F457785

General Info

Members Datasets Scaffolds Average Seq Length
514 242 1028 323

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0178721|Ga0501034_0178721_723_1853
Length 376
Sequence MPVRHFILFFVLKQRKEAKERQGKKPSPQEKRNLKTSTSLTTLGKRWQPIPDFTIRFVTNFTTMSLSKRINPFLKTNNDTGFSNTGNINGGRFINRNGTFNLNKKGWPFWDRFSVYYTMISMPSWKFIMIIILTFIGINLLYTFAYVLLGAGEFTGLIYSSGWNYFKEIYFFSTETFTTVGYGRVNPVGDGANLVAAIEAMSGFLSFAIATGLIYGRFARPRAHLAFSDFAIIAPYRDKTGLMFRFACYKEHHALTDVTVQVNLAMLLQENGQTVYKYYDLPLERSKIESLPMNWTVVHPIDELSPLLGFTAEDMKAADVEIYVLVRGFNDVYSNTVLQRTSYTYNEIEMNRRFIPMYQETENGTVLELNKLSQFV

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
177 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
178 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
221 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
222 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
228 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
231 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 2738541278 Niastella sp. CF465 Isolate Unclassified
233 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
234 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
235 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
236 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
237 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
238 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
239 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
240 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
241 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
242 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.56
Nodule 0
Rhizoplane 0.19
Rhizosphere 83.46
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0178721 3300049571 Bacteria 2087
2 MBSR1b_contig_1241678 2162886012 Bacteria 1661
3 JGI24740J21852_10035446 3300001979 Bacteria 1560
4 JGI24739J22299_10002579 3300001989 Bacteria 6986
5 JGI25154J39366_1000044 3300002738 Bacteria 136516
6 JGI25153J46596_10002544 3300003215 Bacteria 10452
7 rootH1_10011351 3300003316 Bacteria 36357
8 rootH2_10012322 3300003320 Bacteria 30567
9 rootH2_10164000 3300003320 Bacteria 3593
10 rootH2_10242392 3300003320 Bacteria 2109
11 rootH2_10244277 3300003320 Bacteria 1387
12 rootH2_10250364 3300003320 Unclassified 1384
13 rootL2_10032456 3300003322 Bacteria 2545
14 rootL2_10032457 3300003322 Bacteria 1228
15 rootL2_10065582 3300003322 Bacteria 10537
16 rootL2_10081580 3300003322 Bacteria 3430
17 rootL2_10246027 3300003322 Bacteria 2196
18 rootH1_10003031 3300003323 Bacteria 56969
19 rootH1_10029642 3300003323 Bacteria 6330
20 rootH1_10033682 3300003323 Bacteria 2359
21 rootH1_10037018 3300003323 Bacteria 2304
22 rootH1_10104240 3300003323 Bacteria 2903
23 rootH1_10227837 3300003323 Bacteria 5774
24 JGI25160J50197_1001989 3300003354 Bacteria 9752
25 JGI25160J50197_1002581 3300003354 Bacteria 8368
26 JGI25160J50197_1010862 3300003354 Bacteria 3266
27 Ga0055535_1005094 3300003761 Bacteria 2982
28 Ga0055528_1000613 3300003790 Bacteria 26621
29 Ga0055530_10007725 3300003791 Bacteria 4467
30 Ga0065165_1000017 3300005262 Bacteria 278286
31 Ga0065712_10098484 3300005290 Bacteria 2118
32 Ga0065712_10112528 3300005290 Bacteria 1798
33 Ga0065715_10139484 3300005293 Bacteria 1876
34 Ga0070676_10033491 3300005328 Bacteria 2948
35 Ga0070683_100001617 3300005329 Bacteria 17421
36 Ga0070683_100002162 3300005329 Bacteria 15546
37 Ga0070683_100365501 3300005329 Bacteria 1374
38 Ga0070690_100004429 3300005330 Bacteria 7798
39 Ga0070690_100121117 3300005330 Bacteria 1756
40 Ga0068869_100003906 3300005334 Bacteria 9195
41 Ga0068869_100010369 3300005334 Bacteria 6077
42 Ga0068869_100014244 3300005334 Bacteria 5307
43 Ga0068869_100059454 3300005334 Unclassified 2798
44 Ga0068869_100193110 3300005334 Bacteria 1602
45 Ga0068869_100258081 3300005334 Bacteria 1394
46 Ga0070666_10000140 3300005335 Bacteria 50189
47 Ga0070666_10032037 3300005335 Bacteria 3471
48 Ga0070666_10050012 3300005335 Unclassified 2811
49 Ga0070666_10062915 3300005335 Bacteria 2515
50 Ga0070666_10064695 3300005335 Bacteria 2480
51 Ga0070682_100100072 3300005337 Bacteria 1912
52 Ga0070682_100139662 3300005337 Bacteria 1650
53 Ga0068868_100026705 3300005338 Bacteria 4402
54 Ga0070660_100015788 3300005339 Bacteria 5462
55 Ga0070660_100066195 3300005339 Bacteria 2812
56 Ga0070689_100022568 3300005340 Unclassified 4701
57 Ga0070689_100035453 3300005340 Bacteria 3812
58 Ga0070689_100135157 3300005340 Bacteria 1980
59 Ga0070687_100005789 3300005343 Bacteria 5022
60 Ga0070661_100001586 3300005344 Bacteria 15775
61 Ga0070661_100008231 3300005344 Bacteria 7195
62 Ga0070661_100061333 3300005344 Bacteria 2760
63 Ga0070661_100119731 3300005344 Bacteria 1971
64 Ga0070668_100047032 3300005347 Bacteria 3316
65 Ga0070668_100181665 3300005347 Bacteria 1719
66 Ga0070668_100253559 3300005347 Unclassified 1461
67 Ga0070669_100039131 3300005353 Bacteria 3444
68 Ga0070675_100019678 3300005354 Bacteria 5381
69 Ga0070675_100036552 3300005354 Bacteria 3998
70 Ga0070675_100291118 3300005354 Bacteria 1437
71 Ga0070671_100028010 3300005355 Bacteria 4639
72 Ga0070671_100048428 3300005355 Bacteria 3534
73 Ga0070671_100186187 3300005355 Bacteria 1759
74 Ga0070674_100020801 3300005356 Bacteria 4202
75 Ga0070674_100030119 3300005356 Bacteria 3583
76 Ga0070674_100056169 3300005356 Unclassified 2729
77 Ga0070674_100063304 3300005356 Unclassified 2588
78 Ga0070673_100004111 3300005364 Bacteria 9166
79 Ga0070673_100005988 3300005364 Bacteria 7867
