ga0070661_1004490303 83
18 3300005347 Ga0070668_100915193 Ga0070668_1009151932 83
19 3300005353 Ga0070669_100554323 Ga0070669_1005543231 83
20 3300005355 Ga0070671_100075610 Ga0070671_1000756104 83
21 3300005364 Ga0070673_100952242 Ga0070673_1009522421 83
22 3300005366 Ga0070659_100137647 Ga0070659_1001376472 83
23 3300005367 Ga0070667_100006173 Ga0070667_10000617311 83
24 3300005367 Ga0070667_100046959 Ga0070667_1000469595 83
25 3300005455 Ga0070663_100017373 Ga0070663_1000173734 83
26 3300005455 Ga0070663_101229507 Ga0070663_1012295072 83
27 3300005457 Ga0070662_100010637 Ga0070662_1000106374 83
28 3300005535 Ga0070684_100025006 Ga0070684_1000250065 83
29 3300005539 Ga0068853_100054561 Ga0068853_1000545616 83
30 3300005546 Ga0070696_100220094 Ga0070696_1002200943 83
31 3300005547 Ga0070693_100013265 Ga0070693_1000132656 83
32 3300005548 Ga0070665_100054307 Ga0070665_1000543076 83
33 3300005563 Ga0068855_100001613 Ga0068855_10000161324 83
34 3300005564 Ga0070664_100010024 Ga0070664_1000100246 83
35 3300005564 Ga0070664_100058212 Ga0070664_1000582122 83
36 3300005614 Ga0068856_100055013 Ga0068856_1000550136 83
37 3300005614 Ga0068856_101131860 Ga0068856_1011318602 83
38 3300005616 Ga0068852_100053095 Ga0068852_1000530956 83
39 3300005617 Ga0068859_100986682 Ga0068859_1009866822 83
40 3300005834 Ga0068851_10093487 Ga0068851_100934872 83
41 3300005842 Ga0068858_100103202 Ga0068858_1001032024 83
42 3300005844 Ga0068862_100083631 Ga0068862_1000836315 83
43 3300006358 Ga0068871_100632921 Ga0068871_1006329212 83
44 3300006931 Ga0097620_100986709 Ga0097620_1009867091 83
45 3300009174 Ga0105241_10028204 Ga0105241_100282043 83
46 3300009177 Ga0105248_10022750 Ga0105248_100227506 83
47 3300009177 Ga0105248_10391156 Ga0105248_103911562 83
48 3300009551 Ga0105238_10937245 Ga0105238_109372452 83
49 3300009553 Ga0105249_11430435 Ga0105249_114304352 83
50 3300013100 Ga0157373_10042381 Ga0157373_100423812 83
51 3300013102 Ga0157371_10017279 Ga0157371_100172793 83
52 3300013296 Ga0157374_10006752 Ga0157374_100067522 83
53 3300013296 Ga0157374_10096662 Ga0157374_100966622 83
54 3300013307 Ga0157372_10459393 Ga0157372_104593934 83
55 3300014325 Ga0163163_10013300 Ga0163163_100133001 83
56 3300014968 Ga0157379_10120624 Ga0157379_101206242 83
57 3300001990 JGI24737J22298_10266151 JGI24737J22298_102661511 84
58 3300005293 Ga0065715_10016748 Ga0065715_100167482 84
59 3300005334 Ga0068869_100187315 Ga0068869_1001873153 84
60 3300005336 Ga0070680_100071469 Ga0070680_1000714694 84
61 3300005336 Ga0070680_100080684 Ga0070680_1000806844 84
62 3300005336 Ga0070680_100162935 Ga0070680_1001629352 84
63 3300005338 Ga0068868_100111310 Ga0068868_1001113103 84
64 3300005339 Ga0070660_100083565 Ga0070660_1000835655 84
65 3300005339 Ga0070660_101163306 Ga0070660_1011633061 84
66 3300005340 Ga0070689_100132189 Ga0070689_1001321892 84
67 3300005344 Ga0070661_100204841 Ga0070661_1002048412 84
68 3300005344 Ga0070661_100228390 Ga0070661_1002283903 84
69 3300005347 Ga0070668_100180167 Ga0070668_1001801672 84
70 3300005353 Ga0070669_100044111 Ga0070669_1000441113 84
71 3300005355 Ga0070671_100025495 Ga0070671_1000254953 84
72 3300005355 Ga0070671_100054189 Ga0070671_1000541895 84
73 3300005356 Ga0070674_100467037 Ga0070674_1004670372 84
74 3300005364 Ga0070673_101117000 Ga0070673_1011170002 84
75 3300005364 Ga0070673_101476939 Ga0070673_1014769391 84
76 3300005364 Ga0070673_101524091 Ga0070673_1015240912 84
77 3300005366 Ga0070659_100226808 Ga0070659_1002268084 84
78 3300005366 Ga0070659_101881399 Ga0070659_1018813992 84
79 3300005367 Ga0070667_101053075 Ga0070667_1010530751 84
80 3300005455 Ga0070663_101042172 Ga0070663_1010421721 84
81 3300005456 Ga0070678_100057492 Ga0070678_1000574924 84
82 3300005458 Ga0070681_10121410 Ga0070681_101214104 84
83 3300005458 Ga0070681_10772041 Ga0070681_107720413 84
