F457904

General Info

Members Datasets Scaffolds Average Seq Length
515 152 1030 306

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000520|Ga0495686_0000520_52719_53675
Length 318
Sequence VITPAFPRRLGIAVVAPAGYAPEPEAVERGIARLAAQGILVHNYYRHDARHQRFGGTDAERLAQLDAAVANPDVQIVMALRGAYGLTRLLPHIDFDRMADSGKLFVGFSDVTAFQMALYQRRRTISYAGPMFAGDFGAVEPVAFTLDDFWSCLAGPTHTISGQGAGNPALDVSGTVWGGNLAMIVSLLGTPYFPRIDDGILWLEDIAEHPYRVERMLLQLMQAGVLERQRAIVLGDFSGYRLGPMDNGYDFDAMLAYLRATLPCPVLTGLEFGHIPKRVTIPFGAQGRLASRADGWTLTLSDYPTIAAIASDVVQETQ

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
12 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
13 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
16 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
27 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
34 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
35 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
36 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
37 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
38 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
39 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
40 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
53 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
54 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
55 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
73 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
74 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
75 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
76 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
77 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
78 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 2643221556 Massilia sp. Root1485 Isolate Unclassified
150 2643221684 Massilia sp. Root133 Isolate Unclassified
151 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
152 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0.97
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 4.85
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000520 3300047472 Bacteria 55657
2 rootL2_10092551 3300003322 Bacteria 5791
3 rootL2_10157734 3300003322 Bacteria 1226
4 Ga0007416J51690_1011110 3300003577 Bacteria 1969
5 Ga0055525_1000008 3300003759 Bacteria 604287
6 Ga0065165_1009734 3300005262 Bacteria 4257
7 Ga0070658_10146438 3300005327 Bacteria 1975
8 Ga0070658_10287997 3300005327 Bacteria 1399
9 Ga0070660_100011016 3300005339 Bacteria 6408
10 Ga0070660_100043070 3300005339 Bacteria 3448
11 Ga0070659_100020393 3300005366 Bacteria 5033
12 Ga0070659_100138625 3300005366 Bacteria 1979
13 Ga0068855_100005493 3300005563 Bacteria 15466
14 Ga0070664_100126498 3300005564 Bacteria 2242
15 Ga0070664_100169450 3300005564 Bacteria 1936
16 Ga0068871_100281489 3300006358 Bacteria 1455
17 Ga0105241_10046123 3300009174 Bacteria 3309
18 Ga0105242_10019597 3300009176 Bacteria 5302
19 Ga0105239_10475450 3300010375 Bacteria 1419
20 Ga0157371_10000161 3300013102 Bacteria 98412
21 Ga0157371_10296495 3300013102 Bacteria 1170
22 Ga0209563_100003 3300025230 Bacteria 1932942
23 Ga0209677_104676 3300025253 Bacteria 3861
24 Ga0209148_1001061 3300025254 Bacteria 16916
25 Ga0207705_10015246 3300025909 Bacteria 5519
26 Ga0207705_10135776 3300025909 Bacteria 1834
27 Ga0207654_10047576 3300025911 Bacteria 2451
28 Ga0207657_10002545 3300025919 Bacteria 19715
29 Ga0207657_10014526 3300025919 Bacteria 7679
30 Ga0207657_10152251 3300025919 Bacteria 1883
31 Ga0207649_10097025 3300025920 Bacteria 1943
32 Ga0207706_10097183 3300025933 Bacteria 2590
33 Ga0207706_10230616 3300025933 Bacteria 1620
34 Ga0207679_10051628 3300025945 Bacteria 3010
35 Ga0207667_10072828 3300025949 Bacteria 3571
36 Ga0316177_1042298 3300030731 Bacteria 8635
37 Ga0316182_1222243 3300030745 Bacteria 2961
38 Ga0395899_0006673 3300037312 Bacteria 8941
39 Ga0395899_0007027 3300037312 Bacteria 8709
40 Ga0395899_0019247 3300037312 Bacteria 5189
41 Ga0395899_0115746 3300037312 Bacteria 1924
42 Ga0395900_0000164 3300037418 Bacteria 108590
43 Ga0395900_0000177 3300037418 Bacteria 102548
44 Ga0395900_0022632 3300037418 Bacteria 6431
45 Ga0395900_0072764 3300037418 Bacteria 3533
46 Ga0395900_0084154 3300037418 Bacteria 3268
47 Ga0395900_0095262 3300037418 Bacteria 3058
48 Ga0395900_0195351 3300037418 Bacteria 2050
49 Ga0395900_0254642 3300037418 Bacteria 1755
50 Ga0395898_0019774 3300037466 Bacteria 6848
51 Ga0395898_0234112 3300037466 Bacteria 1751
52 Ga0395898_0320155 3300037466 Bacteria 1479
53 Ga0395898_0550969 3300037466 Bacteria 1095
54 Ga0395905_0049660 3300037471 Bacteria 3931
55 Ga0395905_0058996 3300037471 Bacteria 3588
56 Ga0395905_0063783 3300037471 Bacteria 3447
57 Ga0395905_0065045 3300037471 Bacteria 3413
58 Ga0395901_0000226 3300038443 Bacteria 70810
59 Ga0395901_0000263 3300038443 Bacteria 65735
60 Ga0395901_0605353 3300038443 Bacteria 1104
61 Ga0439448_0005530 3300042005 Bacteria 3604