80 Ga0070673_100025838 3300005364 Bacteria 4329
81 Ga0070673_100031047 3300005364 Bacteria 4006
82 Ga0070673_100339999 3300005364 Bacteria 1330
83 Ga0070688_100012562 3300005365 Bacteria 4746
84 Ga0070688_100049164 3300005365 Bacteria 2623
85 Ga0070659_100023662 3300005366 Bacteria 4703
86 Ga0070659_100025806 3300005366 Bacteria 4518
87 Ga0070667_100041537 3300005367 Bacteria 3858
88 Ga0070667_100052707 3300005367 Bacteria 3434
89 Ga0070667_100146420 3300005367 Bacteria 2072
90 Ga0070667_100230658 3300005367 Bacteria 1651
91 Ga0070700_100084368 3300005441 Bacteria 2058
92 Ga0070700_100228593 3300005441 Bacteria 1323
93 Ga0070678_100024931 3300005456 Bacteria 4013
94 Ga0070678_100037951 3300005456 Bacteria 3388
95 Ga0070662_100017694 3300005457 Bacteria 4809
96 Ga0070662_100051579 3300005457 Bacteria 2971
97 Ga0070681_10044366 3300005458 Bacteria 4450
98 Ga0068867_100029486 3300005459 Bacteria 3953
99 Ga0068867_100041719 3300005459 Bacteria 3353
100 Ga0068867_100080440 3300005459 Bacteria 2454
101 Ga0068867_100098160 3300005459 Unclassified 2233
102 Ga0070684_100003375 3300005535 Bacteria 11965
103 Ga0070684_100010652 3300005535 Bacteria 7292
104 Ga0070684_100034332 3300005535 Bacteria 4337
105 Ga0070684_100119759 3300005535 Bacteria 2367
106 Ga0068853_100008148 3300005539 Bacteria 8410
107 Ga0068853_100028239 3300005539 Bacteria 4717
108 Ga0068853_100044239 3300005539 Bacteria 3811
109 Ga0068853_100107471 3300005539 Bacteria 2474
110 Ga0070672_100026793 3300005543 Unclassified 4295
111 Ga0070686_100346138 3300005544 Bacteria 1115
112 Ga0070693_100015081 3300005547 Bacteria 3974
113 Ga0068855_100006158 3300005563 Bacteria 14629
114 Ga0068855_100018500 3300005563 Bacteria 8376
115 Ga0068855_100296816 3300005563 Archaea 1790
116 Ga0070664_100066182 3300005564 Bacteria 3085
117 Ga0070664_100080813 3300005564 Bacteria 2800
118 Ga0070664_100116152 3300005564 Bacteria 2340
119 Ga0068857_100003177 3300005577 Bacteria 13625
120 Ga0068857_100004921 3300005577 Bacteria 11338
121 Ga0068857_100010896 3300005577 Bacteria 7913
122 Ga0068857_100019349 3300005577 Bacteria 5977
123 Ga0068854_100017891 3300005578 Bacteria 4751
124 Ga0068854_100065810 3300005578 Bacteria 2636
125 Ga0068856_100010061 3300005614 Bacteria 9189
126 Ga0068856_100021433 3300005614 Bacteria 6283
127 Ga0068856_100190823 3300005614 Bacteria 2063
128 Ga0070702_100017427 3300005615 Unclassified 3705
129 Ga0068852_100000666 3300005616 Bacteria 22465
130 Ga0068852_100026872 3300005616 Bacteria 4684
131 Ga0068852_100036307 3300005616 Bacteria 4122
132 Ga0068852_100383736 3300005616 Bacteria 1379
133 Ga0068859_100000106 3300005617 Bacteria 78128
134 Ga0068859_100027807 3300005617 Bacteria 5672
135 Ga0068859_100048213 3300005617 Bacteria 4279
136 Ga0068859_100058062 3300005617 Unclassified 3898
137 Ga0068859_100124166 3300005617 Bacteria 2649
138 Ga0068864_100007661 3300005618 Bacteria 8893
139 Ga0068864_100008534 3300005618 Bacteria 8454
140 Ga0068864_100211340 3300005618 Bacteria 1787
141 Ga0068864_100475044 3300005618 Bacteria 1199
142 Ga0068861_100010318 3300005719 Bacteria 6480
143 Ga0068851_10062666 3300005834 Bacteria 1908
144 Ga0068870_10014710 3300005840 Bacteria 3702
145 Ga0068870_10015411 3300005840 Bacteria 3626
146 Ga0068870_10022466 3300005840 Bacteria 3100
147 Ga0068863_100023871 3300005841 Bacteria 5836
148 Ga0068863_100240712 3300005841 Bacteria 1746
149 Ga0068858_100029798 3300005842 Bacteria 5070
150 Ga0068858_100320633 3300005842 Bacteria 1481
151 Ga0068858_100454369 3300005842 Unclassified 1235
152 Ga0068860_100000005 3300005843 Bacteria 472349
153 Ga0068860_100001506 3300005843 Bacteria 25119
154 Ga0068860_100001954 3300005843 Bacteria 21799
155 Ga0068860_100002082 3300005843 Bacteria 21091
156 Ga0068860_100010218 3300005843 Bacteria 9289
157 Ga0068860_100091578 3300005843 Bacteria 2897
158 Ga0081540_1014988 3300005983 Unclassified 4927
159 Ga0081539_10027293 3300005985 Bacteria 3620
160 Ga0075366_10067836 3300006195 Bacteria 2123
161 Ga0075366_10105612 3300006195 Bacteria 1693
162 Ga0075366_10212098 3300006195 Bacteria 1179
163 Ga0097621_100014046 3300006237 Bacteria 5983
164 Ga0097621_100063353 3300006237 Bacteria 3039
165 Ga0097621_100115819 3300006237 Bacteria 2269
166 Ga0097621_100117194 3300006237 Bacteria 2256
167 Ga0068871_100055921 3300006358 Bacteria 3206
168 Ga0068871_100128722 3300006358 Bacteria 2145
169 Ga0075434_100132604 3300006871 Bacteria 2511
170 Ga0097620_100000106 3300006931 Bacteria 78128
171 Ga0097620_100027808 3300006931 Bacteria 5672
172 Ga0097620_100048216 3300006931 Bacteria 4279
173 Ga0097620_100058062 3300006931 Unclassified 3898
174 Ga0097620_100124163 3300006931 Bacteria 2649
175 Ga0105240_10000100 3300009093 Bacteria 176640
176 Ga0105240_10000268 3300009093 Bacteria 102828
177 Ga0105240_10001525 3300009093 Bacteria 39404
178 Ga0105240_10004766 3300009093 Bacteria 20481
179 Ga0105240_10005272 3300009093 Bacteria 19301
180 Ga0105240_10025992 3300009093 Bacteria 7689
181 Ga0105240_10042769 3300009093 Bacteria 5771
182 Ga0105240_10047893 3300009093 Bacteria 5406
183 Ga0105240_10099497 3300009093 Unclassified 3539
184 Ga0111539_10436061 3300009094 Bacteria 1526
185 Ga0105247_10002808 3300009101 Bacteria 11650
186 Ga0114129_10042079 3300009147 Bacteria 6433
187 Ga0105241_10001027 3300009174 Bacteria 21252
188 Ga0105241_10004620 3300009174 Bacteria 10185
189 Ga0105241_10100438 3300009174 Bacteria 2299
190 Ga0105241_10136864 3300009174 Bacteria 1990
191 Ga0105241_10174635 3300009174 Unclassified 1777
