F457906

General Info

Members Datasets Scaffolds Average Seq Length
515 281 1030 235

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0012915|Ga0496102_0012915_2078_2899
Length 273
Sequence MEIVRREKADDFRIRQLRAQQMLRGELDGDDLEEYVKERVLTTTFETAVDWARGNSMFPATFGLACCAIEMMSVVGARLDIARFGFEAFRATPRQADMLILSGRVSIKMAPVVRRIYDQMLEPKWAIAMGACSSSMGVFNNYAIVPADKFLPVDIHIPGCPPRPEALIYGILKLQRKIFGEPDLGWRERYKAYGTEEDERPWKSGPLSVQRVGAAPSDGIVESHGSPPSDAELHAPISHPELSGHEAHDAWEEAADDERVTTSRPPGDRRGDA

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0
Rhizoplane 9.32
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0012915 3300048905 Bacteria 7232
2 JGI24737J22298_10017875 3300001990 Bacteria 2280
3 JGI24737J22298_10064496 3300001990 Bacteria 1099
4 JGI25405J52794_10036623 3300003911 Bacteria 1030
5 Ga0070676_10232008 3300005328 Bacteria 1224
6 Ga0070683_100088996 3300005329 Bacteria 2897
7 Ga0070683_100133311 3300005329 Bacteria 2351
8 Ga0070683_101153511 3300005329 Bacteria 744
9 Ga0070690_100212496 3300005330 Bacteria 1351
10 Ga0070670_100390031 3300005331 Bacteria 1228
11 Ga0070682_100051419 3300005337 Bacteria 2575
12 Ga0070682_100150420 3300005337 Bacteria 1597
13 Ga0068868_100299714 3300005338 Bacteria 1365
14 Ga0068868_100754553 3300005338 Bacteria 875
15 Ga0068868_100979508 3300005338 Bacteria 772
16 Ga0070660_100001669 3300005339 Bacteria 15240
17 Ga0070660_100186754 3300005339 Bacteria 1678
18 Ga0070660_100880788 3300005339 Bacteria 754
19 Ga0070689_100100164 3300005340 Bacteria 2292
20 Ga0070691_10054227 3300005341 Bacteria 1919
21 Ga0070692_10056974 3300005345 Bacteria 2047
22 Ga0070692_10197634 3300005345 Bacteria 1176
23 Ga0070692_10362612 3300005345 Bacteria 904
24 Ga0070668_100030302 3300005347 Bacteria 4113
25 Ga0070675_100029576 3300005354 Bacteria 4420
26 Ga0070671_100278381 3300005355 Bacteria 1423
27 Ga0070674_100019860 3300005356 Bacteria 4278
28 Ga0070674_100122245 3300005356 Bacteria 1929
29 Ga0070674_100712864 3300005356 Bacteria 859
30 Ga0070688_100221808 3300005365 Bacteria 1333
31 Ga0070659_100014074 3300005366 Bacteria 5970
32 Ga0070659_100031084 3300005366 Bacteria 4134
33 Ga0070709_10175567 3300005434 Bacteria 1501
34 Ga0070714_100019766 3300005435 Bacteria 5493
35 Ga0070714_100457058 3300005435 Bacteria 1213
36 Ga0070713_100201107 3300005436 Bacteria 1799
37 Ga0070713_100554440 3300005436 Bacteria 1088
38 Ga0070711_100228215 3300005439 Bacteria 1451
39 Ga0070700_100008502 3300005441 Bacteria 5589
40 Ga0070700_100030467 3300005441 Bacteria 3224
41 Ga0070700_100077913 3300005441 Bacteria 2133
42 Ga0070663_100002800 3300005455 Bacteria 9895
43 Ga0070678_100199985 3300005456 Bacteria 1649
44 Ga0070678_100318810 3300005456 Bacteria 1327
45 Ga0070662_100059992 3300005457 Bacteria 2772
46 Ga0070662_100119426 3300005457 Bacteria 2019
47 Ga0070662_100131853 3300005457 Bacteria 1928
48 Ga0070681_10493321 3300005458 Bacteria 1138
49 Ga0068867_100090687 3300005459 Bacteria 2319
50 Ga0070685_10124147 3300005466 Bacteria 1606
51 Ga0070684_100032378 3300005535 Bacteria 4455
52 Ga0070684_100152709 3300005535 Bacteria 2093
53 Ga0070684_100377979 3300005535 Bacteria 1304
54 Ga0070684_100738316 3300005535 Bacteria 919
55 Ga0068853_100028808 3300005539 Bacteria 4674
56 Ga0070686_100632579 3300005544 Bacteria 846
57 Ga0070693_100237123 3300005547 Bacteria 1203
58 Ga0070665_100197463 3300005548 Bacteria 2013
59 Ga0070664_100183995 3300005564 Bacteria 1858
60 Ga0070664_100282983 3300005564 Bacteria 1496
61 Ga0068857_100167556 3300005577 Bacteria 1996
62 Ga0068857_100338952 3300005577 Bacteria 1391
63 Ga0068854_100070754 3300005578 Bacteria 2550
64 Ga0068854_100102260 3300005578 Bacteria 2150
65 Ga0068856_101015888 3300005614 Bacteria 847
66 Ga0070702_100021251 3300005615 Bacteria 3412
67 Ga0070702_100097458 3300005615 Bacteria 1797
68 Ga0070702_100495967 3300005615 Bacteria 896
69 Ga0068852_100161162 3300005616 Bacteria 2095
70 Ga0068852_100553932 3300005616 Bacteria 1150