62 Ga0439448_0020026 3300042005 Bacteria 2066
63 Ga0439449_0060086 3300042007 Bacteria 1402
64 Ga0439450_010014 3300042008 Bacteria 1816
65 Ga0439455_0000762 3300042012 Bacteria 4835
66 Ga0450904_004173 3300042139 Bacteria 1515
67 Ga0439458_0010555 3300042157 Bacteria 2060
68 Ga0466969_0053320 3300044656 Bacteria 1984
69 Ga0466969_0088902 3300044656 Bacteria 1466
70 Ga0466972_0057857 3300044658 Bacteria 1862
71 Ga0466965_0025248 3300044683 Bacteria 2876
72 Ga0466965_0046548 3300044683 Bacteria 2147
73 Ga0466965_0069602 3300044683 Bacteria 1768
74 Ga0466966_0031760 3300044684 Bacteria 3424
75 Ga0466966_0061932 3300044684 Bacteria 2359
76 Ga0466966_0075077 3300044684 Bacteria 2112
77 Ga0466961_0166187 3300044693 Bacteria 1373
78 Ga0466963_0160209 3300044694 Bacteria 1566
79 Ga0466964_0000062 3300044706 Bacteria 23341
80 Ga0466964_0040409 3300044706 Bacteria 1883
81 Ga0466964_0120173 3300044706 Bacteria 1183
82 Ga0466968_0016708 3300044735 Bacteria 2924
83 Ga0466968_0043191 3300044735 Bacteria 1907
84 Ga0466957_0003314 3300044842 Bacteria 8821
85 Ga0466957_0079937 3300044842 Bacteria 2035
86 Ga0466957_0277649 3300044842 Bacteria 1120
87 Ga0466960_0171208 3300044901 Bacteria 1172
88 Ga0466959_0104831 3300045049 Bacteria 2022
89 Ga0466959_0267960 3300045049 Bacteria 1174
90 Ga0466958_0151161 3300045836 Bacteria 1464
91 Ga0466967_0009705 3300045976 Bacteria 7164
92 Ga0466967_0260093 3300045976 Bacteria 1660
93 Ga0466967_0396137 3300045976 Bacteria 1343
94 Ga0495617_000001 3300046452 Bacteria 877032
95 Ga0495627_000035 3300046453 Bacteria 213698
96 Ga0495627_003986 3300046453 Bacteria 6301
97 Ga0495590_0000015 3300046457 Bacteria 241989
98 Ga0495590_0000267 3300046457 Bacteria 28492
99 Ga0495590_0035258 3300046457 Bacteria 1747
100 Ga0495590_0075610 3300046457 Bacteria 1185
101 Ga0495591_000033 3300046458 Bacteria 171402
102 Ga0495629_0009409 3300046459 Bacteria 7146
103 Ga0495638_0004822 3300046460 Bacteria 10160
104 Ga0495653_0067520 3300046463 Bacteria 2685
105 Ga0495653_0109071 3300046463 Bacteria 1992
106 Ga0495653_0190569 3300046463 Bacteria 1399
107 Ga0495650_0000001 3300046471 Bacteria 1085492
108 Ga0495650_0000233 3300046471 Bacteria 113132
109 Ga0495650_0010790 3300046471 Bacteria 5071
110 Ga0495582_0006886 3300046473 Bacteria 6318
111 Ga0495582_0013646 3300046473 Bacteria 4472
112 Ga0495605_0000227 3300046474 Bacteria 69646
113 Ga0495605_0000303 3300046474 Bacteria 52803
114 Ga0495605_0005359 3300046474 Bacteria 7475
115 Ga0495605_0017890 3300046474 Bacteria 3807
116 Ga0495605_0020027 3300046474 Bacteria 3560
117 Ga0495605_0036977 3300046474 Bacteria 2458
118 Ga0495605_0090215 3300046474 Bacteria 1421
119 Ga0495584_0000175 3300046491 Bacteria 45105
120 Ga0495584_0000664 3300046491 Bacteria 22887
121 Ga0495584_0004372 3300046491 Bacteria 7610
122 Ga0495584_0005252 3300046491 Bacteria 6864
123 Ga0495584_0011634 3300046491 Bacteria 4505
124 Ga0495584_0022537 3300046491 Bacteria 3194
125 Ga0495584_0037452 3300046491 Bacteria 2451
126 Ga0495584_0040461 3300046491 Bacteria 2354
127 Ga0495584_0064533 3300046491 Bacteria 1841
128 Ga0495584_0107829 3300046491 Bacteria 1408
129 Ga0495584_0108419 3300046491 Bacteria 1404
130 Ga0495584_0109945 3300046491 Bacteria 1394
131 Ga0495585_0000003 3300046492 Bacteria 406344
132 Ga0495585_0000039 3300046492 Bacteria 131202
133 Ga0495585_0000257 3300046492 Bacteria 54605
134 Ga0495585_0003587 3300046492 Bacteria 10413
135 Ga0495585_0006887 3300046492 Bacteria 7005
136 Ga0495585_0007938 3300046492 Bacteria 6452
137 Ga0495585_0014637 3300046492 Bacteria 4564
138 Ga0495585_0018345 3300046492 Bacteria 4036
139 Ga0495585_0024222 3300046492 Bacteria 3482
140 Ga0495585_0037013 3300046492 Bacteria 2749
141 Ga0495585_0068153 3300046492 Bacteria 1944
142 Ga0495585_0091298 3300046492 Bacteria 1639
143 Ga0495585_0121499 3300046492 Bacteria 1381
144 Ga0495585_0127120 3300046492 Bacteria 1344
145 Ga0495585_0133013 3300046492 Bacteria 1307
146 Ga0495594_0004722 3300046499 Bacteria 7022
147 Ga0495594_0047415 3300046499 Bacteria 2359
148 Ga0495594_0062364 3300046499 Bacteria 2064
149 Ga0495596_0000044 3300046500 Bacteria 90299
150 Ga0495596_0000502 3300046500 Bacteria 24831
151 Ga0495596_0005902 3300046500 Bacteria 5715
152 Ga0495596_0007820 3300046500 Bacteria 4795
153 Ga0495596_0009546 3300046500 Bacteria 4264
154 Ga0495596_0011125 3300046500 Bacteria 3891
155 Ga0495596_0013357 3300046500 Bacteria 3486
156 Ga0495596_0013588 3300046500 Bacteria 3447
157 Ga0495596_0018540 3300046500 Bacteria 2866
158 Ga0495596_0024541 3300046500 Bacteria 2440
159 Ga0495596_0027645 3300046500 Bacteria 2279
160 Ga0495596_0027885 3300046500 Bacteria 2268
161 Ga0495596_0043442 3300046500 Bacteria 1771
162 Ga0495596_0057882 3300046500 Bacteria 1511
163 Ga0495607_0000759 3300046501 Bacteria 30931
164 Ga0495607_0001344 3300046501 Bacteria 21924
165 Ga0495607_0005929 3300046501 Bacteria 8665