192 Ga0105241_10428330 3300009174 Bacteria 1166
193 Ga0105242_10093828 3300009176 Bacteria 2531
194 Ga0105242_10116486 3300009176 Bacteria 2286
195 Ga0105248_10325336 3300009177 Bacteria 1732
196 Ga0105237_10001534 3300009545 Bacteria 30217
197 Ga0105237_10006014 3300009545 Bacteria 13577
198 Ga0105237_10013269 3300009545 Bacteria 8643
199 Ga0105237_10014907 3300009545 Bacteria 8105
200 Ga0105237_10019257 3300009545 Bacteria 7050
201 Ga0105237_10029971 3300009545 Bacteria 5527
202 Ga0105238_10018791 3300009551 Bacteria 7036
203 Ga0105238_10020919 3300009551 Bacteria 6665
204 Ga0105238_10054844 3300009551 Bacteria 4002
205 Ga0105249_10011207 3300009553 Bacteria 7876
206 Ga0105239_10000811 3300010375 Bacteria 44304
207 Ga0105239_10001950 3300010375 Bacteria 26908
208 Ga0105239_10003047 3300010375 Bacteria 20835
209 Ga0105239_10003552 3300010375 Bacteria 19067
210 Ga0105239_10059626 3300010375 Bacteria 4188
211 Ga0105239_10116978 3300010375 Bacteria 2959
212 Ga0105246_10072441 3300011119 Bacteria 2429
213 Ga0105246_10156531 3300011119 Bacteria 1731
214 Ga0105246_10290913 3300011119 Bacteria 1314
215 Ga0157373_10046899 3300013100 Bacteria 3083
216 Ga0157370_10000536 3300013104 Bacteria 47516
217 Ga0157370_10158231 3300013104 Bacteria 2108
218 Ga0157370_10205042 3300013104 Bacteria 1828
219 Ga0157369_10029881 3300013105 Bacteria 6017
220 Ga0157369_10091760 3300013105 Unclassified 3242
221 Ga0157369_10190393 3300013105 Bacteria 2156
222 Ga0157374_10000607 3300013296 Bacteria 31733
223 Ga0157374_10015745 3300013296 Bacteria 6640
224 Ga0157374_10030025 3300013296 Bacteria 4933
225 Ga0157374_10545879 3300013296 Bacteria 1166
226 Ga0157378_10007350 3300013297 Bacteria 9623
227 Ga0157378_10021460 3300013297 Bacteria 5679
228 Ga0157378_10036442 3300013297 Bacteria 4353
229 Ga0157378_10112564 3300013297 Bacteria 2497
230 Ga0163162_10001924 3300013306 Bacteria 19554
231 Ga0163162_10002494 3300013306 Bacteria 17393
232 Ga0163162_10003034 3300013306 Bacteria 16037
233 Ga0163162_10009578 3300013306 Bacteria 9425
234 Ga0163162_10032966 3300013306 Bacteria 5144
235 Ga0163162_10052248 3300013306 Bacteria 4104
236 Ga0163162_10078475 3300013306 Bacteria 3368
237 Ga0163162_10208056 3300013306 Bacteria 2086
238 Ga0163162_10401368 3300013306 Bacteria 1503
239 Ga0157372_10000052 3300013307 Bacteria 135497
240 Ga0157372_10003732 3300013307 Bacteria 16358
241 Ga0157372_10591204 3300013307 Bacteria 1294
242 Ga0157375_10002714 3300013308 Bacteria 15301
243 Ga0157375_10010451 3300013308 Bacteria 8167
244 Ga0157375_10037882 3300013308 Bacteria 4625
245 Ga0157375_10063712 3300013308 Bacteria 3669
246 Ga0157375_10076611 3300013308 Unclassified 3372
247 Ga0157375_10098582 3300013308 Bacteria 3000
248 Ga0157375_10100836 3300013308 Bacteria 2969
249 Ga0157375_10148556 3300013308 Unclassified 2477
250 Ga0157375_10184024 3300013308 Bacteria 2242
251 Ga0163163_10000078 3300014325 Bacteria 107017
252 Ga0163163_10163398 3300014325 Bacteria 2272
253 Ga0157380_10009590 3300014326 Bacteria 6945
254 Ga0157377_10001358 3300014745 Bacteria 10507
255 Ga0157377_10090760 3300014745 Bacteria 1804
256 Ga0157379_10029468 3300014968 Bacteria 4881
257 Ga0157379_10079331 3300014968 Bacteria 2939
258 Ga0157379_10297269 3300014968 Bacteria 1471
259 Ga0157376_10002017 3300014969 Bacteria 13609
260 Ga0157376_10014323 3300014969 Bacteria 5948
261 Ga0157376_10319461 3300014969 Bacteria 1476
262 Ga0182005_1000058 3300015265 Bacteria 102314
263 Ga0163161_10200565 3300017792 Bacteria 1537
264 Ga0163161_10430781 3300017792 Bacteria 1063
265 Ga0209436_102457 3300025208 Bacteria 5554
266 Ga0209436_104746 3300025208 Bacteria 3285
267 Ga0209258_100628 3300025242 Bacteria 27909
268 Ga0209646_1000006 3300025246 Bacteria 694084
269 Ga0209026_1000262 3300025250 Bacteria 64597
270 Ga0209148_1000559 3300025254 Bacteria 35257
271 Ga0209673_1000354 3300025273 Bacteria 83443
272 Ga0209564_1009024 3300025295 Bacteria 4809
273 Ga0209564_1016119 3300025295 Bacteria 2995
274 Ga0209758_1002136 3300025297 Bacteria 20845
275 Ga0209758_1016610 3300025297 Bacteria 3727
276 Ga0209758_1016817 3300025297 Bacteria 3689
277 Ga0209050_1000163 3300025298 Bacteria 154895
278 Ga0207426_1000060 3300025302 Bacteria 363139
279 Ga0207426_1000096 3300025302 Bacteria 271627
280 Ga0207426_1002638 3300025302 Bacteria 11082
281 Ga0207426_1004315 3300025302 Bacteria 7009
282 Ga0209257_1003391 3300025304 Bacteria 13752
283 Ga0207697_10032668 3300025315 Bacteria 2130
284 Ga0207697_10084532 3300025315 Bacteria 1339
285 Ga0207642_10016562 3300025899 Bacteria 2780
286 Ga0207710_10016555 3300025900 Bacteria 3120
287 Ga0207688_10195857 3300025901 Unclassified 1210
288 Ga0207680_10000140 3300025903 Bacteria 34445
289 Ga0207680_10232922 3300025903 Bacteria 1266
290 Ga0207680_10246352 3300025903 Bacteria 1233
291 Ga0207647_10037784 3300025904 Bacteria 3058
292 Ga0207647_10171114 3300025904 Unclassified 1264
293 Ga0207645_10001767 3300025907 Bacteria 17508
294 Ga0207645_10003739 3300025907 Bacteria 11444
295 Ga0207643_10022918 3300025908 Bacteria 3441
296 Ga0207654_10003026 3300025911 Bacteria 8530
297 Ga0207654_10060003 3300025911 Bacteria 2221
298 Ga0207654_10156718 3300025911 Bacteria 1467
299 Ga0207654_10244590 3300025911 Bacteria 1200
300 Ga0207707_10118721 3300025912 Bacteria 2311
301 Ga0207695_10000027 3300025913 Bacteria 612456
302 Ga0207695_10000073 3300025913 Bacteria 312565
303 Ga0207695_10000164 3300025913 Bacteria 196777
304 Ga0207695_10002078 3300025913 Bacteria 30525