71 Ga0068859_100133108 3300005617 Bacteria 2558
72 Ga0068859_100278622 3300005617 Bacteria 1765
73 Ga0068864_100097205 3300005618 Bacteria 2607
74 Ga0068864_100546086 3300005618 Bacteria 1119
75 Ga0068861_100496396 3300005719 Bacteria 1102
76 Ga0068870_10021017 3300005840 Bacteria 3187
77 Ga0068863_100461385 3300005841 Bacteria 1248
78 Ga0068858_100163827 3300005842 Bacteria 2094
79 Ga0068860_100104399 3300005843 Bacteria 2705
80 Ga0081455_10007545 3300005937 Bacteria 11439
81 Ga0081538_10001191 3300005981 Bacteria 27404
82 Ga0081540_1000568 3300005983 Bacteria 35821
83 Ga0081539_10001045 3300005985 Bacteria 50690
84 Ga0081539_10001489 3300005985 Bacteria 39599
85 Ga0081539_10005444 3300005985 Bacteria 12992
86 Ga0070717_10028271 3300006028 Bacteria 4487
87 Ga0070717_10110889 3300006028 Bacteria 2340
88 Ga0075365_10001589 3300006038 Bacteria 10448
89 Ga0075365_10006537 3300006038 Bacteria 6421
90 Ga0075365_10019279 3300006038 Bacteria 4208
91 Ga0075368_10056615 3300006042 Bacteria 1565
92 Ga0075363_100008514 3300006048 Bacteria 4779
93 Ga0075363_100041207 3300006048 Bacteria 2435
94 Ga0075363_100092696 3300006048 Bacteria 1664
95 Ga0075363_100204917 3300006048 Bacteria 1128
96 Ga0075364_10059932 3300006051 Bacteria 2496
97 Ga0075364_10294487 3300006051 Bacteria 1105
98 Ga0075432_10061981 3300006058 Bacteria 1333
99 Ga0070715_10057327 3300006163 Bacteria 1697
100 Ga0070712_100000013 3300006175 Bacteria 109912
101 Ga0070712_100002893 3300006175 Bacteria 10651
102 Ga0070712_100067270 3300006175 Bacteria 2549
103 Ga0075367_10065179 3300006178 Bacteria 2181
104 Ga0097621_100770796 3300006237 Bacteria 890
105 Ga0068871_100375678 3300006358 Bacteria 1262
106 Ga0075434_100158025 3300006871 Bacteria 2287
107 Ga0075434_100356912 3300006871 Bacteria 1483
108 Ga0068865_100001280 3300006881 Bacteria 14644
109 Ga0068865_100114880 3300006881 Bacteria 1992
110 Ga0068865_100619216 3300006881 Bacteria 917
111 Ga0068865_100922714 3300006881 Bacteria 760
112 Ga0097620_100133112 3300006931 Bacteria 2558
113 Ga0097620_100278624 3300006931 Bacteria 1765
114 Ga0075435_100495085 3300007076 Bacteria 1057
115 Ga0105240_10018075 3300009093 Bacteria 9479
116 Ga0111539_10063618 3300009094 Bacteria 4365
117 Ga0105245_10350196 3300009098 Bacteria 1463
118 Ga0105245_10894708 3300009098 Bacteria 929
119 Ga0105247_10229146 3300009101 Bacteria 1261
120 Ga0105243_10023540 3300009148 Bacteria 4692
121 Ga0105243_10176524 3300009148 Bacteria 1854
122 Ga0105243_10214267 3300009148 Bacteria 1698
123 Ga0105243_10275440 3300009148 Bacteria 1513
124 Ga0105243_10303868 3300009148 Bacteria 1447
125 Ga0105243_10778866 3300009148 Bacteria 941
126 Ga0105241_10127111 3300009174 Bacteria 2060
127 Ga0105242_10098001 3300009176 Bacteria 2479
128 Ga0105242_10129852 3300009176 Bacteria 2173
129 Ga0105248_10244961 3300009177 Bacteria 2018
130 Ga0105237_10740336 3300009545 Bacteria 989
131 Ga0105238_10678829 3300009551 Bacteria 1041
132 Ga0105239_10040445 3300010375 Bacteria 5108
133 Ga0105239_10403099 3300010375 Bacteria 1548
134 Ga0105239_11028559 3300010375 Bacteria 947
135 Ga0105246_10167617 3300011119 Bacteria 1679
136 Ga0157371_10313935 3300013102 Bacteria 1137
137 Ga0157378_10186833 3300013297 Bacteria 1952
138 Ga0157378_11388859 3300013297 Bacteria 745
139 Ga0163162_10574445 3300013306 Bacteria 1255
140 Ga0157372_10391961 3300013307 Bacteria 1618
141 Ga0157372_11330501 3300013307 Bacteria 829
142 Ga0157375_10056009 3300013308 Bacteria 3890
143 Ga0157375_10157295 3300013308 Bacteria 2412
144 Ga0163163_10046316 3300014325 Bacteria 4272
145 Ga0157380_10049473 3300014326 Bacteria 3316
146 Ga0157380_10538390 3300014326 Bacteria 1143
147 Ga0157380_10540175 3300014326 Bacteria 1141
148 Ga0157379_10160198 3300014968 Bacteria 2031
149 Ga0163161_10133540 3300017792 Bacteria 1874
150 Ga0163161_10332112 3300017792 Bacteria 1204
151 Ga0197907_10991395 3300020069 Bacteria 1425