84 3300005458 Ga0070681_10965488 Ga0070681_109654882 84
85 3300005530 Ga0070679_100291023 Ga0070679_1002910232 84
86 3300005530 Ga0070679_100526097 Ga0070679_1005260972 84
87 3300005530 Ga0070679_100977476 Ga0070679_1009774762 84
88 3300005535 Ga0070684_100677362 Ga0070684_1006773622 84
89 3300005539 Ga0068853_100260381 Ga0068853_1002603813 84
90 3300005543 Ga0070672_100136073 Ga0070672_1001360732 84
91 3300005543 Ga0070672_100893541 Ga0070672_1008935412 84
92 3300005545 Ga0070695_100376796 Ga0070695_1003767962 84
93 3300005548 Ga0070665_100500749 Ga0070665_1005007492 84
94 3300005563 Ga0068855_100439305 Ga0068855_1004393051 84
95 3300005564 Ga0070664_100008740 Ga0070664_10000874011 84
96 3300005564 Ga0070664_100484404 Ga0070664_1004844042 84
97 3300005577 Ga0068857_100120054 Ga0068857_1001200543 84
98 3300005577 Ga0068857_100234638 Ga0068857_1002346382 84
99 3300005577 Ga0068857_101384115 Ga0068857_1013841152 84
100 3300005578 Ga0068854_100081220 Ga0068854_1000812201 84
101 3300005614 Ga0068856_100017430 Ga0068856_1000174302 84
102 3300005616 Ga0068852_100008341 Ga0068852_1000083412 84
103 3300005616 Ga0068852_100014847 Ga0068852_1000148473 84
104 3300005616 Ga0068852_101822071 Ga0068852_1018220712 84
105 3300005617 Ga0068859_100134598 Ga0068859_1001345982 84
106 3300005618 Ga0068864_100012818 Ga0068864_1000128187 84
107 3300005618 Ga0068864_100777707 Ga0068864_1007777072 84
108 3300005618 Ga0068864_100933821 Ga0068864_1009338212 84
109 3300005841 Ga0068863_100290562 Ga0068863_1002905622 84
110 3300005842 Ga0068858_100152572 Ga0068858_1001525723 84
111 3300005842 Ga0068858_100899686 Ga0068858_1008996862 84
112 3300006844 Ga0075428_100755243 Ga0075428_1007552431 84
113 3300006852 Ga0075433_10214454 Ga0075433_102144542 84
114 3300006871 Ga0075434_100581083 Ga0075434_1005810832 84
115 3300006881 Ga0068865_100297361 Ga0068865_1002973612 84
116 3300006914 Ga0075436_100954096 Ga0075436_1009540962 84
117 3300006931 Ga0097620_100134607 Ga0097620_1001346073 84
118 3300009093 Ga0105240_10051295 Ga0105240_100512952 84
119 3300009098 Ga0105245_11282309 Ga0105245_112823092 84
120 3300009177 Ga0105248_10000516 Ga0105248_1000051629 84
121 3300009551 Ga0105238_10161081 Ga0105238_101610815 84
122 3300011119 Ga0105246_10183731 Ga0105246_101837312 84
123 3300013100 Ga0157373_10062749 Ga0157373_100627495 84
124 3300013102 Ga0157371_10101165 Ga0157371_101011652 84
125 3300013102 Ga0157371_10117740 Ga0157371_101177402 84
126 3300013102 Ga0157371_10161600 Ga0157371_101616003 84
127 3300013102 Ga0157371_10407761 Ga0157371_104077612 84
128 3300013104 Ga0157370_10098929 Ga0157370_100989292 84
129 3300013104 Ga0157370_10224077 Ga0157370_102240771 84
130 3300013105 Ga0157369_10000385 Ga0157369_1000038548 84
131 3300013105 Ga0157369_10422006 Ga0157369_104220062 84
132 3300013105 Ga0157369_10444864 Ga0157369_104448643 84
133 3300013105 Ga0157369_10675353 Ga0157369_106753532 84
134 3300013296 Ga0157374_10978382 Ga0157374_109783822 84
135 3300013297 Ga0157378_10169374 Ga0157378_101693743 84
136 3300013306 Ga0163162_12251976 Ga0163162_122519762 84
137 3300013307 Ga0157372_10673750 Ga0157372_106737502 84
138 3300013307 Ga0157372_10756211 Ga0157372_107562112 84
139 3300013308 Ga0157375_10597467 Ga0157375_105974672 84
140 3300013308 Ga0157375_10671341 Ga0157375_106713412 84
141 3300014326 Ga0157380_11543130 Ga0157380_115431302 84
142 3300014745 Ga0157377_10023595 Ga0157377_100235953 84
143 3300025900 Ga0207710_10046389 Ga0207710_100463892 84
144 3300025901 Ga0207688_10020909 Ga0207688_100209092 84
145 3300025909 Ga0207705_10082959 Ga0207705_100829593 84
146 3300025912 Ga0207707_10090918 Ga0207707_100909182 84
147 3300025912 Ga0207707_10152410 Ga0207707_101524104 84
148 3300025913 Ga0207695_10126505 Ga0207695_101265052 84
149 3300025917 Ga0207660_10028730 Ga0207660_100287302 84
150 3300025917 Ga0207660_11493349 Ga0207660_114933491 84