305 Ga0207695_10026599 3300025913 Bacteria 6456
306 Ga0207695_10026947 3300025913 Bacteria 6406
307 Ga0207671_10000499 3300025914 Bacteria 53290
308 Ga0207671_10005845 3300025914 Bacteria 11178
309 Ga0207671_10010037 3300025914 Bacteria 7853
310 Ga0207671_10010941 3300025914 Bacteria 7433
311 Ga0207671_10011844 3300025914 Bacteria 7057
312 Ga0207671_10014729 3300025914 Bacteria 6166
313 Ga0207671_10026173 3300025914 Bacteria 4374
314 Ga0207662_10002457 3300025918 Bacteria 9299
315 Ga0207657_10088030 3300025919 Bacteria 2597
316 Ga0207657_10128632 3300025919 Bacteria 2078
317 Ga0207649_10003797 3300025920 Bacteria 8239
318 Ga0207649_10152557 3300025920 Bacteria 1593
319 Ga0207681_10047510 3300025923 Bacteria 2892
320 Ga0207681_10108424 3300025923 Bacteria 2016
321 Ga0207694_10008864 3300025924 Bacteria 7589
322 Ga0207694_10041674 3300025924 Bacteria 3538
323 Ga0207694_10050605 3300025924 Bacteria 3218
324 Ga0207650_10207200 3300025925 Unclassified 1573
325 Ga0207659_10016489 3300025926 Bacteria 4809
326 Ga0207659_10170146 3300025926 Bacteria 1718
327 Ga0207659_10193013 3300025926 Bacteria 1622
328 Ga0207687_10186949 3300025927 Bacteria 1609
329 Ga0207644_10050060 3300025931 Bacteria 2993
330 Ga0207690_10034234 3300025932 Bacteria 3272
331 Ga0207706_10002220 3300025933 Bacteria 18951
332 Ga0207706_10003282 3300025933 Bacteria 15477
333 Ga0207706_10031421 3300025933 Unclassified 4730
334 Ga0207706_10039001 3300025933 Bacteria 4213
335 Ga0207706_10489007 3300025933 Unclassified 1063
336 Ga0207686_10115374 3300025934 Bacteria 1819
337 Ga0207686_10351897 3300025934 Unclassified 1109
338 Ga0207670_10002410 3300025936 Bacteria 9801
339 Ga0207670_10049466 3300025936 Bacteria 2812
340 Ga0207669_10242189 3300025937 Bacteria 1337
341 Ga0207691_10021576 3300025940 Bacteria 6080
342 Ga0207691_10027880 3300025940 Bacteria 5292
343 Ga0207691_10036026 3300025940 Bacteria 4586
344 Ga0207691_10084053 3300025940 Bacteria 2858
345 Ga0207689_10002252 3300025942 Bacteria 18073
346 Ga0207689_10003471 3300025942 Bacteria 14403
347 Ga0207689_10009081 3300025942 Bacteria 8606
348 Ga0207689_10014246 3300025942 Bacteria 6765
349 Ga0207689_10034962 3300025942 Bacteria 4174
350 Ga0207689_10037992 3300025942 Unclassified 3990
351 Ga0207689_10070182 3300025942 Bacteria 2878
352 Ga0207689_10084161 3300025942 Bacteria 2615
353 Ga0207689_10369478 3300025942 Bacteria 1193
354 Ga0207661_10247104 3300025944 Bacteria 1585
355 Ga0207661_10277733 3300025944 Bacteria 1496
356 Ga0207661_10459465 3300025944 Bacteria 1160
357 Ga0207679_10000691 3300025945 Bacteria 22567
358 Ga0207679_10037343 3300025945 Bacteria 3452
359 Ga0207679_10145215 3300025945 Bacteria 1923
360 Ga0207679_10216861 3300025945 Bacteria 1608
361 Ga0207679_10424738 3300025945 Bacteria 1174
362 Ga0207667_10003747 3300025949 Bacteria 18727
363 Ga0207667_10011842 3300025949 Bacteria 10102
364 Ga0207667_10024231 3300025949 Bacteria 6667
365 Ga0207667_10027221 3300025949 Bacteria 6229
366 Ga0207667_10058445 3300025949 Bacteria 4044
367 Ga0207667_10207072 3300025949 Unclassified 2011
368 Ga0207651_10013688 3300025960 Bacteria 4653
369 Ga0207651_10088174 3300025960 Bacteria 2261
370 Ga0207712_10009144 3300025961 Bacteria 6270
371 Ga0207668_10150167 3300025972 Bacteria 1803
372 Ga0207668_10175041 3300025972 Bacteria 1687
373 Ga0207640_10014805 3300025981 Bacteria 4498
374 Ga0207640_10082410 3300025981 Bacteria 2203
375 Ga0207640_10109270 3300025981 Bacteria 1956
376 Ga0207658_10157610 3300025986 Bacteria 1857
377 Ga0207658_10271364 3300025986 Bacteria 1450
378 Ga0207677_10258382 3300026023 Bacteria 1418
379 Ga0207703_10009480 3300026035 Bacteria 7641
380 Ga0207703_10080500 3300026035 Bacteria 2713
381 Ga0207639_10062125 3300026041 Bacteria 2887
382 Ga0207639_10140156 3300026041 Bacteria 2013
383 Ga0207639_10225712 3300026041 Bacteria 1620
384 Ga0207708_10252646 3300026075 Bacteria 1421
385 Ga0207702_10027264 3300026078 Bacteria 4744
386 Ga0207702_10038820 3300026078 Bacteria 3988
387 Ga0207702_10195768 3300026078 Bacteria 1871
388 Ga0207702_10278384 3300026078 Bacteria 1581
389 Ga0207641_10000082 3300026088 Bacteria 138385
390 Ga0207648_10005538 3300026089 Bacteria 12716
391 Ga0207648_10058729 3300026089 Bacteria 3354
392 Ga0207648_10066891 3300026089 Bacteria 3134
393 Ga0207648_10069474 3300026089 Unclassified 3069
394 Ga0207648_10270643 3300026089 Bacteria 1518
395 Ga0207676_10004052 3300026095 Bacteria 10333
396 Ga0207676_10004389 3300026095 Bacteria 9974
397 Ga0207676_10233445 3300026095 Bacteria 1646
398 Ga0207674_10003192 3300026116 Bacteria 20181
399 Ga0207674_10003943 3300026116 Bacteria 18057
400 Ga0207674_10037879 3300026116 Bacteria 5010
401 Ga0207674_10178985 3300026116 Bacteria 2072
402 Ga0207675_100004261 3300026118 Bacteria 13836
403 Ga0207675_100068146 3300026118 Bacteria 3326
404 Ga0207675_100302592 3300026118 Bacteria 1558
405 Ga0207683_10003686 3300026121 Bacteria 13312
406 Ga0207683_10003995 3300026121 Bacteria 12789
407 Ga0207698_10004607 3300026142 Bacteria 8422
408 Ga0207698_10157375 3300026142 Bacteria 1982
409 Ga0207698_10186015 3300026142 Bacteria 1845
410 Ga0268266_10000010 3300028379 Bacteria 1030233
411 Ga0268266_10079258 3300028379 Unclassified 2859
412 Ga0268266_10254220 3300028379 Bacteria 1626
413 Ga0268265_10011306 3300028380 Bacteria 6035
414 Ga0268264_10000012 3300028381 Bacteria 521740
415 Ga0268264_10000810 3300028381 Bacteria 33689
416 Ga0268264_10002219 3300028381 Bacteria 17224
417 Ga0268264_10011333 3300028381 Bacteria 7367