166 Ga0495607_0015004 3300046501 Bacteria 5034
167 Ga0495607_0023659 3300046501 Bacteria 3842
168 Ga0495607_0054461 3300046501 Bacteria 2305
169 Ga0495607_0083069 3300046501 Bacteria 1755
170 Ga0495607_0146817 3300046501 Bacteria 1211
171 Ga0495583_0000243 3300046506 Bacteria 89875
172 Ga0495583_0000266 3300046506 Bacteria 85810
173 Ga0495583_0000292 3300046506 Bacteria 79152
174 Ga0495583_0000999 3300046506 Bacteria 32381
175 Ga0495583_0001599 3300046506 Bacteria 22251
176 Ga0495583_0012600 3300046506 Bacteria 4773
177 Ga0495583_0017116 3300046506 Bacteria 3862
178 Ga0495583_0031921 3300046506 Bacteria 2547
179 Ga0495583_0038858 3300046506 Bacteria 2246
180 Ga0495606_0008876 3300046507 Bacteria 8611
181 Ga0495606_0015655 3300046507 Bacteria 5827
182 Ga0495606_0035387 3300046507 Bacteria 3413
183 Ga0495606_0118724 3300046507 Bacteria 1585
184 Ga0495610_0000318 3300046512 Bacteria 51226
185 Ga0495610_0070697 3300046512 Bacteria 1629
186 Ga0495616_0000510 3300046513 Bacteria 29511
187 Ga0495616_0001728 3300046513 Bacteria 14883
188 Ga0495616_0008431 3300046513 Bacteria 6107
189 Ga0495616_0009897 3300046513 Bacteria 5544
190 Ga0495616_0019906 3300046513 Bacteria 3656
191 Ga0495616_0024372 3300046513 Bacteria 3245
192 Ga0495616_0028521 3300046513 Bacteria 2955
193 Ga0495616_0030091 3300046513 Bacteria 2857
194 Ga0495616_0040100 3300046513 Bacteria 2395
195 Ga0495616_0069290 3300046513 Bacteria 1710
196 Ga0495616_0070154 3300046513 Bacteria 1697
197 Ga0495616_0074482 3300046513 Bacteria 1636
198 Ga0495616_0088751 3300046513 Bacteria 1467
199 Ga0495616_0101907 3300046513 Bacteria 1345
200 Ga0495630_0072302 3300046517 Bacteria 2596
201 Ga0495631_0000367 3300046518 Bacteria 31010
202 Ga0495631_0000658 3300046518 Bacteria 22317
203 Ga0495631_0001307 3300046518 Bacteria 15264
204 Ga0495631_0006206 3300046518 Bacteria 6189
205 Ga0495631_0008493 3300046518 Bacteria 5176
206 Ga0495631_0008586 3300046518 Bacteria 5143
207 Ga0495631_0018146 3300046518 Bacteria 3316
208 Ga0495631_0020590 3300046518 Bacteria 3080
209 Ga0495631_0021924 3300046518 Bacteria 2972
210 Ga0495631_0030982 3300046518 Bacteria 2423
211 Ga0495631_0057503 3300046518 Bacteria 1692
212 Ga0495631_0063559 3300046518 Bacteria 1598
213 Ga0495631_0069458 3300046518 Bacteria 1523
214 Ga0495631_0073572 3300046518 Bacteria 1475
215 Ga0495631_0090315 3300046518 Bacteria 1319
216 Ga0495631_0105010 3300046518 Bacteria 1215
217 Ga0495631_0150578 3300046518 Bacteria 998
218 Ga0495632_0000084 3300046519 Bacteria 96469
219 Ga0495632_0000116 3300046519 Bacteria 81523
220 Ga0495632_0001227 3300046519 Bacteria 21783
221 Ga0495632_0001970 3300046519 Bacteria 16312
222 Ga0495632_0004895 3300046519 Bacteria 8975
223 Ga0495637_0000002 3300046520 Bacteria 629280
224 Ga0495637_0039658 3300046520 Bacteria 2031
225 Ga0495643_0001196 3300046522 Bacteria 25287
226 Ga0495643_0003602 3300046522 Bacteria 11256
227 Ga0495643_0006119 3300046522 Bacteria 7997
228 Ga0495643_0007851 3300046522 Bacteria 6820
229 Ga0495643_0021719 3300046522 Bacteria 3675
230 Ga0495643_0101096 3300046522 Bacteria 1477
231 Ga0495644_0010026 3300046523 Bacteria 3650
232 Ga0495644_0018122 3300046523 Bacteria 2688
233 Ga0495644_0023110 3300046523 Bacteria 2367
234 Ga0495644_0059666 3300046523 Bacteria 1434
235 Ga0495644_0061349 3300046523 Bacteria 1413
236 Ga0495644_0074465 3300046523 Bacteria 1277
237 Ga0495648_0000171 3300046524 Bacteria 74494
238 Ga0495648_0001531 3300046524 Bacteria 22612
239 Ga0495648_0006637 3300046524 Bacteria 9377
240 Ga0495648_0012793 3300046524 Bacteria 6232
241 Ga0495648_0021397 3300046524 Bacteria 4479
242 Ga0495648_0023248 3300046524 Bacteria 4250
243 Ga0495648_0032126 3300046524 Bacteria 3449
244 Ga0495648_0039072 3300046524 Bacteria 3024
245 Ga0495648_0064838 3300046524 Bacteria 2150
246 Ga0495648_0071620 3300046524 Bacteria 2008
247 Ga0495663_0002595 3300046525 Bacteria 5387
248 Ga0495663_0026878 3300046525 Bacteria 1686
249 Ga0495666_0001479 3300046526 Bacteria 11479
250 Ga0495666_0036215 3300046526 Bacteria 2403
251 Ga0495642_0000429 3300046528 Bacteria 22212
252 Ga0495642_0002815 3300046528 Bacteria 6962
253 Ga0495642_0003721 3300046528 Bacteria 5981
254 Ga0495642_0005385 3300046528 Bacteria 4910
255 Ga0495642_0006461 3300046528 Bacteria 4497
256 Ga0495642_0008833 3300046528 Bacteria 3853
257 Ga0495642_0012458 3300046528 Bacteria 3278
258 Ga0495642_0017829 3300046528 Bacteria 2774
259 Ga0495642_0019442 3300046528 Bacteria 2663
260 Ga0495642_0046000 3300046528 Bacteria 1784
261 Ga0495642_0078884 3300046528 Bacteria 1384
262 Ga0495642_0086130 3300046528 Bacteria 1327
263 Ga0495652_0003096 3300046529 Bacteria 16621
264 Ga0495654_0010326 3300046530 Bacteria 5080
265 Ga0495654_0034863 3300046530 Bacteria 2537
266 Ga0495654_0090219 3300046530 Bacteria 1423
267 Ga0495665_0001496 3300046531 Bacteria 12525
268 Ga0495665_0005329 3300046531 Bacteria 6929