151 3300025919 Ga0207657_10096242 Ga0207657_100962422 84
152 3300025919 Ga0207657_10845809 Ga0207657_108458092 84
153 3300025920 Ga0207649_10014810 Ga0207649_100148103 84
154 3300025920 Ga0207649_10133589 Ga0207649_101335892 84
155 3300025920 Ga0207649_10344710 Ga0207649_103447102 84
156 3300025921 Ga0207652_10033611 Ga0207652_100336115 84
157 3300025921 Ga0207652_10424067 Ga0207652_104240671 84
158 3300025921 Ga0207652_11515356 Ga0207652_115153562 84
159 3300025924 Ga0207694_10167385 Ga0207694_101673854 84
160 3300025925 Ga0207650_10004442 Ga0207650_100044425 84
161 3300025927 Ga0207687_10104607 Ga0207687_101046072 84
162 3300025931 Ga0207644_10002867 Ga0207644_100028676 84
163 3300025932 Ga0207690_10064763 Ga0207690_100647631 84
164 3300025933 Ga0207706_10051085 Ga0207706_100510856 84
165 3300025938 Ga0207704_10252222 Ga0207704_102522222 84
166 3300025940 Ga0207691_10029081 Ga0207691_100290812 84
167 3300025942 Ga0207689_10099503 Ga0207689_100995032 84
168 3300025945 Ga0207679_10005285 Ga0207679_100052852 84
169 3300025945 Ga0207679_10079136 Ga0207679_100791362 84
170 3300025949 Ga0207667_10070757 Ga0207667_100707572 84
171 3300025960 Ga0207651_10710513 Ga0207651_107105132 84
172 3300025972 Ga0207668_10637317 Ga0207668_106373172 84
173 3300025981 Ga0207640_10029533 Ga0207640_100295336 84
174 3300025981 Ga0207640_10533171 Ga0207640_105331712 84
175 3300026023 Ga0207677_10170187 Ga0207677_101701873 84
176 3300026035 Ga0207703_10022556 Ga0207703_100225564 84
177 3300026035 Ga0207703_10208459 Ga0207703_102084592 84
178 3300026035 Ga0207703_11720929 Ga0207703_117209291 84
179 3300026067 Ga0207678_12018848 Ga0207678_120188482 84
180 3300026078 Ga0207702_10273514 Ga0207702_102735142 84
181 3300026088 Ga0207641_10828147 Ga0207641_108281471 84
182 3300026095 Ga0207676_10007170 Ga0207676_1000717011 84
183 3300026095 Ga0207676_10868795 Ga0207676_108687952 84
184 3300026116 Ga0207674_11044377 Ga0207674_110443771 84
185 3300026121 Ga0207683_10095648 Ga0207683_100956482 84
186 3300026142 Ga0207698_10005828 Ga0207698_100058282 84
187 3300026142 Ga0207698_10025187 Ga0207698_100251873 84
188 3300028380 Ga0268265_10024930 Ga0268265_100249304 84
189 3300028380 Ga0268265_10132271 Ga0268265_101322712 84
190 3300031548 Ga0307408_100083965 Ga0307408_1000839653 84
191 3300031548 Ga0307408_101704811 Ga0307408_1017048112 84
192 3300031824 Ga0307413_10107170 Ga0307413_101071703 84
193 3300031852 Ga0307410_10105133 Ga0307410_101051333 84
194 3300031852 Ga0307410_10231216 Ga0307410_102312163 84
195 3300031852 Ga0307410_10957226 Ga0307410_109572261 84
196 3300031901 Ga0307406_10178290 Ga0307406_101782901 84
197 3300031903 Ga0307407_10055358 Ga0307407_100553582 84
198 3300031903 Ga0307407_10283392 Ga0307407_102833922 84
199 3300031911 Ga0307412_10095657 Ga0307412_100956574 84
200 3300031995 Ga0307409_100329059 Ga0307409_1003290592 84
201 3300031995 Ga0307409_100760455 Ga0307409_1007604552 84
202 3300032002 Ga0307416_101121292 Ga0307416_1011212922 84
203 3300032004 Ga0307414_10249054 Ga0307414_102490543 84
204 3300032004 Ga0307414_10504874 Ga0307414_105048742 84
205 3300032004 Ga0307414_11530125 Ga0307414_115301251 84
206 3300032005 Ga0307411_10409217 Ga0307411_104092172 84
207 3300032005 Ga0307411_10433199 Ga0307411_104331991 84
208 3300032005 Ga0307411_11119575 Ga0307411_111195752 84
209 3300032126 Ga0307415_100104498 Ga0307415_1001044981 84
210 3300037312 Ga0395899_0556327 Ga0395899_0556327_273_527 84
211 3300037312 Ga0395899_0665464 Ga0395899_0665464_307_561 84
212 3300037418 Ga0395900_0000564 Ga0395900_0000564_8070_8324 84
213 3300037418 Ga0395900_0067290 Ga0395900_0067290_2474_2728 84
214 3300037418 Ga0395900_1839064 Ga0395900_1839064_198_452 84
215 3300037466 Ga0395898_0072812 Ga0395898_0072812_829_1083 84
216 3300037466 Ga0395898_0744749 Ga0395898_0744749_540_794 84