152 Ga0213875_10014084 3300021388 Bacteria 3910
153 Ga0213875_10064693 3300021388 Bacteria 1709
154 Ga0207426_1042188 3300025302 Bacteria 1409
155 Ga0207656_10105523 3300025321 Bacteria 1296
156 Ga0207642_10043753 3300025899 Bacteria 1978
157 Ga0207710_10200003 3300025900 Bacteria 986
158 Ga0207710_10241315 3300025900 Bacteria 902
159 Ga0207688_10030391 3300025901 Bacteria 2978
160 Ga0207688_10049244 3300025901 Bacteria 2355
161 Ga0207688_10060014 3300025901 Bacteria 2142
162 Ga0207647_10057343 3300025904 Bacteria 2387
163 Ga0207645_10187261 3300025907 Bacteria 1359
164 Ga0207643_10019273 3300025908 Bacteria 3738
165 Ga0207643_10025586 3300025908 Bacteria 3263
166 Ga0207643_10253678 3300025908 Bacteria 1084
167 Ga0207705_10030926 3300025909 Bacteria 3821
168 Ga0207695_10017468 3300025913 Bacteria 8348
169 Ga0207671_10100708 3300025914 Bacteria 2188
170 Ga0207693_10007488 3300025915 Bacteria 8975
171 Ga0207693_10118510 3300025915 Bacteria 2079
172 Ga0207657_10004224 3300025919 Bacteria 15215
173 Ga0207657_10129189 3300025919 Bacteria 2072
174 Ga0207657_10480262 3300025919 Bacteria 974
175 Ga0207652_10437287 3300025921 Bacteria 1179
176 Ga0207650_10506026 3300025925 Bacteria 1010
177 Ga0207659_10370722 3300025926 Bacteria 1192
178 Ga0207687_10067011 3300025927 Bacteria 2553
179 Ga0207687_10242623 3300025927 Bacteria 1429
180 Ga0207700_10624859 3300025928 Bacteria 959
181 Ga0207664_10002161 3300025929 Bacteria 12930
182 Ga0207664_10344561 3300025929 Bacteria 1318
183 Ga0207690_10020757 3300025932 Bacteria 4063
184 Ga0207690_10149095 3300025932 Bacteria 1732
185 Ga0207690_10239941 3300025932 Bacteria 1396
186 Ga0207690_10489880 3300025932 Bacteria 993
187 Ga0207706_10061353 3300025933 Bacteria 3311
188 Ga0207706_10123874 3300025933 Bacteria 2274
189 Ga0207706_10868030 3300025933 Bacteria 763
190 Ga0207686_10054690 3300025934 Bacteria 2501
191 Ga0207709_10045449 3300025935 Bacteria 2659
192 Ga0207709_10051587 3300025935 Bacteria 2522
193 Ga0207709_10096377 3300025935 Bacteria 1946
194 Ga0207669_10080944 3300025937 Bacteria 2079
195 Ga0207669_10183989 3300025937 Bacteria 1501
196 Ga0207704_10011097 3300025938 Bacteria 4422
197 Ga0207691_10215905 3300025940 Bacteria 1665
198 Ga0207711_10139695 3300025941 Bacteria 2178
199 Ga0207661_10088111 3300025944 Bacteria 2579
200 Ga0207679_10063332 3300025945 Bacteria 2760
201 Ga0207679_10203615 3300025945 Bacteria 1655
202 Ga0207712_10165774 3300025961 Bacteria 1722
203 Ga0207712_10298660 3300025961 Bacteria 1321
204 Ga0207640_10179634 3300025981 Bacteria 1586
205 Ga0207677_10291858 3300026023 Bacteria 1343
206 Ga0207639_10040252 3300026041 Bacteria 3487
207 Ga0207639_10105773 3300026041 Bacteria 2283
208 Ga0207639_10384486 3300026041 Bacteria 1261
209 Ga0207678_10002606 3300026067 Bacteria 16433
210 Ga0207678_10286642 3300026067 Bacteria 1414
211 Ga0207708_10001007 3300026075 Bacteria 21085
212 Ga0207708_10082234 3300026075 Bacteria 2476
213 Ga0207708_10160813 3300026075 Bacteria 1773
214 Ga0207708_10441679 3300026075 Bacteria 1082
215 Ga0207702_10039414 3300026078 Bacteria 3958
216 Ga0207702_10184969 3300026078 Bacteria 1921
217 Ga0207648_10073188 3300026089 Bacteria 2987
218 Ga0207676_10094746 3300026095 Bacteria 2461
219 Ga0207674_10020606 3300026116 Bacteria 7119
220 Ga0207674_10160023 3300026116 Bacteria 2206
221 Ga0207675_100044705 3300026118 Bacteria 4139
222 Ga0207675_100423957 3300026118 Bacteria 1314
223 Ga0207675_100492231 3300026118 Bacteria 1220
224 Ga0207683_10140656 3300026121 Bacteria 2175
225 Ga0207683_10254433 3300026121 Bacteria 1603
226 Ga0207683_10305054 3300026121 Bacteria 1457
227 Ga0207698_10104880 3300026142 Bacteria 2354
228 Ga0207698_10194016 3300026142 Bacteria 1812
229 Ga0207698_10681668 3300026142 Bacteria 1021
230 Ga0207698_10696872 3300026142 Bacteria 1010
231 Ga0207428_10062582 3300027907 Bacteria 2942
232 Ga0268266_10267802 3300028379 Bacteria 1585