269 Ga0495665_0014012 3300046531 Bacteria 4331
270 Ga0495640_0149762 3300046533 Bacteria 1500
271 Ga0495586_0003280 3300046535 Bacteria 8694
272 Ga0495586_0066245 3300046535 Bacteria 1969
273 Ga0495587_0072098 3300046536 Bacteria 2008
274 Ga0495609_0000001 3300046538 Bacteria 1060094
275 Ga0495609_0001909 3300046538 Bacteria 13292
276 Ga0495609_0006093 3300046538 Bacteria 6204
277 Ga0495609_0007947 3300046538 Bacteria 5241
278 Ga0495609_0020030 3300046538 Bacteria 3092
279 Ga0495609_0027767 3300046538 Bacteria 2585
280 Ga0495609_0070976 3300046538 Bacteria 1530
281 Ga0495597_0000624 3300046542 Bacteria 28935
282 Ga0495597_0001280 3300046542 Bacteria 18503
283 Ga0495597_0003334 3300046542 Bacteria 9466
284 Ga0495597_0004738 3300046542 Bacteria 7367
285 Ga0495597_0006247 3300046542 Bacteria 6176
286 Ga0495597_0015068 3300046542 Bacteria 3666
287 Ga0495597_0027030 3300046542 Bacteria 2633
288 Ga0495597_0074623 3300046542 Bacteria 1456
289 Ga0495597_0087528 3300046542 Bacteria 1325
290 Ga0495597_0087905 3300046542 Bacteria 1322
291 Ga0495645_0077729 3300046543 Bacteria 2386
292 Ga0495622_0008072 3300046557 Bacteria 4881
293 Ga0495622_0009216 3300046557 Bacteria 4568
294 Ga0495622_0048414 3300046557 Bacteria 1975
295 Ga0495633_0000965 3300046558 Bacteria 23609
296 Ga0495633_0002567 3300046558 Bacteria 12727
297 Ga0495633_0002808 3300046558 Bacteria 12041
298 Ga0495633_0016312 3300046558 Bacteria 3833
299 Ga0495633_0046088 3300046558 Bacteria 2063
300 Ga0495633_0051776 3300046558 Bacteria 1934
301 Ga0495633_0061893 3300046558 Bacteria 1752
302 Ga0495633_0074050 3300046558 Bacteria 1587
303 Ga0495633_0124654 3300046558 Bacteria 1192
304 Ga0495656_0028080 3300046615 Bacteria 2254
305 Ga0495656_0044391 3300046615 Bacteria 1871
306 Ga0495668_0000052 3300046616 Bacteria 212864
307 Ga0495668_0000954 3300046616 Bacteria 32115
308 Ga0495668_0001517 3300046616 Bacteria 22084
309 Ga0495668_0006577 3300046616 Bacteria 7584
310 Ga0495668_0011055 3300046616 Bacteria 5425
311 Ga0495668_0013955 3300046616 Bacteria 4723
312 Ga0495668_0020501 3300046616 Bacteria 3803
313 Ga0495668_0035646 3300046616 Bacteria 2788
314 Ga0495668_0036303 3300046616 Bacteria 2761
315 Ga0495668_0055660 3300046616 Bacteria 2184
316 Ga0495668_0072468 3300046616 Bacteria 1892
317 Ga0495634_0010936 3300046642 Bacteria 6623
318 Ga0495611_0003643 3300046648 Bacteria 6754
319 Ga0495611_0009702 3300046648 Bacteria 4069
320 Ga0495611_0016927 3300046648 Bacteria 3117
321 Ga0495611_0017376 3300046648 Bacteria 3077
322 Ga0495611_0021773 3300046648 Bacteria 2770
323 Ga0495611_0031327 3300046648 Bacteria 2340
324 Ga0495611_0032003 3300046648 Bacteria 2317
325 Ga0495611_0060672 3300046648 Bacteria 1718
326 Ga0495625_0023558 3300046660 Bacteria 4701
327 Ga0495625_0035707 3300046660 Bacteria 3661
328 Ga0495625_0050492 3300046660 Bacteria 2985
329 Ga0495625_0292433 3300046660 Bacteria 1045
330 Ga0495635_0010594 3300046663 Bacteria 6452
331 Ga0495661_0000175 3300046665 Bacteria 73957
332 Ga0495661_0000260 3300046665 Bacteria 60822
333 Ga0495661_0002109 3300046665 Bacteria 15599
334 Ga0495661_0002998 3300046665 Bacteria 12732
335 Ga0495661_0006117 3300046665 Bacteria 8479
336 Ga0495661_0014921 3300046665 Bacteria 5192
337 Ga0495661_0030931 3300046665 Bacteria 3403
338 Ga0495661_0035076 3300046665 Bacteria 3152
339 Ga0495661_0036553 3300046665 Bacteria 3074
340 Ga0495661_0039183 3300046665 Bacteria 2946
341 Ga0495661_0058536 3300046665 Bacteria 2296
342 Ga0495661_0079367 3300046665 Bacteria 1896
343 Ga0495661_0094852 3300046665 Bacteria 1690
344 Ga0495661_0123717 3300046665 Bacteria 1425
345 Ga0495661_0157988 3300046665 Bacteria 1219
346 Ga0495588_0000095 3300046674 Bacteria 175627
347 Ga0495588_0003042 3300046674 Bacteria 7254
348 Ga0495588_0028699 3300046674 Bacteria 2787
349 Ga0495588_0049577 3300046674 Bacteria 2159
350 Ga0495588_0166003 3300046674 Bacteria 1167
351 Ga0495623_0033253 3300046679 Bacteria 3309
352 Ga0495623_0063301 3300046679 Bacteria 2316
353 Ga0495669_0000029 3300046684 Bacteria 105945
354 Ga0495669_0000595 3300046684 Bacteria 15869
355 Ga0495669_0006317 3300046684 Bacteria 4949
356 Ga0495669_0009510 3300046684 Bacteria 4100
357 Ga0495669_0067504 3300046684 Bacteria 1625
358 Ga0495669_0079119 3300046684 Bacteria 1507
359 Ga0495669_0098035 3300046684 Bacteria 1359
360 Ga0495669_0106822 3300046684 Bacteria 1304
361 Ga0495613_0028523 3300046689 Bacteria 4152
362 Ga0495624_0008491 3300046690 Bacteria 7156
363 Ga0495670_0000207 3300046691 Bacteria 26631
364 Ga0495670_0001161 3300046691 Bacteria 12805
365 Ga0495670_0005006 3300046691 Bacteria 6514
366 Ga0495670_0089483 3300046691 Bacteria 1574
367 Ga0495670_0092467 3300046691 Bacteria 1549
368 Ga0495671_0001157 3300046692 Bacteria 18104
369 Ga0495671_0009581 3300046692 Bacteria 5407
370 Ga0495671_0033232 3300046692 Bacteria 2629
371 Ga0495671_0051993 3300046692 Bacteria 2036
372 Ga0495671_0082717 3300046692 Bacteria 1573