217 3300037471 Ga0395905_0058580 Ga0395905_0058580_570_824 84
218 3300037471 Ga0395905_0186530 Ga0395905_0186530_981_1235 84
219 3300037471 Ga0395905_0331824 Ga0395905_0331824_300_554 84
220 3300037471 Ga0395905_0433038 Ga0395905_0433038_517_771 84
221 3300037471 Ga0395905_0518390 Ga0395905_0518390_343_597 84
222 3300037471 Ga0395905_0576331 Ga0395905_0576331_178_432 84
223 3300038443 Ga0395901_0193763 Ga0395901_0193763_744_998 84
224 3300038443 Ga0395901_1971563 Ga0395901_1971563_261_515 84
225 3300039437 Ga0436365_0324202 Ga0436365_0324202_1115_1369 84
226 3300039450 Ga0436363_0070737 Ga0436363_0070737_947_1201 84
227 3300044693 Ga0466961_0328671 Ga0466961_0328671_655_909 84
228 3300044694 Ga0466963_0054003 Ga0466963_0054003_1489_1743 84
229 3300044694 Ga0466963_0138958 Ga0466963_0138958_830_1084 84
230 3300044694 Ga0466963_0141917 Ga0466963_0141917_1027_1281 84
231 3300044706 Ga0466964_0171144 Ga0466964_0171144_752_1006 84
232 3300044706 Ga0466964_0254841 Ga0466964_0254841_500_754 84
233 3300044842 Ga0466957_0150528 Ga0466957_0150528_1123_1377 84
234 3300044842 Ga0466957_0325831 Ga0466957_0325831_150_404 84
235 3300045049 Ga0466959_0560668 Ga0466959_0560668_271_525 84
236 3300045976 Ga0466967_0099604 Ga0466967_0099604_284_538 84
237 3300045976 Ga0466967_0640599 Ga0466967_0640599_339_593 84
238 3300046528 Ga0495642_0041984 Ga0495642_0041984_1211_1465 84
239 3300046537 Ga0495598_0029692 Ga0495598_0029692_173_427 84
240 3300046539 Ga0495621_0000065 Ga0495621_0000065_16206_16460 84
241 3300046684 Ga0495669_0026244 Ga0495669_0026244_557_811 84
242 3300046684 Ga0495669_0076543 Ga0495669_0076543_272_526 84
243 3300046691 Ga0495670_0000467 Ga0495670_0000467_12970_13224 84
244 3300046691 Ga0495670_0650105 Ga0495670_0650105_38_292 84
245 3300047445 Ga0495677_0016171 Ga0495677_0016171_2208_2462 84
246 3300048903 Ga0496100_1270292 Ga0496100_1270292_216_470 84
247 3300048915 Ga0496112_0025925 Ga0496112_0025925_1204_1458 84
248 3300050512 nmdc:mga0n895_858806_c1 nmdc:mga0n895_858806_c1_572_826 84
249 3300050513 nmdc:mga0rr50_253428_c1 nmdc:mga0rr50_253428_c1_178_432 84
250 3300050514 nmdc:mga08x19_159254_c1 nmdc:mga08x19_159254_c1_877_1131 84
251 3300050515 nmdc:mga0a205_101691_c1 nmdc:mga0a205_101691_c1_1738_1992 84
252 3300001904 JGI24736J21556_1007099 JGI24736J21556_10070993 85
253 3300001979 JGI24740J21852_10012406 JGI24740J21852_100124063 85
254 3300001979 JGI24740J21852_10022394 JGI24740J21852_100223942 85
255 3300001990 JGI24737J22298_10000636 JGI24737J22298_1000063610 85
256 3300005328 Ga0070676_10193689 Ga0070676_101936892 85
257 3300005329 Ga0070683_100067719 Ga0070683_1000677194 85
258 3300005331 Ga0070670_100063582 Ga0070670_1000635824 85
259 3300005331 Ga0070670_101873703 Ga0070670_1018737032 85
260 3300005333 Ga0070677_10079455 Ga0070677_100794553 85
261 3300005335 Ga0070666_10106918 Ga0070666_101069183 85
262 3300005336 Ga0070680_100026458 Ga0070680_1000264583 85
263 3300005339 Ga0070660_100028930 Ga0070660_1000289305 85
264 3300005339 Ga0070660_100116913 Ga0070660_1001169133 85
265 3300005339 Ga0070660_100306875 Ga0070660_1003068752 85
266 3300005344 Ga0070661_100042947 Ga0070661_1000429473 85
267 3300005344 Ga0070661_100088145 Ga0070661_1000881454 85
268 3300005345 Ga0070692_10129904 Ga0070692_101299043 85
269 3300005347 Ga0070668_100238425 Ga0070668_1002384253 85
270 3300005347 Ga0070668_100255538 Ga0070668_1002555383 85
271 3300005353 Ga0070669_100052547 Ga0070669_1000525474 85
272 3300005354 Ga0070675_100149565 Ga0070675_1001495651 85
273 3300005355 Ga0070671_100096409 Ga0070671_1000964093 85
274 3300005355 Ga0070671_101829295 Ga0070671_1018292951 85
275 3300005356 Ga0070674_100118013 Ga0070674_1001180133 85
276 3300005356 Ga0070674_100868340 Ga0070674_1008683402 85
277 3300005364 Ga0070673_100086124 Ga0070673_1000861243 85
278 3300005364 Ga0070673_100427964 Ga0070673_1004279641 85