233 Ga0268266_10545380 3300028379 Bacteria 1111
234 Ga0268265_10463683 3300028380 Bacteria 1186
235 Ga0268265_10669667 3300028380 Bacteria 999
236 Ga0265326_10002998 3300028558 Bacteria 5614
237 Ga0265319_1001901 3300028563 Bacteria 11865
238 Ga0265318_10000545 3300028577 Bacteria 26811
239 Ga0265322_10081786 3300028654 Bacteria 916
240 Ga0265336_10000001 3300028666 Bacteria 916179
241 Ga0265338_10000004 3300028800 Bacteria 644793
242 Ga0265332_10207300 3300031238 Bacteria 814
243 Ga0265325_10109896 3300031241 Bacteria 1341
244 Ga0265340_10000002 3300031247 Bacteria 711693
245 Ga0265339_10138895 3300031249 Bacteria 1237
246 Ga0265316_10030285 3300031344 Bacteria 4438
247 Ga0307408_100230751 3300031548 Bacteria 1516
248 Ga0316576_10122001 3300031727 Bacteria 1958
249 Ga0307405_10096618 3300031731 Bacteria 1970
250 Ga0307413_10076970 3300031824 Bacteria 2122
251 Ga0307410_10024313 3300031852 Bacteria 3783
252 Ga0307410_10040733 3300031852 Bacteria 3059
253 Ga0307410_10407211 3300031852 Bacteria 1100
254 Ga0307406_10093082 3300031901 Bacteria 2034
255 Ga0307406_10432386 3300031901 Bacteria 1051
256 Ga0307407_10021524 3300031903 Bacteria 3328
257 Ga0307407_10348128 3300031903 Bacteria 1048
258 Ga0307412_10152724 3300031911 Bacteria 1706
259 Ga0307412_10249379 3300031911 Bacteria 1378
260 Ga0307409_100048138 3300031995 Bacteria 3241
261 Ga0307409_100131999 3300031995 Bacteria 2136
262 Ga0307409_100572469 3300031995 Bacteria 1112
263 Ga0307409_100590347 3300031995 Bacteria 1096
264 Ga0307409_100868897 3300031995 Bacteria 914
265 Ga0307416_100006134 3300032002 Bacteria 7489
266 Ga0307416_100169926 3300032002 Bacteria 2028
267 Ga0307416_100690692 3300032002 Bacteria 1109
268 Ga0307416_100700132 3300032002 Bacteria 1102
269 Ga0307416_100957700 3300032002 Bacteria 958
270 Ga0307414_10070620 3300032004 Bacteria 2515
271 Ga0307414_10209494 3300032004 Bacteria 1592
272 Ga0307414_10557400 3300032004 Bacteria 1022
273 Ga0307414_10718167 3300032004 Bacteria 906
274 Ga0307411_10058554 3300032005 Bacteria 2550
275 Ga0307415_100092951 3300032126 Bacteria 2189
276 Ga0307415_100238210 3300032126 Bacteria 1470
277 Ga0307415_100514167 3300032126 Bacteria 1049
278 Ga0373949_0078127 3300035090 Bacteria 878
279 Ga0373953_0021152 3300035117 Bacteria 2438
280 Ga0373954_0022104 3300035118 Bacteria 2884
281 Ga0373957_0056611 3300035120 Bacteria 1510
282 Ga0373946_0277031 3300035171 Bacteria 824
283 Ga0316574_0068583 3300035398 Bacteria 2237
284 Ga0373933_0308816 3300035724 Bacteria 1025
285 Ga0373937_0024988 3300036401 Bacteria 5391
286 Ga0316584_0110090 3300036712 Bacteria 2061
287 Ga0373925_0348231 3300037068 Bacteria 1202
288 Ga0395900_0002246 3300037418 Bacteria 21499
289 Ga0395898_0003455 3300037466 Bacteria 17662
290 Ga0395898_0105497 3300037466 Bacteria 2702
291 Ga0395898_0328615 3300037466 Bacteria 1458
292 Ga0395898_0350362 3300037466 Bacteria 1408
293 Ga0436364_1438537 3300037853 Bacteria 5416
294 Ga0395901_0006802 3300038443 Bacteria 11553
295 Ga0395901_0180843 3300038443 Bacteria 2212
296 Ga0395901_0519269 3300038443 Bacteria 1210
297 Ga0436365_0824534 3300039437 Bacteria 1548
298 Ga0436365_1102108 3300039437 Bacteria 21525
299 Ga0436365_1725409 3300039437 Bacteria 5697
300 Ga0436363_0012859 3300039450 Bacteria 1296
301 Ga0436363_0669888 3300039450 Bacteria 1201
302 Ga0436363_0850733 3300039450 Bacteria 845
303 Ga0436362_0239758 3300039453 Bacteria 2799
304 Ga0451791_0327589 3300041451 Bacteria 3598
305 Ga0439448_0013856 3300042005 Bacteria 2428
306 Ga0439455_0014762 3300042012 Bacteria 1787
307 Ga0439463_037411 3300042016 Bacteria 1231
308 Ga0466972_0290006 3300044658 Bacteria 765
309 Ga0466965_0056854 3300044683 Bacteria 1949
310 Ga0466965_0193315 3300044683 Bacteria 1077
311 Ga0466966_0033106 3300044684 Bacteria 3347
312 Ga0466963_0006643 3300044694 Bacteria 6867
313 Ga0466963_0019103 3300044694 Bacteria 4292
314 Ga0466963_0056025 3300044694 Bacteria 2623