373 Ga0495671_0131536 3300046692 Bacteria 1220
374 Ga0495649_0000024 3300046694 Bacteria 175713
375 Ga0495649_0003404 3300046694 Bacteria 10749
376 Ga0495589_0000029 3300046794 Bacteria 173640
377 Ga0495589_0001333 3300046794 Bacteria 14478
378 Ga0495589_0003072 3300046794 Bacteria 9146
379 Ga0495589_0005447 3300046794 Bacteria 6715
380 Ga0495589_0021198 3300046794 Bacteria 3321
381 Ga0495589_0024443 3300046794 Bacteria 3071
382 Ga0495589_0039752 3300046794 Bacteria 2350
383 Ga0495589_0043050 3300046794 Bacteria 2249
384 Ga0495660_0000033 3300046810 Bacteria 212425
385 Ga0495660_0015199 3300046810 Bacteria 4448
386 Ga0495660_0020348 3300046810 Bacteria 3803
387 Ga0495660_0024642 3300046810 Bacteria 3426
388 Ga0495660_0059033 3300046810 Bacteria 2064
389 Ga0495660_0086265 3300046810 Bacteria 1638
390 Ga0495660_0115918 3300046810 Bacteria 1361
391 Ga0495660_0134106 3300046810 Bacteria 1239
392 Ga0495660_0166833 3300046810 Bacteria 1075
393 Ga0495604_0037690 3300047317 Bacteria 3806
394 Ga0495604_0287879 3300047317 Bacteria 1107
395 Ga0495636_0012846 3300047318 Bacteria 3318
396 Ga0495636_0027649 3300047318 Bacteria 2310
397 Ga0495672_0000179 3300047320 Bacteria 91327
398 Ga0495672_0000195 3300047320 Bacteria 86608
399 Ga0495672_0002926 3300047320 Bacteria 15087
400 Ga0495672_0010603 3300047320 Bacteria 6550
401 Ga0495672_0015935 3300047320 Bacteria 5088
402 Ga0495676_0000007 3300047321 Bacteria 276148
403 Ga0495676_0209298 3300047321 Bacteria 1350
404 Ga0495680_0007924 3300047322 Bacteria 9689
405 Ga0495680_0052821 3300047322 Bacteria 3166
406 Ga0495683_0000007 3300047323 Bacteria 268546
407 Ga0495683_0000017 3300047323 Bacteria 189599
408 Ga0495683_0005799 3300047323 Bacteria 6798
409 Ga0495683_0008604 3300047323 Bacteria 5453
410 Ga0495683_0012597 3300047323 Bacteria 4441
411 Ga0495683_0014740 3300047323 Bacteria 4072
412 Ga0495683_0029418 3300047323 Bacteria 2808
413 Ga0495683_0038558 3300047323 Bacteria 2419
414 Ga0495687_000002 3300047443 Bacteria 1085770
415 Ga0495687_000003 3300047443 Bacteria 859509
416 Ga0495687_000007 3300047443 Bacteria 552679
417 Ga0495687_000092 3300047443 Bacteria 140313
418 Ga0495687_000647 3300047443 Bacteria 39948
419 Ga0495687_079437 3300047443 Bacteria 1289
420 Ga0495675_0006949 3300047444 Bacteria 6953
421 Ga0495677_0000001 3300047445 Bacteria 715000
422 Ga0495677_0000174 3300047445 Bacteria 30810
423 Ga0495677_0000876 3300047445 Bacteria 12165
424 Ga0495677_0003022 3300047445 Bacteria 6542
425 Ga0495677_0015007 3300047445 Bacteria 2817
426 Ga0495677_0034135 3300047445 Bacteria 1855
427 Ga0495677_0044785 3300047445 Bacteria 1622
428 Ga0495677_0054627 3300047445 Bacteria 1473
429 Ga0495679_015399 3300047446 Bacteria 2798
430 Ga0495679_016279 3300047446 Bacteria 2693
431 Ga0495685_001401 3300047447 Bacteria 7358
432 Ga0495685_030179 3300047447 Bacteria 1864
433 Ga0495685_036975 3300047447 Bacteria 1675
434 Ga0495681_0000149 3300047470 Bacteria 59126
435 Ga0495681_0001349 3300047470 Bacteria 18551
436 Ga0495681_0005689 3300047470 Bacteria 8300
437 Ga0495681_0016506 3300047470 Bacteria 4134
438 Ga0495681_0029587 3300047470 Bacteria 2802
439 Ga0495681_0038573 3300047470 Bacteria 2340
440 Ga0495681_0143324 3300047470 Bacteria 1007
441 Ga0495686_0000015 3300047472 Bacteria 471703
442 Ga0495593_0009800 3300047673 Bacteria 5558
443 Ga0495593_0027553 3300047673 Bacteria 3127
444 Ga0495602_0044947 3300048088 Bacteria 4001
445 Ga0495614_0031607 3300048089 Bacteria 2278
446 Ga0495626_0000018 3300048091 Bacteria 230153
447 Ga0495626_0000160 3300048091 Bacteria 83120
448 Ga0495626_0001394 3300048091 Bacteria 19365
449 Ga0495626_0004154 3300048091 Bacteria 8992
450 Ga0495626_0005625 3300048091 Bacteria 7265
451 Ga0495626_0009719 3300048091 Bacteria 5183
452 Ga0495626_0010900 3300048091 Bacteria 4826
453 Ga0495626_0022249 3300048091 Bacteria 3132
454 Ga0495626_0080733 3300048091 Bacteria 1445
455 Ga0496101_0083060 3300048904 Bacteria 2371
456 Ga0496101_0278227 3300048904 Bacteria 1307
457 Ga0496102_0000077 3300048905 Bacteria 142501
458 Ga0496102_0000254 3300048905 Bacteria 69564
459 Ga0496102_0156762 3300048905 Bacteria 2140
460 Ga0496102_0246891 3300048905 Bacteria 1683
461 Ga0496102_0532909 3300048905 Bacteria 1097
462 Ga0496103_0032891 3300048906 Bacteria 3167
463 Ga0496103_0101863 3300048906 Bacteria 1818
464 Ga0496104_0154324 3300048907 Bacteria 2204
465 Ga0496105_0227191 3300048908 Bacteria 1518
466 Ga0496106_0010939 3300048909 Bacteria 6707
467 Ga0496107_0060511 3300048910 Bacteria 2741
468 Ga0496107_0307412 3300048910 Bacteria 1180
469 Ga0496108_0330811 3300048911 Bacteria 1329
470 Ga0496109_0030975 3300048912 Bacteria 4796
471 Ga0496109_0256142 3300048912 Bacteria 1648
472 Ga0496110_0000002 3300048913 Bacteria 166613
473 Ga0496110_0041096 3300048913 Bacteria 4033
474 Ga0496110_0313221 3300048913 Bacteria 1429
475 Ga0496110_0386311 3300048913 Bacteria 1276