279 3300005366 Ga0070659_100017184 Ga0070659_1000171847 85
280 3300005366 Ga0070659_100045351 Ga0070659_1000453513 85
281 3300005455 Ga0070663_100032144 Ga0070663_1000321446 85
282 3300005455 Ga0070663_100349009 Ga0070663_1003490094 85
283 3300005456 Ga0070678_100176052 Ga0070678_1001760523 85
284 3300005457 Ga0070662_100248195 Ga0070662_1002481954 85
285 3300005457 Ga0070662_100506132 Ga0070662_1005061322 85
286 3300005458 Ga0070681_10087681 Ga0070681_100876812 85
287 3300005535 Ga0070684_100153624 Ga0070684_1001536243 85
288 3300005539 Ga0068853_100119979 Ga0068853_1001199792 85
289 3300005548 Ga0070665_100207543 Ga0070665_1002075433 85
290 3300005548 Ga0070665_100375089 Ga0070665_1003750891 85
291 3300005563 Ga0068855_100009002 Ga0068855_10000900211 85
292 3300005564 Ga0070664_100033467 Ga0070664_1000334672 85
293 3300005564 Ga0070664_100117107 Ga0070664_1001171074 85
294 3300005614 Ga0068856_100008781 Ga0068856_1000087811 85
295 3300005618 Ga0068864_100230670 Ga0068864_1002306703 85
296 3300005834 Ga0068851_10249398 Ga0068851_102493981 85
297 3300005834 Ga0068851_10478621 Ga0068851_104786211 85
298 3300005841 Ga0068863_100753025 Ga0068863_1007530253 85
299 3300006237 Ga0097621_101073576 Ga0097621_1010735762 85
300 3300009177 Ga0105248_10023976 Ga0105248_100239764 85
301 3300010375 Ga0105239_13172696 Ga0105239_131726962 85
302 3300013102 Ga0157371_11060265 Ga0157371_110602652 85
303 3300013104 Ga0157370_10056182 Ga0157370_100561826 85
304 3300013105 Ga0157369_10121134 Ga0157369_101211343 85
305 3300013307 Ga0157372_10338321 Ga0157372_103383212 85
306 3300013308 Ga0157375_10337632 Ga0157375_103376322 85
307 3300013308 Ga0157375_10475933 Ga0157375_104759333 85
308 3300014325 Ga0163163_10321634 Ga0163163_103216341 85
309 3300025315 Ga0207697_10197511 Ga0207697_101975113 85
310 3300025321 Ga0207656_10139602 Ga0207656_101396022 85
311 3300025893 Ga0207682_10184742 Ga0207682_101847422 85
312 3300025903 Ga0207680_10578051 Ga0207680_105780512 85
313 3300025904 Ga0207647_10007590 Ga0207647_100075906 85
314 3300025904 Ga0207647_10033358 Ga0207647_100333583 85
315 3300025909 Ga0207705_10031663 Ga0207705_100316635 85
316 3300025912 Ga0207707_10221095 Ga0207707_102210952 85
317 3300025917 Ga0207660_10605796 Ga0207660_106057963 85
318 3300025919 Ga0207657_10059003 Ga0207657_100590035 85
319 3300025919 Ga0207657_10107785 Ga0207657_101077852 85
320 3300025919 Ga0207657_10193174 Ga0207657_101931742 85
321 3300025920 Ga0207649_10136018 Ga0207649_101360182 85
322 3300025920 Ga0207649_10267266 Ga0207649_102672662 85
323 3300025920 Ga0207649_10349169 Ga0207649_103491693 85
324 3300025921 Ga0207652_10030193 Ga0207652_100301935 85
325 3300025923 Ga0207681_10042703 Ga0207681_100427033 85
326 3300025925 Ga0207650_10123768 Ga0207650_101237682 85
327 3300025926 Ga0207659_10035674 Ga0207659_100356743 85
328 3300025931 Ga0207644_10111928 Ga0207644_101119284 85
329 3300025931 Ga0207644_11139928 Ga0207644_111399281 85
330 3300025932 Ga0207690_10003550 Ga0207690_100035506 85
331 3300025932 Ga0207690_10331788 Ga0207690_103317882 85
332 3300025933 Ga0207706_10044853 Ga0207706_100448535 85
333 3300025933 Ga0207706_10083283 Ga0207706_100832832 85
334 3300025937 Ga0207669_10236914 Ga0207669_102369142 85
335 3300025937 Ga0207669_10258203 Ga0207669_102582032 85
336 3300025941 Ga0207711_10264122 Ga0207711_102641223 85
337 3300025944 Ga0207661_10072094 Ga0207661_100720943 85
338 3300025945 Ga0207679_10007146 Ga0207679_100071462 85
339 3300025949 Ga0207667_10140403 Ga0207667_101404032 85
340 3300025949 Ga0207667_11441611 Ga0207667_114416112 85
341 3300025960 Ga0207651_10123114 Ga0207651_101231142 85
342 3300025960 Ga0207651_10199802 Ga0207651_101998023 85
343 3300025972 Ga0207668_10510240 Ga0207668_105102402 85
344 3300025972 Ga0207668_11212660 Ga0207668_112126601 85
345 3300026041 Ga0207639_10608444 Ga0207639_106084442 85