315 Ga0466963_0237275 3300044694 Bacteria 1278
316 Ga0466963_0319092 3300044694 Bacteria 1093
317 Ga0466963_0323368 3300044694 Bacteria 1085
318 Ga0466963_0421331 3300044694 Bacteria 941
319 Ga0466971_0030125 3300044719 Bacteria 2428
320 Ga0466971_0164061 3300044719 Bacteria 1040
321 Ga0466971_0207401 3300044719 Bacteria 926
322 Ga0466968_0300984 3300044735 Bacteria 771
323 Ga0466970_0223929 3300044765 Unclassified 1050
324 Ga0466970_0424286 3300044765 Bacteria 760
325 Ga0466957_0023685 3300044842 Bacteria 3631
326 Ga0466957_0045760 3300044842 Bacteria 2654
327 Ga0466957_0049437 3300044842 Bacteria 2557
328 Ga0466957_0091952 3300044842 Unclassified 1902
329 Ga0466957_0156531 3300044842 Bacteria 1477
330 Ga0466957_0222145 3300044842 Bacteria 1248
331 Ga0466960_0000181 3300044901 Bacteria 21653
332 Ga0466960_0007477 3300044901 Bacteria 4440
333 Ga0466959_0000694 3300045049 Bacteria 19701
334 Ga0466959_0001464 3300045049 Bacteria 14467
335 Ga0466959_0014631 3300045049 Bacteria 5708
336 Ga0466959_0046460 3300045049 Bacteria 3194
337 Ga0466958_0001617 3300045836 Bacteria 10842
338 Ga0466958_0005363 3300045836 Bacteria 6889
339 Ga0466958_0091739 3300045836 Bacteria 1881
340 Ga0466958_0162550 3300045836 Bacteria 1411
341 Ga0466967_0001002 3300045976 Bacteria 15413
342 Ga0466967_0004740 3300045976 Bacteria 9253
343 Ga0466967_0006851 3300045976 Bacteria 8130
344 Ga0466967_0027823 3300045976 Bacteria 4709
345 Ga0466967_0040152 3300045976 Bacteria 4027
346 Ga0466967_0064248 3300045976 Bacteria 3263
347 Ga0466967_0099987 3300045976 Bacteria 2649
348 Ga0466967_0300195 3300045976 Bacteria 1545
349 Ga0466967_0335872 3300045976 Bacteria 1460
350 Ga0466967_0351525 3300045976 Bacteria 1427
351 Ga0466967_0353698 3300045976 Bacteria 1422
352 Ga0466967_0747992 3300045976 Bacteria 969
353 Ga0495592_0145852 3300046454 Bacteria 1641
354 Ga0495629_0202789 3300046459 Bacteria 1371
355 Ga0495641_0006906 3300046461 Bacteria 7243
356 Ga0495641_0034868 3300046461 Bacteria 2376
357 Ga0495641_0042503 3300046461 Bacteria 2106
358 Ga0495651_0010955 3300046462 Bacteria 6975
359 Ga0495650_0000053 3300046471 Bacteria 316684
360 Ga0495582_0099192 3300046473 Bacteria 1630
361 Ga0495662_0111604 3300046476 Bacteria 1340
362 Ga0495664_0205994 3300046477 Bacteria 1192
363 Ga0495664_0342590 3300046477 Bacteria 901
364 Ga0495596_0076942 3300046500 Bacteria 1296
365 Ga0495618_0027308 3300046514 Bacteria 3554
366 Ga0495631_0187082 3300046518 Bacteria 887
367 Ga0495632_0179314 3300046519 Bacteria 971
368 Ga0495644_0008448 3300046523 Bacteria 3967
369 Ga0495652_0106110 3300046529 Bacteria 2269
370 Ga0495667_0046512 3300046559 Bacteria 2869
371 Ga0495656_0008515 3300046615 Bacteria 3664
372 Ga0495635_0011412 3300046663 Bacteria 6232
373 Ga0495657_0010844 3300046675 Bacteria 6841
374 Ga0495647_0021635 3300046681 Bacteria 2317
375 Ga0495658_0014291 3300046683 Bacteria 4054
376 Ga0495658_0202614 3300046683 Bacteria 1237
377 Ga0495589_0187057 3300046794 Bacteria 981
378 Ga0495600_0135576 3300046809 Bacteria 1599
379 Ga0495604_0223686 3300047317 Bacteria 1294
380 Ga0495674_0015458 3300047319 Bacteria 7132
381 Ga0495674_0532214 3300047319 Bacteria 937
382 Ga0495672_0052078 3300047320 Bacteria 2406
383 Ga0495676_0109852 3300047321 Bacteria 2025
384 Ga0495680_0003599 3300047322 Bacteria 15170
385 Ga0495675_0027217 3300047444 Bacteria 3644
386 Ga0495673_0012407 3300047469 Bacteria 4522
387 Ga0495684_0011380 3300047471 Bacteria 6870
388 Ga0496100_0001662 3300048903 Bacteria 11028
389 Ga0496100_0358450 3300048903 Bacteria 1103
390 Ga0496100_0679951 3300048903 Bacteria 802
391 Ga0496101_0001032 3300048904 Bacteria 16420
392 Ga0496101_0001988 3300048904 Bacteria 12406
393 Ga0496101_0111063 3300048904 Bacteria 2063
394 Ga0496102_0450930 3300048905 Bacteria 1207
395 Ga0496104_0013656 3300048907 Bacteria 7322
396 Ga0496104_0058522 3300048907 Bacteria 3648
397 Ga0496104_0066408 3300048907 Bacteria 3425