476 Ga0496111_0115275 3300048914 Bacteria 1981
477 Ga0496113_0000541 3300048916 Bacteria 18686
478 Ga0496113_0019089 3300048916 Bacteria 4790
479 Ga0496115_0040243 3300048918 Bacteria 3715
480 Ga0496122_0000626 3300048925 Bacteria 72235
481 Ga0496122_0048073 3300048925 Bacteria 3285
482 Ga0496122_0088466 3300048925 Bacteria 2122
483 Ga0496123_0001195 3300048926 Bacteria 38153
484 Ga0496123_0004809 3300048926 Bacteria 13934
485 Ga0496123_0029050 3300048926 Bacteria 4082
486 Ga0496124_0006447 3300048927 Bacteria 12781
487 Ga0496124_0029266 3300048927 Bacteria 4911
488 Ga0496124_0032576 3300048927 Bacteria 4599
489 Ga0496124_0048434 3300048927 Bacteria 3632
490 Ga0496124_0198114 3300048927 Bacteria 1530
491 Ga0496124_0258773 3300048927 Bacteria 1282
492 Ga0496125_0016249 3300048928 Bacteria 7154
493 Ga0496125_0094281 3300048928 Bacteria 2231
494 Ga0496125_0231974 3300048928 Bacteria 1179
495 Ga0495678_000048 3300049459 Bacteria 165744
496 Ga0495678_000050 3300049459 Bacteria 160887
497 Ga0495678_000218 3300049459 Bacteria 66538
498 Ga0495678_002637 3300049459 Bacteria 11946
499 Ga0495678_005246 3300049459 Bacteria 7220
500 Ga0495678_020862 3300049459 Bacteria 2893
501 Ga0495678_035804 3300049459 Bacteria 2031
502 Ga0495678_087926 3300049459 Bacteria 1101
503 Ga0495682_0000530 3300049460 Bacteria 26313
504 Ga0495682_0012816 3300049460 Bacteria 3204
505 Ga0495682_0040991 3300049460 Bacteria 1697
506 Ga0495682_0065737 3300049460 Bacteria 1307
507 Ga0501035_0003259 3300049822 Bacteria 15552
508 Ga0587083_0008606 3300059505 Bacteria 1602
509 Ga0587068_002212 3300059641 Bacteria 2331
510 Ga0587072_007026 3300059643 Bacteria 1736
511 Ga0587079_005884 3300059647 Bacteria 1758
512 2643797515 2643221556 Bacteria 7251154
513 2644473943 2643221684 Bacteria 7145183
514 2809143425 2808606418 Bacteria 6724496
515 8047679570 8047673197 Bacteria 7395230
516 Ga0495686_0000520
517 rootL2_10092551
518 rootL2_10157734
519 Ga0007416J51690_1011110
520 Ga0055525_1000008
521 Ga0065165_1009734
522 Ga0070658_10146438
523 Ga0070658_10287997
524 Ga0070660_100011016
525 Ga0070660_100043070
526 Ga0070659_100020393
527 Ga0070659_100138625
528 Ga0068855_100005493
529 Ga0070664_100126498
530 Ga0070664_100169450
531 Ga0068871_100281489
532 Ga0105241_10046123
533 Ga0105242_10019597
534 Ga0105239_10475450
535 Ga0157371_10000161
536 Ga0157371_10296495
537 Ga0209563_100003
538 Ga0209677_104676
539 Ga0209148_1001061
540 Ga0207705_10015246
541 Ga0207705_10135776
542 Ga0207654_10047576
543 Ga0207657_10002545
544 Ga0207657_10014526
545 Ga0207657_10152251
546 Ga0207649_10097025
547 Ga0207706_10097183
548 Ga0207706_10230616
549 Ga0207679_10051628
550 Ga0207667_10072828
551 Ga0316177_1042298
552 Ga0316182_1222243
553 Ga0395899_0006673
554 Ga0395899_0007027
555 Ga0395899_0019247
556 Ga0395899_0115746
557 Ga0395900_0000164
558 Ga0395900_0000177
559 Ga0395900_0022632
560 Ga0395900_0072764
561 Ga0395900_0084154
562 Ga0395900_0095262
563 Ga0395900_0195351
564 Ga0395900_0254642
565 Ga0395898_0019774
566 Ga0395898_0234112
567 Ga0395898_0320155
568 Ga0395898_0550969
569 Ga0395905_0049660
570 Ga0395905_0058996
571 Ga0395905_0063783
572 Ga0395905_0065045
573 Ga0395901_0000226
574 Ga0395901_0000263
575 Ga0395901_0605353
576 Ga0439448_0005530
577 Ga0439448_0020026
578 Ga0439449_0060086
579 Ga0439450_010014
580 Ga0439455_0000762
581 Ga0450904_004173
582 Ga0439458_0010555
583 Ga0466969_0053320
584 Ga0466969_0088902
585 Ga0466972_0057857
586 Ga0466965_0025248
587 Ga0466965_0046548
588 Ga0466965_0069602
589 Ga0466966_0031760
590 Ga0466966_0061932
591 Ga0466966_0075077
592 Ga0466961_0166187
593 Ga0466963_0160209
594 Ga0466964_0000062
595 Ga0466964_0040409
596 Ga0466964_0120173
597 Ga0466968_0016708
598 Ga0466968_0043191
599 Ga0466957_0003314
600 Ga0466957_0079937
601 Ga0466957_0277649
602 Ga0466960_0171208
603 Ga0466959_0104831
604 Ga0466959_0267960
605 Ga0466958_0151161
606 Ga0466967_0009705
607 Ga0466967_0260093
608 Ga0466967_0396137
609 Ga0495617_000001
610 Ga0495627_000035
611 Ga0495627_003986
612 Ga0495590_0000015
613 Ga0495590_0000267
614 Ga0495590_0035258
615 Ga0495590_0075610
616 Ga0495591_000033
617 Ga0495629_0009409
618 Ga0495638_0004822
619 Ga0495653_0067520
620 Ga0495653_0109071
621 Ga0495653_0190569
622 Ga0495650_0000001
623 Ga0495650_0000233
624 Ga0495650_0010790
625 Ga0495582_0006886
626 Ga0495582_0013646
627 Ga0495605_0000227
628 Ga0495605_0000303
629 Ga0495605_0005359
630 Ga0495605_0017890
631 Ga0495605_0020027
632 Ga0495605_0036977
633 Ga0495605_0090215
634 Ga0495584_0000175
635 Ga0495584_0000664
636 Ga0495584_0004372
637 Ga0495584_0005252
638 Ga0495584_0011634
639 Ga0495584_0022537
640 Ga0495584_0037452
641 Ga0495584_0040461
642 Ga0495584_0064533
643 Ga0495584_0107829
644 Ga0495584_0108419
645 Ga0495584_0109945
646 Ga0495585_0000003
647 Ga0495585_0000039
648 Ga0495585_0000257
649 Ga0495585_0003587
650 Ga0495585_0006887
651 Ga0495585_0007938