418 Ga0268264_10029788 3300028381 Bacteria 4473
419 Ga0268264_10265677 3300028381 Unclassified 1601
420 Ga0307517_10014107 3300028786 Bacteria 10776
421 Ga0307515_10000412 3300028794 Bacteria 103361
422 Ga0265324_10013561 3300029957 Bacteria 3036
423 Ga0307511_10001438 3300030521 Bacteria 25120
424 Ga0265327_10040995 3300031251 Bacteria 2500
425 Ga0307513_10197111 3300031456 Unclassified 1859
426 Ga0307513_10273799 3300031456 Bacteria 1470
427 Ga0307509_10013165 3300031507 Bacteria 9816
428 Ga0307509_10066428 3300031507 Bacteria 3784
429 Ga0307509_10280633 3300031507 Bacteria 1427
430 Ga0307516_10000292 3300031730 Bacteria 65041
431 Ga0307510_10001319 3300033180 Bacteria 27054
432 Ga0373934_0077619 3300035086 Bacteria 1332
433 Ga0373943_0085612 3300035170 Bacteria 1624
434 Ga0373955_0064341 3300035172 Bacteria 2033
435 Ga0373924_0038261 3300035410 Bacteria 1956
436 Ga0373935_0161516 3300035692 Bacteria 1527
437 Ga0373933_0010042 3300035724 Bacteria 5183
438 Ga0373937_0041443 3300036401 Bacteria 4199
439 Ga0373925_0133175 3300037068 Unclassified 1940
440 Ga0439436_0005330 3300041404 Bacteria 3943
441 Ga0451841_0111009 3300041498 Bacteria 2089
442 Ga0439457_005435 3300042014 Bacteria 3208
443 Ga0439462_0020163 3300042015 Bacteria 1738
444 Ga0466969_0006579 3300044656 Bacteria 6178
445 Ga0466972_0000183 3300044658 Bacteria 48447
446 Ga0466972_0000893 3300044658 Bacteria 14339
447 Ga0466965_0053607 3300044683 Bacteria 2005
448 Ga0466966_0000053 3300044684 Bacteria 84809
449 Ga0466964_0124579 3300044706 Bacteria 1166
450 Ga0466968_0021115 3300044735 Bacteria 2635
451 Ga0466957_0002049 3300044842 Bacteria 10768
452 Ga0466960_0142484 3300044901 Bacteria 1274
453 Ga0466960_0183565 3300044901 Unclassified 1135
454 Ga0466959_0000005 3300045049 Bacteria 213958
455 Ga0466959_0014142 3300045049 Bacteria 5793
456 Ga0466958_0113644 3300045836 Archaea 1691
457 Ga0466967_0121154 3300045976 Bacteria 2417
458 Ga0495650_0085702 3300046471 Unclassified 1207
459 Ga0495664_0194302 3300046477 Bacteria 1230
460 Ga0495608_0029767 3300046511 Unclassified 3701
461 Ga0495618_0080252 3300046514 Bacteria 2082
462 Ga0495628_0080503 3300046516 Bacteria 2532
463 Ga0495630_0009105 3300046517 Bacteria 7137
464 Ga0495640_0108190 3300046533 Bacteria 1819
465 Ga0495587_0113007 3300046536 Bacteria 1559
466 Ga0495668_0002330 3300046616 Bacteria 15817
467 Ga0495611_0000757 3300046648 Bacteria 18182
468 Ga0495635_0094510 3300046663 Bacteria 2044
469 Ga0495657_0118703 3300046675 Bacteria 1668
470 Ga0495649_0042458 3300046694 Bacteria 2485
471 Ga0495674_0186689 3300047319 Bacteria 1725
472 Ga0495687_000243 3300047443 Bacteria 75026
473 Ga0495686_0000058 3300047472 Bacteria 240089
474 Ga0496110_0064729 3300048913 Bacteria 3232
475 Ga0501036_0157831 3300049572 Bacteria 1913
476 Ga0501038_0161668 3300049574 Bacteria 1819
477 Ga0501039_0404134 3300049575 Bacteria 1072
478 Ga0501043_0263951 3300049579 Bacteria 1323
479 Ga0501035_0255261 3300049822 Bacteria 1488
480 Ga0501044_0342449 3300049823 Bacteria 1416
481 Ga0501044_0372544 3300049823 Bacteria 1344
482 nmdc:mga0k408_146230_c1 3300050493 Bacteria 1407
483 nmdc:mga0k408_32912_c1 3300050493 Bacteria 2962
484 nmdc:mga05p37_1882_c2 3300050507 Bacteria 12283
485 nmdc:mga0n895_163541_c1 3300050512 Bacteria 2257
486 Ga0495619_0025822 3300053085 Bacteria 3776
487 Ga0495619_0099374 3300053085 Bacteria 1979
488 Ga0500644_0001023 3300053088 Bacteria 8471
489 Ga0500644_0050380 3300053088 Unclassified 1425
490 Ga0500583_0000130 3300053092 Bacteria 34913
491 Ga0500583_0027754 3300053092 Bacteria 2447
492 Ga0500556_0042662 3300053104 Bacteria 1606
493 Ga0500569_016919 3300053109 Bacteria 1855
494 Ga0500607_085368 3300053121 Bacteria 1601
495 Ga0500568_0016887 3300053139 Bacteria 3233
496 Ga0500577_0001108 3300053142 Bacteria 6905
497 Ga0500616_0037646 3300053153 Bacteria 2618
498 Ga0500622_0001340 3300053156 Bacteria 19939
499 Ga0500633_0000876 3300053160 Bacteria 5234
500 Ga0500639_116691 3300053163 Bacteria 1289
501 Ga0500636_0013903 3300053177 Bacteria 4732
502 Ga0500661_016977 3300055283 Bacteria 1300
503 Ga0590075_012136 3300059424 Bacteria 2091
504 2738729397 2738541278 Bacteria 9755573
505 2819574270 2818991442 Bacteria 8318214
506 2819678090 2818991460 Bacteria 7595395
507 2821137592 2821136567 Bacteria 8080116
508 2904467669 2904467357 Bacteria 8057758
509 2929181203 2929177148 Bacteria 7883697
510 2929242090 2929239360 Bacteria 7745570
511 2929925037 2929921140 Bacteria 8649150
512 2945983607 2945977869 Bacteria 7777518
513 2946017005 2946013367 Bacteria 7766675
514 8003157386 8003151029 Bacteria 8187759
515 Ga0501034_0178721
516 MBSR1b_contig_1241678
517 JGI24740J21852_10035446
518 JGI24739J22299_10002579
519 JGI25154J39366_1000044
520 JGI25153J46596_10002544
521 rootH1_10011351
522 rootH2_10012322
523 rootH2_10164000
524 rootH2_10242392
525 rootH2_10244277
526 rootH2_10250364
527 rootL2_10032456
528 rootL2_10032457
529 rootL2_10065582
530 rootL2_10081580
531 rootL2_10246027
532 rootH1_10003031
533 rootH1_10029642
534 rootH1_10033682
535 rootH1_10037018
536 rootH1_10104240
537 rootH1_10227837
538 JGI25160J50197_1001989
539 JGI25160J50197_1002581
540 JGI25160J50197_1010862
541 Ga0055535_1005094
542 Ga0055528_1000613
543 Ga0055530_10007725
544 Ga0065165_1000017
545 Ga0065712_10098484
546 Ga0065712_10112528
547 Ga0065715_10139484
548 Ga0070676_10033491
549 Ga0070683_100001617
550 Ga0070683_100002162
551 Ga0070683_100365501
552 Ga0070690_100004429
553 Ga0070690_100121117