346 3300026041 Ga0207639_11461043 Ga0207639_114610432 85
347 3300026067 Ga0207678_10078016 Ga0207678_100780164 85
348 3300026067 Ga0207678_10174518 Ga0207678_101745181 85
349 3300026078 Ga0207702_10147410 Ga0207702_101474102 85
350 3300026088 Ga0207641_11683927 Ga0207641_116839272 85
351 3300026095 Ga0207676_10183333 Ga0207676_101833333 85
352 3300026116 Ga0207674_11163145 Ga0207674_111631452 85
353 3300026121 Ga0207683_10155005 Ga0207683_101550053 85
354 3300028379 Ga0268266_10263002 Ga0268266_102630023 85
355 3300031731 Ga0307405_10188573 Ga0307405_101885732 85
356 3300031901 Ga0307406_10332051 Ga0307406_103320513 85
357 3300031911 Ga0307412_11236098 Ga0307412_112360982 85
358 3300032002 Ga0307416_100006793 Ga0307416_1000067936 85
359 3300032126 Ga0307415_100025803 Ga0307415_1000258037 85
360 3300037312 Ga0395899_0279962 Ga0395899_0279962_783_1040 85
361 3300037418 Ga0395900_0050105 Ga0395900_0050105_518_775 85
362 3300037466 Ga0395898_0000941 Ga0395898_0000941_36981_37238 85
363 3300037466 Ga0395898_0137221 Ga0395898_0137221_1358_1615 85
364 3300037471 Ga0395905_0080119 Ga0395905_0080119_2695_2952 85
365 3300037471 Ga0395905_0347097 Ga0395905_0347097_437_694 85
366 3300037471 Ga0395905_0866016 Ga0395905_0866016_245_502 85
367 3300037471 Ga0395905_1014591 Ga0395905_1014591_439_696 85
368 3300038443 Ga0395901_0102263 Ga0395901_0102263_728_985 85
369 3300038443 Ga0395901_0195729 Ga0395901_0195729_1137_1394 85
370 3300041512 Ga0451853_0183747 Ga0451853_0183747_52_309 85
371 3300044683 Ga0466965_0489557 Ga0466965_0489557_143_400 85
372 3300044684 Ga0466966_0471492 Ga0466966_0471492_15_272 85
373 3300044693 Ga0466961_0496082 Ga0466961_0496082_322_579 85
374 3300044719 Ga0466971_0071053 Ga0466971_0071053_899_1156 85
375 3300045836 Ga0466958_0105941 Ga0466958_0105941_749_1006 85
376 3300046525 Ga0495663_0138423 Ga0495663_0138423_198_455 85
377 3300046539 Ga0495621_0008845 Ga0495621_0008845_1239_1496 85
378 3300046558 Ga0495633_0024149 Ga0495633_0024149_267_524 85
379 3300046684 Ga0495669_0060341 Ga0495669_0060341_110_367 85
380 3300046684 Ga0495669_0085879 Ga0495669_0085879_1149_1406 85
381 3300046684 Ga0495669_0156989 Ga0495669_0156989_554_811 85
382 3300046691 Ga0495670_0368091 Ga0495670_0368091_190_447 85
383 3300046691 Ga0495670_0749773 Ga0495670_0749773_20_277 85
384 3300047445 Ga0495677_0037561 Ga0495677_0037561_1128_1385 85
385 3300047445 Ga0495677_0067772 Ga0495677_0067772_224_535 85
386 3300047445 Ga0495677_0395191 Ga0495677_0395191_24_281 85
387 3300048904 Ga0496101_0388103 Ga0496101_0388103_45_302 85
388 3300048912 Ga0496109_0304046 Ga0496109_0304046_974_1231 85
389 3300048913 Ga0496110_0029386 Ga0496110_0029386_3040_3297 85
390 3300048914 Ga0496111_0044338 Ga0496111_0044338_1247_1504 85
391 3300048917 Ga0496114_0030935 Ga0496114_0030935_2237_2494 85
392 3300059424 Ga0590075_131216 Ga0590075_131216_214_471 85
393 3300005339 Ga0070660_100050134 Ga0070660_1000501343 86
394 3300005366 Ga0070659_100404073 Ga0070659_1004040733 86
395 3300005578 Ga0068854_100016489 Ga0068854_1000164895 86
396 3300005616 Ga0068852_101043263 Ga0068852_1010432632 86
397 3300025913 Ga0207695_10006706 Ga0207695_1000670611 86
398 3300025981 Ga0207640_10000423 Ga0207640_1000042324 86
399 3300026142 Ga0207698_10508149 Ga0207698_105081492 86
400 3300026142 Ga0207698_11045724 Ga0207698_110457241 86
401 3300031903 Ga0307407_10889499 Ga0307407_108894992 86
402 3300032004 Ga0307414_10349049 Ga0307414_103490492 86
403 3300032005 Ga0307411_10066627 Ga0307411_100666274 86
404 3300037471 Ga0395905_0752658 Ga0395905_0752658_46_306 86
405 3300041406 Ga0439439_0087781 Ga0439439_0087781_34_294 86
406 3300044658 Ga0466972_0456354 Ga0466972_0456354_198_458 86
407 3300044683 Ga0466965_0890606 Ga0466965_0890606_179_439 86
408 3300046616 Ga0495668_0050159 Ga0495668_0050159_29_388 86
409 3300047447 Ga0495685_053707 Ga0495685_053707_715_1029 86