398 Ga0496105_0217134 3300048908 Bacteria 1557
399 Ga0496105_0473789 3300048908 Bacteria 986
400 Ga0496106_0015340 3300048909 Bacteria 5670
401 Ga0496106_0213273 3300048909 Bacteria 1538
402 Ga0496107_0002155 3300048910 Bacteria 12647
403 Ga0496107_0038123 3300048910 Bacteria 3449
404 Ga0496107_0250323 3300048910 Bacteria 1318
405 Ga0496108_0002529 3300048911 Bacteria 14633
406 Ga0496108_0013342 3300048911 Bacteria 6700
407 Ga0496108_0085236 3300048911 Bacteria 2681
408 Ga0496108_0124361 3300048911 Bacteria 2214
409 Ga0496108_0695403 3300048911 Bacteria 882
410 Ga0496109_0007698 3300048912 Bacteria 9129
411 Ga0496109_0035002 3300048912 Bacteria 4527
412 Ga0496109_0215502 3300048912 Bacteria 1805
413 Ga0496109_0336368 3300048912 Bacteria 1426
414 Ga0496110_0001092 3300048913 Bacteria 19117
415 Ga0496110_0555201 3300048913 Bacteria 1043
416 Ga0496111_0024384 3300048914 Bacteria 4259
417 Ga0496111_0042675 3300048914 Bacteria 3257
418 Ga0496111_0135410 3300048914 Bacteria 1824
419 Ga0496112_0000095 3300048915 Bacteria 57431
420 Ga0496112_0036205 3300048915 Bacteria 4813
421 Ga0496112_0042428 3300048915 Bacteria 4451
422 Ga0496112_0097313 3300048915 Bacteria 2913
423 Ga0496112_0145218 3300048915 Bacteria 2341
424 Ga0496112_0520338 3300048915 Bacteria 1124
425 Ga0496112_0533058 3300048915 Bacteria 1108
426 Ga0496113_0003866 3300048916 Bacteria 9068
427 Ga0496113_0066251 3300048916 Bacteria 2735
428 Ga0496113_0113703 3300048916 Bacteria 2110
429 Ga0496113_0742114 3300048916 Bacteria 782
430 Ga0496114_0174589 3300048917 Bacteria 1874
431 Ga0496114_0217393 3300048917 Bacteria 1677
432 Ga0496115_0005651 3300048918 Bacteria 9094
433 Ga0496115_0478963 3300048918 Bacteria 1002
434 Ga0496119_0200835 3300048922 Bacteria 1032
435 Ga0496121_0002770 3300048924 Bacteria 26007
436 Ga0496126_0207358 3300048929 Bacteria 1652
437 Ga0501034_0008091 3300049571 Bacteria 11153
438 Ga0501034_0385490 3300049571 Bacteria 1326
439 Ga0501036_0235928 3300049572 Bacteria 1534
440 Ga0501039_0113175 3300049575 Bacteria 2122
441 Ga0501039_0548008 3300049575 Bacteria 907
442 Ga0501040_0010625 3300049576 Bacteria 6021
443 Ga0501040_0091759 3300049576 Bacteria 2111
444 Ga0501041_0211450 3300049577 Bacteria 1216
445 Ga0501042_0141260 3300049578 Bacteria 1736
446 Ga0501046_0449740 3300049580 Bacteria 926
447 Ga0501048_0046630 3300049582 Bacteria 3093
448 Ga0501048_0063398 3300049582 Bacteria 2614
449 Ga0501048_0111621 3300049582 Bacteria 1930
450 Ga0501070_0185229 3300049586 Bacteria 1712
451 Ga0501070_0694103 3300049586 Bacteria 805
452 Ga0501070_0729182 3300049586 Bacteria 782
453 Ga0501071_0087176 3300049587 Bacteria 2290
454 Ga0501071_0121839 3300049587 Bacteria 1933
455 Ga0501071_0144586 3300049587 Bacteria 1772
456 Ga0501071_0264094 3300049587 Bacteria 1300
457 Ga0501072_0016803 3300049588 Bacteria 5620
458 Ga0501072_0038280 3300049588 Bacteria 3763
459 Ga0501074_0068386 3300049590 Bacteria 2553
460 Ga0501075_0020119 3300049591 Bacteria 4849
461 Ga0501075_0115517 3300049591 Bacteria 2041
462 Ga0501076_0030426 3300049592 Bacteria 4205
463 Ga0501076_0147010 3300049592 Bacteria 1916
464 Ga0501076_0529315 3300049592 Bacteria 972
465 Ga0501077_0016549 3300049593 Bacteria 4646
466 Ga0501079_0019643 3300049741 Bacteria 5160
467 Ga0501080_0081359 3300049742 Bacteria 3009
468 Ga0501080_0203012 3300049742 Bacteria 1819
469 Ga0501081_0018355 3300049743 Bacteria 4645
470 Ga0501081_0226238 3300049743 Bacteria 1361
471 Ga0501081_0482873 3300049743 Bacteria 922
472 Ga0501083_0025105 3300049744 Bacteria 4128
473 Ga0501035_0101777 3300049822 Bacteria 2521
474 Ga0501035_0151660 3300049822 Bacteria 2011
475 Ga0501035_0332672 3300049822 Bacteria 1274
476 Ga0501044_0467623 3300049823 Bacteria 1166
477 Ga0501045_0010013 3300049824 Bacteria 6631
478 Ga0501045_0244219 3300049824 Bacteria 1336
479 nmdc:mga00v17_24681_c1 3300050491 Bacteria 3488
480 nmdc:mga00v17_34256_c1 3300050491 Bacteria 3015