554 Ga0068869_100003906
555 Ga0068869_100010369
556 Ga0068869_100014244
557 Ga0068869_100059454
558 Ga0068869_100193110
559 Ga0068869_100258081
560 Ga0070666_10000140
561 Ga0070666_10032037
562 Ga0070666_10050012
563 Ga0070666_10062915
564 Ga0070666_10064695
565 Ga0070682_100100072
566 Ga0070682_100139662
567 Ga0068868_100026705
568 Ga0070660_100015788
569 Ga0070660_100066195
570 Ga0070689_100022568
571 Ga0070689_100035453
572 Ga0070689_100135157
573 Ga0070687_100005789
574 Ga0070661_100001586
575 Ga0070661_100008231
576 Ga0070661_100061333
577 Ga0070661_100119731
578 Ga0070668_100047032
579 Ga0070668_100181665
580 Ga0070668_100253559
581 Ga0070669_100039131
582 Ga0070675_100019678
583 Ga0070675_100036552
584 Ga0070675_100291118
585 Ga0070671_100028010
586 Ga0070671_100048428
587 Ga0070671_100186187
588 Ga0070674_100020801
589 Ga0070674_100030119
590 Ga0070674_100056169
591 Ga0070674_100063304
592 Ga0070673_100004111
593 Ga0070673_100005988
594 Ga0070673_100025838
595 Ga0070673_100031047
596 Ga0070673_100339999
597 Ga0070688_100012562
598 Ga0070688_100049164
599 Ga0070659_100023662
600 Ga0070659_100025806
601 Ga0070667_100041537
602 Ga0070667_100052707
603 Ga0070667_100146420
604 Ga0070667_100230658
605 Ga0070700_100084368
606 Ga0070700_100228593
607 Ga0070678_100024931
608 Ga0070678_100037951
609 Ga0070662_100017694
610 Ga0070662_100051579
611 Ga0070681_10044366
612 Ga0068867_100029486
613 Ga0068867_100041719
614 Ga0068867_100080440
615 Ga0068867_100098160
616 Ga0070684_100003375
617 Ga0070684_100010652
618 Ga0070684_100034332
619 Ga0070684_100119759
620 Ga0068853_100008148
621 Ga0068853_100028239
622 Ga0068853_100044239
623 Ga0068853_100107471
624 Ga0070672_100026793
625 Ga0070686_100346138
626 Ga0070693_100015081
627 Ga0068855_100006158
628 Ga0068855_100018500
629 Ga0068855_100296816
630 Ga0070664_100066182
631 Ga0070664_100080813
632 Ga0070664_100116152
633 Ga0068857_100003177
634 Ga0068857_100004921
635 Ga0068857_100010896
636 Ga0068857_100019349
637 Ga0068854_100017891
638 Ga0068854_100065810
639 Ga0068856_100010061
640 Ga0068856_100021433
641 Ga0068856_100190823
642 Ga0070702_100017427
643 Ga0068852_100000666
644 Ga0068852_100026872
645 Ga0068852_100036307
646 Ga0068852_100383736
647 Ga0068859_100000106
648 Ga0068859_100027807
649 Ga0068859_100048213
650 Ga0068859_100058062
651 Ga0068859_100124166
652 Ga0068864_100007661
653 Ga0068864_100008534
654 Ga0068864_100211340
655 Ga0068864_100475044
656 Ga0068861_100010318
657 Ga0068851_10062666
658 Ga0068870_10014710
659 Ga0068870_10015411
660 Ga0068870_10022466
661 Ga0068863_100023871
662 Ga0068863_100240712
663 Ga0068858_100029798
664 Ga0068858_100320633
665 Ga0068858_100454369
666 Ga0068860_100000005
667 Ga0068860_100001506
668 Ga0068860_100001954
669 Ga0068860_100002082
670 Ga0068860_100010218
671 Ga0068860_100091578
672 Ga0081540_1014988
673 Ga0081539_10027293
674 Ga0075366_10067836
675 Ga0075366_10105612
676 Ga0075366_10212098
677 Ga0097621_100014046
678 Ga0097621_100063353
679 Ga0097621_100115819
680 Ga0097621_100117194
681 Ga0068871_100055921
682 Ga0068871_100128722
683 Ga0075434_100132604
684 Ga0097620_100000106
685 Ga0097620_100027808
686 Ga0097620_100048216
687 Ga0097620_100058062
688 Ga0097620_100124163
689 Ga0105240_10000100
690 Ga0105240_10000268
691 Ga0105240_10001525
692 Ga0105240_10004766
693 Ga0105240_10005272
694 Ga0105240_10025992
695 Ga0105240_10042769
696 Ga0105240_10047893
697 Ga0105240_10099497
698 Ga0111539_10436061
699 Ga0105247_10002808
700 Ga0114129_10042079
701 Ga0105241_10001027
702 Ga0105241_10004620
703 Ga0105241_10100438
704 Ga0105241_10136864
705 Ga0105241_10174635
706 Ga0105241_10428330
707 Ga0105242_10093828
708 Ga0105242_10116486
709 Ga0105248_10325336
710 Ga0105237_10001534
711 Ga0105237_10006014
712 Ga0105237_10013269
713 Ga0105237_10014907
714 Ga0105237_10019257
715 Ga0105237_10029971
716 Ga0105238_10018791
717 Ga0105238_10020919
718 Ga0105238_10054844
719 Ga0105249_10011207
720 Ga0105239_10000811
721 Ga0105239_10001950
722 Ga0105239_10003047
723 Ga0105239_10003552
724 Ga0105239_10059626
725 Ga0105239_10116978
726 Ga0105246_10072441
727 Ga0105246_10156531
728 Ga0105246_10290913
729 Ga0157373_10046899
730 Ga0157370_10000536
731 Ga0157370_10158231
732 Ga0157370_10205042
733 Ga0157369_10029881
734 Ga0157369_10091760
735 Ga0157369_10190393
736 Ga0157374_10000607
737 Ga0157374_10015745
738 Ga0157374_10030025
739 Ga0157374_10545879
740 Ga0157378_10007350
741 Ga0157378_10021460
742 Ga0157378_10036442
743 Ga0157378_10112564
744 Ga0163162_10001924
745 Ga0163162_10002494
746 Ga0163162_10003034
747 Ga0163162_10009578
748 Ga0163162_10032966
749 Ga0163162_10052248
750 Ga0163162_10078475
751 Ga0163162_10208056
752 Ga0163162_10401368
753 Ga0157372_10000052
754 Ga0157372_10003732
755 Ga0157372_10591204
756 Ga0157375_10002714
757 Ga0157375_10010451
758 Ga0157375_10037882
759 Ga0157375_10063712
760 Ga0157375_10076611
761 Ga0157375_10098582
762 Ga0157375_10100836
763 Ga0157375_10148556
764 Ga0157375_10184024
765 Ga0163163_10000078
766 Ga0163163_10163398
767 Ga0157380_10009590
768 Ga0157377_10001358
769 Ga0157377_10090760
770 Ga0157379_10029468
771 Ga0157379_10079331
772 Ga0157379_10297269
773 Ga0157376_10002017
774 Ga0157376_10014323
775 Ga0157376_10319461
776 Ga0182005_1000058
777 Ga0163161_10200565
778 Ga0163161_10430781
779 Ga0209436_102457
780 Ga0209436_104746
781 Ga0209258_100628
782 Ga0209646_1000006
783 Ga0209026_1000262
784 Ga0209148_1000559
785 Ga0209673_1000354
786 Ga0209564_1009024
787 Ga0209564_1016119