410 3300049705 Ga0501225_0169792 Ga0501225_0169792_289_555 86
411 3300001979 JGI24740J21852_10022788 JGI24740J21852_100227882 87
412 3300001989 JGI24739J22299_10049041 JGI24739J22299_100490412 87
413 3300001990 JGI24737J22298_10046383 JGI24737J22298_100463832 87
414 3300005327 Ga0070658_10199822 Ga0070658_101998222 87
415 3300005337 Ga0070682_100044956 Ga0070682_1000449562 87
416 3300005344 Ga0070661_100108180 Ga0070661_1001081803 87
417 3300005455 Ga0070663_100021677 Ga0070663_1000216772 87
418 3300005457 Ga0070662_100056965 Ga0070662_1000569653 87
419 3300005539 Ga0068853_100051542 Ga0068853_1000515423 87
420 3300005563 Ga0068855_100487202 Ga0068855_1004872022 87
421 3300005578 Ga0068854_100507190 Ga0068854_1005071902 87
422 3300013102 Ga0157371_10150906 Ga0157371_101509063 87
423 3300025909 Ga0207705_10494066 Ga0207705_104940662 87
424 3300025912 Ga0207707_10252336 Ga0207707_102523362 87
425 3300025920 Ga0207649_10092605 Ga0207649_100926053 87
426 3300025921 Ga0207652_10066916 Ga0207652_100669162 87
427 3300025932 Ga0207690_10113515 Ga0207690_101135152 87
428 3300025933 Ga0207706_10026411 Ga0207706_100264116 87
429 3300025944 Ga0207661_10652534 Ga0207661_106525342 87
430 3300025945 Ga0207679_10446427 Ga0207679_104464272 87
431 3300025981 Ga0207640_10507684 Ga0207640_105076842 87
432 3300026041 Ga0207639_10526302 Ga0207639_105263022 87
433 3300026067 Ga0207678_10077304 Ga0207678_100773043 87
434 3300026067 Ga0207678_10630307 Ga0207678_106303073 87
435 3300031824 Ga0307413_10765204 Ga0307413_107652042 87
436 3300031852 Ga0307410_11481331 Ga0307410_114813312 87
437 3300032004 Ga0307414_11221344 Ga0307414_112213442 87
438 3300044901 Ga0466960_0130821 Ga0466960_0130821_856_1119 87
439 3300045976 Ga0466967_0576552 Ga0466967_0576552_163_426 87
440 3300005344 Ga0070661_100379850 Ga0070661_1003798502 88
441 3300005353 Ga0070669_101027010 Ga0070669_1010270102 88
442 3300005455 Ga0070663_100051901 Ga0070663_1000519013 88
443 3300005563 Ga0068855_100347496 Ga0068855_1003474962 88
444 3300005614 Ga0068856_100225513 Ga0068856_1002255133 88
445 3300005614 Ga0068856_100423814 Ga0068856_1004238142 88
446 3300005616 Ga0068852_100038343 Ga0068852_1000383432 88
447 3300013100 Ga0157373_10615410 Ga0157373_106154102 88
448 3300013102 Ga0157371_10229530 Ga0157371_102295302 88
449 3300013104 Ga0157370_10379558 Ga0157370_103795583 88
450 3300013105 Ga0157369_10206322 Ga0157369_102063222 88
451 3300013105 Ga0157369_10336086 Ga0157369_103360861 88
452 3300013307 Ga0157372_12902890 Ga0157372_129028902 88
453 3300025909 Ga0207705_10641590 Ga0207705_106415901 88
454 3300025920 Ga0207649_10361407 Ga0207649_103614071 88
455 3300025949 Ga0207667_10222811 Ga0207667_102228112 88
456 3300026067 Ga0207678_10141268 Ga0207678_101412682 88
457 3300026078 Ga0207702_10239259 Ga0207702_102392591 88
458 3300026078 Ga0207702_10469899 Ga0207702_104698992 88
459 3300026142 Ga0207698_10361896 Ga0207698_103618961 88
460 3300031995 Ga0307409_102690138 Ga0307409_1026901381 88
461 3300037312 Ga0395899_0010253 Ga0395899_0010253_422_688 88
462 3300037418 Ga0395900_0029417 Ga0395900_0029417_4273_4539 88
463 3300037418 Ga0395900_0067719 Ga0395900_0067719_1607_1873 88
464 3300037466 Ga0395898_0016800 Ga0395898_0016800_3585_3851 88
465 3300038443 Ga0395901_0108848 Ga0395901_0108848_2201_2467 88
466 3300044684 Ga0466966_0000052 Ga0466966_0000052_25647_25913 88
467 3300031731 Ga0307405_10582443 Ga0307405_105824432 89
468 3300031824 Ga0307413_10277850 Ga0307413_102778502 89
469 3300031824 Ga0307413_11005242 Ga0307413_110052422 89
470 3300031852 Ga0307410_10143338 Ga0307410_101433383 89
471 3300031852 Ga0307410_10946133 Ga0307410_109461332 89
472 3300031901 Ga0307406_10190050 Ga0307406_101900502 89
473 3300031901 Ga0307406_11849860 Ga0307406_118498601 89
474 3300032002 Ga0307416_100163898 Ga0307416_1001638982 89