652 Ga0495585_0014637
653 Ga0495585_0018345
654 Ga0495585_0024222
655 Ga0495585_0037013
656 Ga0495585_0068153
657 Ga0495585_0091298
658 Ga0495585_0121499
659 Ga0495585_0127120
660 Ga0495585_0133013
661 Ga0495594_0004722
662 Ga0495594_0047415
663 Ga0495594_0062364
664 Ga0495596_0000044
665 Ga0495596_0000502
666 Ga0495596_0005902
667 Ga0495596_0007820
668 Ga0495596_0009546
669 Ga0495596_0011125
670 Ga0495596_0013357
671 Ga0495596_0013588
672 Ga0495596_0018540
673 Ga0495596_0024541
674 Ga0495596_0027645
675 Ga0495596_0027885
676 Ga0495596_0043442
677 Ga0495596_0057882
678 Ga0495607_0000759
679 Ga0495607_0001344
680 Ga0495607_0005929
681 Ga0495607_0015004
682 Ga0495607_0023659
683 Ga0495607_0054461
684 Ga0495607_0083069
685 Ga0495607_0146817
686 Ga0495583_0000243
687 Ga0495583_0000266
688 Ga0495583_0000292
689 Ga0495583_0000999
690 Ga0495583_0001599
691 Ga0495583_0012600
692 Ga0495583_0017116
693 Ga0495583_0031921
694 Ga0495583_0038858
695 Ga0495606_0008876
696 Ga0495606_0015655
697 Ga0495606_0035387
698 Ga0495606_0118724
699 Ga0495610_0000318
700 Ga0495610_0070697
701 Ga0495616_0000510
702 Ga0495616_0001728
703 Ga0495616_0008431
704 Ga0495616_0009897
705 Ga0495616_0019906
706 Ga0495616_0024372
707 Ga0495616_0028521
708 Ga0495616_0030091
709 Ga0495616_0040100
710 Ga0495616_0069290
711 Ga0495616_0070154
712 Ga0495616_0074482
713 Ga0495616_0088751
714 Ga0495616_0101907
715 Ga0495630_0072302
716 Ga0495631_0000367
717 Ga0495631_0000658
718 Ga0495631_0001307
719 Ga0495631_0006206
720 Ga0495631_0008493
721 Ga0495631_0008586
722 Ga0495631_0018146
723 Ga0495631_0020590
724 Ga0495631_0021924
725 Ga0495631_0030982
726 Ga0495631_0057503
727 Ga0495631_0063559
728 Ga0495631_0069458
729 Ga0495631_0073572
730 Ga0495631_0090315
731 Ga0495631_0105010
732 Ga0495631_0150578
733 Ga0495632_0000084
734 Ga0495632_0000116
735 Ga0495632_0001227
736 Ga0495632_0001970
737 Ga0495632_0004895
738 Ga0495637_0000002
739 Ga0495637_0039658
740 Ga0495643_0001196
741 Ga0495643_0003602
742 Ga0495643_0006119
743 Ga0495643_0007851
744 Ga0495643_0021719
745 Ga0495643_0101096
746 Ga0495644_0010026
747 Ga0495644_0018122
748 Ga0495644_0023110
749 Ga0495644_0059666
750 Ga0495644_0061349
751 Ga0495644_0074465
752 Ga0495648_0000171
753 Ga0495648_0001531
754 Ga0495648_0006637
755 Ga0495648_0012793
756 Ga0495648_0021397
757 Ga0495648_0023248
758 Ga0495648_0032126
759 Ga0495648_0039072
760 Ga0495648_0064838
761 Ga0495648_0071620
762 Ga0495663_0002595
763 Ga0495663_0026878
764 Ga0495666_0001479
765 Ga0495666_0036215
766 Ga0495642_0000429
767 Ga0495642_0002815
768 Ga0495642_0003721
769 Ga0495642_0005385
770 Ga0495642_0006461
771 Ga0495642_0008833
772 Ga0495642_0012458
773 Ga0495642_0017829
774 Ga0495642_0019442
775 Ga0495642_0046000
776 Ga0495642_0078884
777 Ga0495642_0086130
778 Ga0495652_0003096
779 Ga0495654_0010326
780 Ga0495654_0034863
781 Ga0495654_0090219
782 Ga0495665_0001496
783 Ga0495665_0005329
784 Ga0495665_0014012
785 Ga0495640_0149762
786 Ga0495586_0003280
787 Ga0495586_0066245
788 Ga0495587_0072098
789 Ga0495609_0000001
790 Ga0495609_0001909
791 Ga0495609_0006093
792 Ga0495609_0007947
793 Ga0495609_0020030
794 Ga0495609_0027767
795 Ga0495609_0070976
796 Ga0495597_0000624
797 Ga0495597_0001280
798 Ga0495597_0003334
799 Ga0495597_0004738
800 Ga0495597_0006247
801 Ga0495597_0015068
802 Ga0495597_0027030
803 Ga0495597_0074623
804 Ga0495597_0087528
805 Ga0495597_0087905
806 Ga0495645_0077729
807 Ga0495622_0008072
808 Ga0495622_0009216
809 Ga0495622_0048414
810 Ga0495633_0000965
811 Ga0495633_0002567
812 Ga0495633_0002808
813 Ga0495633_0016312
814 Ga0495633_0046088
815 Ga0495633_0051776
816 Ga0495633_0061893
817 Ga0495633_0074050
818 Ga0495633_0124654
819 Ga0495656_0028080
820 Ga0495656_0044391
821 Ga0495668_0000052
822 Ga0495668_0000954
823 Ga0495668_0001517
824 Ga0495668_0006577
825 Ga0495668_0011055
826 Ga0495668_0013955
827 Ga0495668_0020501
828 Ga0495668_0035646
829 Ga0495668_0036303
830 Ga0495668_0055660
831 Ga0495668_0072468
832 Ga0495634_0010936
833 Ga0495611_0003643
834 Ga0495611_0009702
835 Ga0495611_0016927
836 Ga0495611_0017376
837 Ga0495611_0021773
838 Ga0495611_0031327
839 Ga0495611_0032003
840 Ga0495611_0060672
841 Ga0495625_0023558
842 Ga0495625_0035707
843 Ga0495625_0050492
844 Ga0495625_0292433
845 Ga0495635_0010594
846 Ga0495661_0000175
847 Ga0495661_0000260
848 Ga0495661_0002109
849 Ga0495661_0002998
850 Ga0495661_0006117
851 Ga0495661_0014921
852 Ga0495661_0030931
853 Ga0495661_0035076
854 Ga0495661_0036553
855 Ga0495661_0039183
856 Ga0495661_0058536
857 Ga0495661_0079367
858 Ga0495661_0094852
859 Ga0495661_0123717
860 Ga0495661_0157988
861 Ga0495588_0000095
862 Ga0495588_0003042
863 Ga0495588_0028699
864 Ga0495588_0049577
865 Ga0495588_0166003
866 Ga0495623_0033253
867 Ga0495623_0063301
868 Ga0495669_0000029
869 Ga0495669_0000595
870 Ga0495669_0006317
871 Ga0495669_0009510
872 Ga0495669_0067504
873 Ga0495669_0079119