788 Ga0209758_1002136
789 Ga0209758_1016610
790 Ga0209758_1016817
791 Ga0209050_1000163
792 Ga0207426_1000060
793 Ga0207426_1000096
794 Ga0207426_1002638
795 Ga0207426_1004315
796 Ga0209257_1003391
797 Ga0207697_10032668
798 Ga0207697_10084532
799 Ga0207642_10016562
800 Ga0207710_10016555
801 Ga0207688_10195857
802 Ga0207680_10000140
803 Ga0207680_10232922
804 Ga0207680_10246352
805 Ga0207647_10037784
806 Ga0207647_10171114
807 Ga0207645_10001767
808 Ga0207645_10003739
809 Ga0207643_10022918
810 Ga0207654_10003026
811 Ga0207654_10060003
812 Ga0207654_10156718
813 Ga0207654_10244590
814 Ga0207707_10118721
815 Ga0207695_10000027
816 Ga0207695_10000073
817 Ga0207695_10000164
818 Ga0207695_10002078
819 Ga0207695_10026599
820 Ga0207695_10026947
821 Ga0207671_10000499
822 Ga0207671_10005845
823 Ga0207671_10010037
824 Ga0207671_10010941
825 Ga0207671_10011844
826 Ga0207671_10014729
827 Ga0207671_10026173
828 Ga0207662_10002457
829 Ga0207657_10088030
830 Ga0207657_10128632
831 Ga0207649_10003797
832 Ga0207649_10152557
833 Ga0207681_10047510
834 Ga0207681_10108424
835 Ga0207694_10008864
836 Ga0207694_10041674
837 Ga0207694_10050605
838 Ga0207650_10207200
839 Ga0207659_10016489
840 Ga0207659_10170146
841 Ga0207659_10193013
842 Ga0207687_10186949
843 Ga0207644_10050060
844 Ga0207690_10034234
845 Ga0207706_10002220
846 Ga0207706_10003282
847 Ga0207706_10031421
848 Ga0207706_10039001
849 Ga0207706_10489007
850 Ga0207686_10115374
851 Ga0207686_10351897
852 Ga0207670_10002410
853 Ga0207670_10049466
854 Ga0207669_10242189
855 Ga0207691_10021576
856 Ga0207691_10027880
857 Ga0207691_10036026
858 Ga0207691_10084053
859 Ga0207689_10002252
860 Ga0207689_10003471
861 Ga0207689_10009081
862 Ga0207689_10014246
863 Ga0207689_10034962
864 Ga0207689_10037992
865 Ga0207689_10070182
866 Ga0207689_10084161
867 Ga0207689_10369478
868 Ga0207661_10247104
869 Ga0207661_10277733
870 Ga0207661_10459465
871 Ga0207679_10000691
872 Ga0207679_10037343
873 Ga0207679_10145215
874 Ga0207679_10216861
875 Ga0207679_10424738
876 Ga0207667_10003747
877 Ga0207667_10011842
878 Ga0207667_10024231
879 Ga0207667_10027221
880 Ga0207667_10058445
881 Ga0207667_10207072
882 Ga0207651_10013688
883 Ga0207651_10088174
884 Ga0207712_10009144
885 Ga0207668_10150167
886 Ga0207668_10175041
887 Ga0207640_10014805
888 Ga0207640_10082410
889 Ga0207640_10109270
890 Ga0207658_10157610
891 Ga0207658_10271364
892 Ga0207677_10258382
893 Ga0207703_10009480
894 Ga0207703_10080500
895 Ga0207639_10062125
896 Ga0207639_10140156
897 Ga0207639_10225712
898 Ga0207708_10252646
899 Ga0207702_10027264
900 Ga0207702_10038820
901 Ga0207702_10195768
902 Ga0207702_10278384
903 Ga0207641_10000082
904 Ga0207648_10005538
905 Ga0207648_10058729
906 Ga0207648_10066891
907 Ga0207648_10069474
908 Ga0207648_10270643
909 Ga0207676_10004052
910 Ga0207676_10004389
911 Ga0207676_10233445
912 Ga0207674_10003192
913 Ga0207674_10003943
914 Ga0207674_10037879
915 Ga0207674_10178985
916 Ga0207675_100004261
917 Ga0207675_100068146
918 Ga0207675_100302592
919 Ga0207683_10003686
920 Ga0207683_10003995
921 Ga0207698_10004607
922 Ga0207698_10157375
923 Ga0207698_10186015
924 Ga0268266_10000010
925 Ga0268266_10079258
926 Ga0268266_10254220
927 Ga0268265_10011306
928 Ga0268264_10000012
929 Ga0268264_10000810
930 Ga0268264_10002219
931 Ga0268264_10011333
932 Ga0268264_10029788
933 Ga0268264_10265677
934 Ga0307517_10014107
935 Ga0307515_10000412
936 Ga0265324_10013561
937 Ga0307511_10001438
938 Ga0265327_10040995
939 Ga0307513_10197111
940 Ga0307513_10273799
941 Ga0307509_10013165
942 Ga0307509_10066428
943 Ga0307509_10280633
944 Ga0307516_10000292
945 Ga0307510_10001319
946 Ga0373934_0077619
947 Ga0373943_0085612
948 Ga0373955_0064341
949 Ga0373924_0038261
950 Ga0373935_0161516
951 Ga0373933_0010042
952 Ga0373937_0041443
953 Ga0373925_0133175
954 Ga0439436_0005330
955 Ga0451841_0111009
956 Ga0439457_005435
957 Ga0439462_0020163
958 Ga0466969_0006579
959 Ga0466972_0000183
960 Ga0466972_0000893
961 Ga0466965_0053607
962 Ga0466966_0000053
963 Ga0466964_0124579
964 Ga0466968_0021115
965 Ga0466957_0002049
966 Ga0466960_0142484
967 Ga0466960_0183565
968 Ga0466959_0000005
969 Ga0466959_0014142
970 Ga0466958_0113644
971 Ga0466967_0121154
972 Ga0495650_0085702
973 Ga0495664_0194302
974 Ga0495608_0029767
975 Ga0495618_0080252
976 Ga0495628_0080503
977 Ga0495630_0009105
978 Ga0495640_0108190
979 Ga0495587_0113007
980 Ga0495668_0002330
981 Ga0495611_0000757
982 Ga0495635_0094510
983 Ga0495657_0118703
984 Ga0495649_0042458
985 Ga0495674_0186689
986 Ga0495687_000243
987 Ga0495686_0000058
988 Ga0496110_0064729
989 Ga0501036_0157831
990 Ga0501038_0161668
991 Ga0501039_0404134
992 Ga0501043_0263951
993 Ga0501035_0255261
994 Ga0501044_0342449
995 Ga0501044_0372544
996 nmdc:mga0k408_146230_c1
997 nmdc:mga0k408_32912_c1
998 nmdc:mga05p37_1882_c2
999 nmdc:mga0n895_163541_c1
1000 Ga0495619_0025822
1001 Ga0495619_0099374
1002 Ga0500644_0001023
1003 Ga0500644_0050380
1004 Ga0500583_0000130
1005 Ga0500583_0027754
1006 Ga0500556_0042662
1007 Ga0500569_016919
1008 Ga0500607_085368
1009 Ga0500568_0016887
1010 Ga0500577_0001108
1011 Ga0500616_0037646
1012 Ga0500622_0001340
1013 Ga0500633_0000876
1014 Ga0500639_116691
1015 Ga0500636_0013903
1016 Ga0500661_016977
1017 Ga0590075_012136
1018 2738729397
1019 2819574270
1020 2819678090
1021 2821137592
1022 2904467669
1023 2929181203
1024 2929242090
1025 2929925037
1026 2945983607
1027 2946017005
1028 8003157386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17655