475 3300032004 Ga0307414_11220797 Ga0307414_112207972 89
476 3300032005 Ga0307411_10127528 Ga0307411_101275282 89
477 3300032126 Ga0307415_100917498 Ga0307415_1009174982 89
478 3300032126 Ga0307415_100942575 Ga0307415_1009425752 89
479 3300001904 JGI24736J21556_1001189 JGI24736J21556_10011892 90
480 3300005327 Ga0070658_10467783 Ga0070658_104677832 90
481 3300005339 Ga0070660_100062576 Ga0070660_1000625763 90
482 3300005344 Ga0070661_100130438 Ga0070661_1001304383 90
483 3300005455 Ga0070663_100271075 Ga0070663_1002710751 90
484 3300005535 Ga0070684_100384381 Ga0070684_1003843812 90
485 3300005578 Ga0068854_100204701 Ga0068854_1002047012 90
486 3300005616 Ga0068852_100040329 Ga0068852_1000403291 90
487 3300009093 Ga0105240_10072531 Ga0105240_100725314 90
488 3300009174 Ga0105241_10143674 Ga0105241_101436743 90
489 3300009551 Ga0105238_10089598 Ga0105238_100895983 90
490 3300013100 Ga0157373_10260089 Ga0157373_102600892 90
491 3300013102 Ga0157371_10954505 Ga0157371_109545051 90
492 3300022467 Ga0224712_10612992 Ga0224712_106129922 90
493 3300025904 Ga0207647_10068892 Ga0207647_100688922 90
494 3300025909 Ga0207705_10000059 Ga0207705_1000005922 90
495 3300025909 Ga0207705_10001692 Ga0207705_100016924 90
496 3300025911 Ga0207654_10909050 Ga0207654_109090501 90
497 3300025913 Ga0207695_10213824 Ga0207695_102138242 90
498 3300025919 Ga0207657_10011122 Ga0207657_100111222 90
499 3300025920 Ga0207649_10010690 Ga0207649_100106903 90
500 3300025924 Ga0207694_10590959 Ga0207694_105909592 90
501 3300025932 Ga0207690_10002543 Ga0207690_1000254310 90
502 3300025949 Ga0207667_10041974 Ga0207667_100419744 90
503 3300025949 Ga0207667_10206811 Ga0207667_102068111 90
504 3300025981 Ga0207640_10731836 Ga0207640_107318361 90
505 3300026067 Ga0207678_10159084 Ga0207678_101590842 90
506 3300026078 Ga0207702_10153119 Ga0207702_101531193 90
507 3300026142 Ga0207698_10040747 Ga0207698_100407474 90
508 3300037312 Ga0395899_0114827 Ga0395899_0114827_1239_1511 90
509 3300037418 Ga0395900_0368632 Ga0395900_0368632_150_422 90
510 3300037418 Ga0395900_0558540 Ga0395900_0558540_775_1047 90
511 3300037418 Ga0395900_1440407 Ga0395900_1440407_13_285 90
512 3300037466 Ga0395898_0073073 Ga0395898_0073073_2965_3237 90
513 3300037471 Ga0395905_0260637 Ga0395905_0260637_528_800 90
514 3300038443 Ga0395901_0042757 Ga0395901_0042757_4006_4278 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

9

101

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v6u-assembly1.cif.gz_A high resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii 0.9777 8 86
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.9615 8 86
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9607 8 86
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.955 8 86
4c45-assembly1.cif.gz_A crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2) 0.9524 8 86
ID Description Score Start End Superfamily
2v6uA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9777 8 86 3.30.1360.20
af_O42658_1_95_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9679 9 84 3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9616 7 83 3.30.1360.20
af_Q54RY8_2_96_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9486 6 83 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9462 7 88 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A5C4JLD0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9864 8 86 GO:0006729
GO:0008124
AF-A0A516IUK0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9854 6 85 GO:0006729
GO:0008124
AF-A0A2P6FU96-F1-model_v4 deleted 0.9851 8 83
AF-A0A011VBW2-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9848 8 86 GO:0006729
GO:0008124
AF-A0A4R6YCN0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9844 8 86 GO:0006729
GO:0008124

Feature Viewer

pLDDT pTM Quality
90.49 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map