874 Ga0495669_0098035
875 Ga0495669_0106822
876 Ga0495613_0028523
877 Ga0495624_0008491
878 Ga0495670_0000207
879 Ga0495670_0001161
880 Ga0495670_0005006
881 Ga0495670_0089483
882 Ga0495670_0092467
883 Ga0495671_0001157
884 Ga0495671_0009581
885 Ga0495671_0033232
886 Ga0495671_0051993
887 Ga0495671_0082717
888 Ga0495671_0131536
889 Ga0495649_0000024
890 Ga0495649_0003404
891 Ga0495589_0000029
892 Ga0495589_0001333
893 Ga0495589_0003072
894 Ga0495589_0005447
895 Ga0495589_0021198
896 Ga0495589_0024443
897 Ga0495589_0039752
898 Ga0495589_0043050
899 Ga0495660_0000033
900 Ga0495660_0015199
901 Ga0495660_0020348
902 Ga0495660_0024642
903 Ga0495660_0059033
904 Ga0495660_0086265
905 Ga0495660_0115918
906 Ga0495660_0134106
907 Ga0495660_0166833
908 Ga0495604_0037690
909 Ga0495604_0287879
910 Ga0495636_0012846
911 Ga0495636_0027649
912 Ga0495672_0000179
913 Ga0495672_0000195
914 Ga0495672_0002926
915 Ga0495672_0010603
916 Ga0495672_0015935
917 Ga0495676_0000007
918 Ga0495676_0209298
919 Ga0495680_0007924
920 Ga0495680_0052821
921 Ga0495683_0000007
922 Ga0495683_0000017
923 Ga0495683_0005799
924 Ga0495683_0008604
925 Ga0495683_0012597
926 Ga0495683_0014740
927 Ga0495683_0029418
928 Ga0495683_0038558
929 Ga0495687_000002
930 Ga0495687_000003
931 Ga0495687_000007
932 Ga0495687_000092
933 Ga0495687_000647
934 Ga0495687_079437
935 Ga0495675_0006949
936 Ga0495677_0000001
937 Ga0495677_0000174
938 Ga0495677_0000876
939 Ga0495677_0003022
940 Ga0495677_0015007
941 Ga0495677_0034135
942 Ga0495677_0044785
943 Ga0495677_0054627
944 Ga0495679_015399
945 Ga0495679_016279
946 Ga0495685_001401
947 Ga0495685_030179
948 Ga0495685_036975
949 Ga0495681_0000149
950 Ga0495681_0001349
951 Ga0495681_0005689
952 Ga0495681_0016506
953 Ga0495681_0029587
954 Ga0495681_0038573
955 Ga0495681_0143324
956 Ga0495686_0000015
957 Ga0495593_0009800
958 Ga0495593_0027553
959 Ga0495602_0044947
960 Ga0495614_0031607
961 Ga0495626_0000018
962 Ga0495626_0000160
963 Ga0495626_0001394
964 Ga0495626_0004154
965 Ga0495626_0005625
966 Ga0495626_0009719
967 Ga0495626_0010900
968 Ga0495626_0022249
969 Ga0495626_0080733
970 Ga0496101_0083060
971 Ga0496101_0278227
972 Ga0496102_0000077
973 Ga0496102_0000254
974 Ga0496102_0156762
975 Ga0496102_0246891
976 Ga0496102_0532909
977 Ga0496103_0032891
978 Ga0496103_0101863
979 Ga0496104_0154324
980 Ga0496105_0227191
981 Ga0496106_0010939
982 Ga0496107_0060511
983 Ga0496107_0307412
984 Ga0496108_0330811
985 Ga0496109_0030975
986 Ga0496109_0256142
987 Ga0496110_0000002
988 Ga0496110_0041096
989 Ga0496110_0313221
990 Ga0496110_0386311
991 Ga0496111_0115275
992 Ga0496113_0000541
993 Ga0496113_0019089
994 Ga0496115_0040243
995 Ga0496122_0000626
996 Ga0496122_0048073
997 Ga0496122_0088466
998 Ga0496123_0001195
999 Ga0496123_0004809
1000 Ga0496123_0029050
1001 Ga0496124_0006447
1002 Ga0496124_0029266
1003 Ga0496124_0032576
1004 Ga0496124_0048434
1005 Ga0496124_0198114
1006 Ga0496124_0258773
1007 Ga0496125_0016249
1008 Ga0496125_0094281
1009 Ga0496125_0231974
1010 Ga0495678_000048
1011 Ga0495678_000050
1012 Ga0495678_000218
1013 Ga0495678_002637
1014 Ga0495678_005246
1015 Ga0495678_020862
1016 Ga0495678_035804
1017 Ga0495678_087926
1018 Ga0495682_0000530
1019 Ga0495682_0012816
1020 Ga0495682_0040991
1021 Ga0495682_0065737
1022 Ga0501035_0003259
1023 Ga0587083_0008606
1024 Ga0587068_002212
1025 Ga0587072_007026
1026 Ga0587079_005884
1027 2643797515
1028 2644473943
1029 2809143425
1030 8047679570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

12

129

0.92

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

173

289

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9626 7 301
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9561 7 301
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9499 9 300
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9434 9 300
5z01-assembly1.cif.gz_A-2 native escherichia coli l,d-carboxypeptidase a (ldca) 0.9315 5 302
ID Description Score Start End Superfamily
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9536 164 287 3.50.30.60
af_P76008_4_153_3.40.50.10740 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9352 9 151 3.40.50.10740
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.902 7 133 3.40.50.10740
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8986 5 149 3.40.50.10740
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8976 164 287 3.50.30.60
ID Description Score Start End GO Terms
AF-A0A4Q6GMQ7-F1-model_v4 Muramoyltetrapeptide carboxypeptidase 0.9837 1 156 GO:0004180
AF-A0A4Q6GMQ7-F1-model_v4 Muramoyltetrapeptide carboxypeptidase 0.9714 1 156 GO:0004180
AF-A0A853QM02-F1-model_v4 deleted 0.9713 100 302
AF-A0A4R6YA49-F1-model_v4 Murein tetrapeptidase LD-carboxypeptidase 0.9688 6 295 GO:0004180
GO:0006508
GO:0008236
AF-A0A1F3ZUM3-F1-model_v4 Muramoyltetrapeptide carboxypeptidase 0.9655 11 303 GO:0004180
GO:0006508
GO:0008236

Map