IRK_C

Inward rectifier potassium channel C-terminal domain

225

375

0.85

PF07885

Ion_trans_2

Ion channel

129

220

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wll-assembly1.cif.gz_A-2 potassium channel from burkholderia pseudomallei 0.9063 39 317
2wll-assembly1.cif.gz_B-2 potassium channel from burkholderia pseudomallei 0.8974 36 317
2e4f-assembly1.cif.gz_A crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 0.8879 163 317
2wll-assembly1.cif.gz_B-2 potassium channel from burkholderia pseudomallei 0.8879 36 317
3atf-assembly1.cif.gz_A crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 200 mm cesium chloride) 0.8846 162 319
ID Description Score Start End Superfamily
2wlkA02 Mainly Beta;Sandwich;Immunoglobulin-like;G protein-activated inward rectifier potassium channel 1 0.9482 159 316 2.60.40.1400
2wllB02 Mainly Beta;Sandwich;Immunoglobulin-like;G protein-activated inward rectifier potassium channel 1 0.9447 159 317 2.60.40.1400
2wllB02 Mainly Beta;Sandwich;Immunoglobulin-like;G protein-activated inward rectifier potassium channel 1 0.9386 159 317 2.60.40.1400
af_V6CLK4_431_688_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9331 103 152 1.10.287.70
af_Q9NPI9_175_353_2.60.40.1400 Mainly Beta;Sandwich;Immunoglobulin-like;G protein-activated inward rectifier potassium channel 1 0.9187 161 317 2.60.40.1400
ID Description Score Start End GO Terms
AF-A0A2R7KU32-F1-model_v4 Inward rectifier potassium channel Irk 0.9749 193 317 GO:0005242
GO:0005886
GO:0034702
GO:0034765
GO:1990573
AF-A0A4Q3P6M8-F1-model_v4 deleted 0.9606 160 317
AF-A0A4Q3PRG0-F1-model_v4 deleted 0.9589 157 318
AF-A0A4R4DZ52-F1-model_v4 Inward rectifier potassium channel Irk 0.9574 9 318 GO:0005242
GO:0005886
GO:0034702
GO:0034765
GO:1990573
AF-A0A1G9Q068-F1-model_v4 deleted 0.9555 152 318

Map