481 nmdc:mga00v17_78772_c1 3300050491 Bacteria 2054
482 nmdc:mga00v17_80638_c1 3300050491 Bacteria 2031
483 nmdc:mga0yw44_200428_c1 3300050492 Bacteria 1318
484 nmdc:mga0yw44_3109_c1 3300050492 Bacteria 7278
485 nmdc:mga0yw44_77001_c1 3300050492 Bacteria 2083
486 nmdc:mga0yw44_80072_c1 3300050492 Bacteria 2045
487 nmdc:mga0yw44_88197_c1 3300050492 Bacteria 1956
488 nmdc:mga05p37_185386_c1 3300050507 Bacteria 2530
489 nmdc:mga09592_151397_c1 3300050508 Bacteria 2001
490 nmdc:mga08y16_114787_c1 3300050511 Bacteria 2804
491 nmdc:mga08y16_226079_c1 3300050511 Bacteria 1936
492 nmdc:mga0n895_336090_c1 3300050512 Bacteria 1530
493 nmdc:mga0n895_458595_c1 3300050512 Bacteria 1286
494 nmdc:mga0a205_50302_c1 3300050515 Bacteria 4023
495 Ga0495601_0035823 3300053077 Bacteria 3099
496 Ga0495612_0247195 3300053078 Bacteria 793
497 Ga0495655_0066949 3300053083 Bacteria 995
498 Ga0495655_0096628 3300053083 Bacteria 869
499 Ga0495619_0018953 3300053085 Bacteria 4370
500 Ga0500616_0006584 3300053153 Bacteria 7574
501 Ga0501084_0014085 3300054114 Bacteria 6622
502 Ga0501084_0033542 3300054114 Bacteria 4295
503 Ga0501084_0261983 3300054114 Bacteria 1459
504 Ga0590075_051026 3300059424 Bacteria 1061
505 Ga0587083_0059437 3300059505 Bacteria 857
506 Ga0587090_019800 3300059510 Bacteria 1041
507 Ga0587111_0020888 3300060346 Bacteria 1257
508 Ga0501082_0176203 3300060353 Bacteria 1859
509 Ga0501082_0280830 3300060353 Bacteria 1449
510 Ga0466962_0015902 3300061719 Bacteria 3631
511 Ga0466962_0016871 3300061719 Bacteria 3519
512 Ga0466962_0223274 3300061719 Bacteria 923
513 Ga0530510_0076350 3300061734 Bacteria 2434
514 Ga0530510_0100672 3300061734 Bacteria 2113
515 Ga0530510_0169453 3300061734 Bacteria 1617
516 Ga0496102_0012915
517 JGI24737J22298_10017875
518 JGI24737J22298_10064496
519 JGI25405J52794_10036623
520 Ga0070676_10232008
521 Ga0070683_100088996
522 Ga0070683_100133311
523 Ga0070683_101153511
524 Ga0070690_100212496
525 Ga0070670_100390031
526 Ga0070682_100051419
527 Ga0070682_100150420
528 Ga0068868_100299714
529 Ga0068868_100754553
530 Ga0068868_100979508
531 Ga0070660_100001669
532 Ga0070660_100186754
533 Ga0070660_100880788
534 Ga0070689_100100164
535 Ga0070691_10054227
536 Ga0070692_10056974
537 Ga0070692_10197634
538 Ga0070692_10362612
539 Ga0070668_100030302
540 Ga0070675_100029576
541 Ga0070671_100278381
542 Ga0070674_100019860
543 Ga0070674_100122245
544 Ga0070674_100712864
545 Ga0070688_100221808
546 Ga0070659_100014074
547 Ga0070659_100031084
548 Ga0070709_10175567
549 Ga0070714_100019766
550 Ga0070714_100457058
551 Ga0070713_100201107
552 Ga0070713_100554440
553 Ga0070711_100228215
554 Ga0070700_100008502
555 Ga0070700_100030467
556 Ga0070700_100077913
557 Ga0070663_100002800
558 Ga0070678_100199985
559 Ga0070678_100318810
560 Ga0070662_100059992
561 Ga0070662_100119426
562 Ga0070662_100131853
563 Ga0070681_10493321
564 Ga0068867_100090687
565 Ga0070685_10124147
566 Ga0070684_100032378
567 Ga0070684_100152709
568 Ga0070684_100377979
569 Ga0070684_100738316
570 Ga0068853_100028808
571 Ga0070686_100632579
572 Ga0070693_100237123
573 Ga0070665_100197463
574 Ga0070664_100183995
575 Ga0070664_100282983
576 Ga0068857_100167556
577 Ga0068857_100338952
578 Ga0068854_100070754
579 Ga0068854_100102260
580 Ga0068856_101015888
581 Ga0070702_100021251
582 Ga0070702_100097458
583 Ga0070702_100495967
584 Ga0068852_100161162
585 Ga0068852_100553932
586 Ga0068859_100133108
587 Ga0068859_100278622
588 Ga0068864_100097205
589 Ga0068864_100546086
590 Ga0068861_100496396
591 Ga0068870_10021017
592 Ga0068863_100461385
593 Ga0068858_100163827
594 Ga0068860_100104399
595 Ga0081455_10007545
596 Ga0081538_10001191
597 Ga0081540_1000568
598 Ga0081539_10001045
599 Ga0081539_10001489
600 Ga0081539_10005444
601 Ga0070717_10028271
602 Ga0070717_10110889
603 Ga0075365_10001589
604 Ga0075365_10006537
605 Ga0075365_10019279
606 Ga0075368_10056615
607 Ga0075363_100008514
608 Ga0075363_100041207
609 Ga0075363_100092696
610 Ga0075363_100204917
611 Ga0075364_10059932
612 Ga0075364_10294487
613 Ga0075432_10061981
614 Ga0070715_10057327
615 Ga0070712_100000013
616 Ga0070712_100002893
617 Ga0070712_100067270
618 Ga0075367_10065179
619 Ga0097621_100770796
620 Ga0068871_100375678
621 Ga0075434_100158025
622 Ga0075434_100356912
623 Ga0068865_100001280
624 Ga0068865_100114880
625 Ga0068865_100619216
626 Ga0068865_100922714
627 Ga0097620_100133112
628 Ga0097620_100278624
629 Ga0075435_100495085
630 Ga0105240_10018075
631 Ga0111539_10063618
632 Ga0105245_10350196
633 Ga0105245_10894708
634 Ga0105247_10229146
635 Ga0105243_10023540
636 Ga0105243_10176524
637 Ga0105243_10214267
638 Ga0105243_10275440
639 Ga0105243_10303868
640 Ga0105243_10778866
641 Ga0105241_10127111
642 Ga0105242_10098001
643 Ga0105242_10129852
644 Ga0105248_10244961
645 Ga0105237_10740336
646 Ga0105238_10678829
647 Ga0105239_10040445
648 Ga0105239_10403099
649 Ga0105239_11028559
650 Ga0105246_10167617
651 Ga0157371_10313935
652 Ga0157378_10186833
653 Ga0157378_11388859
654 Ga0163162_10574445
655 Ga0157372_10391961
656 Ga0157372_11330501
657 Ga0157375_10056009
658 Ga0157375_10157295
659 Ga0163163_10046316
660 Ga0157380_10049473
661 Ga0157380_10538390
662 Ga0157380_10540175
663 Ga0157379_10160198
664 Ga0163161_10133540
665 Ga0163161_10332112
666 Ga0197907_10991395
667 Ga0213875_10014084
668 Ga0213875_10064693
669 Ga0207426_1042188
670 Ga0207656_10105523
671 Ga0207642_10043753
672 Ga0207710_10200003
673 Ga0207710_10241315
674 Ga0207688_10030391
675 Ga0207688_10049244
676 Ga0207688_10060014
677 Ga0207647_10057343
678 Ga0207645_10187261
679 Ga0207643_10019273
680 Ga0207643_10025586
681 Ga0207643_10253678
682 Ga0207705_10030926
683 Ga0207695_10017468
684 Ga0207671_10100708
685 Ga0207693_10007488
686 Ga0207693_10118510
687 Ga0207657_10004224
688 Ga0207657_10129189
689 Ga0207657_10480262
690 Ga0207652_10437287
691 Ga0207650_10506026
692 Ga0207659_10370722
693 Ga0207687_10067011
694 Ga0207687_10242623
695 Ga0207700_10624859
696 Ga0207664_10002161
697 Ga0207664_10344561
698 Ga0207690_10020757
699 Ga0207690_10149095
700 Ga0207690_10239941
701 Ga0207690_10489880
702 Ga0207706_10061353
703 Ga0207706_10123874
704 Ga0207706_10868030
705 Ga0207686_10054690
706 Ga0207709_10045449
707 Ga0207709_10051587
708 Ga0207709_10096377
709 Ga0207669_10080944
710 Ga0207669_10183989
711 Ga0207704_10011097
712 Ga0207691_10215905
713 Ga0207711_10139695
714 Ga0207661_10088111
715 Ga0207679_10063332
716 Ga0207679_10203615
717 Ga0207712_10165774
718 Ga0207712_10298660
719 Ga0207640_10179634
720 Ga0207677_10291858
721 Ga0207639_10040252
722 Ga0207639_10105773
723 Ga0207639_10384486
724 Ga0207678_10002606
725 Ga0207678_10286642
726 Ga0207708_10001007
727 Ga0207708_10082234
728 Ga0207708_10160813
729 Ga0207708_10441679
730 Ga0207702_10039414
731 Ga0207702_10184969
732 Ga0207648_10073188
733 Ga0207676_10094746
734 Ga0207674_10020606
735 Ga0207674_10160023
736 Ga0207675_100044705
737 Ga0207675_100423957
738 Ga0207675_100492231
739 Ga0207683_10140656
740 Ga0207683_10254433
741 Ga0207683_10305054
742 Ga0207698_10104880
743 Ga0207698_10194016
744 Ga0207698_10681668
745 Ga0207698_10696872
746 Ga0207428_10062582
747 Ga0268266_10267802
748 Ga0268266_10545380
749 Ga0268265_10463683
750 Ga0268265_10669667
751 Ga0265326_10002998
752 Ga0265319_1001901
753 Ga0265318_10000545
754 Ga0265322_10081786
755 Ga0265336_10000001
756 Ga0265338_10000004
757 Ga0265332_10207300
758 Ga0265325_10109896
759 Ga0265340_10000002
760 Ga0265339_10138895
761 Ga0265316_10030285
762 Ga0307408_100230751
763 Ga0316576_10122001
764 Ga0307405_10096618
765 Ga0307413_10076970
766 Ga0307410_10024313
767 Ga0307410_10040733
768 Ga0307410_10407211
769 Ga0307406_10093082
770 Ga0307406_10432386
771 Ga0307407_10021524
772 Ga0307407_10348128
773 Ga0307412_10152724
774 Ga0307412_10249379
775 Ga0307409_100048138
776 Ga0307409_100131999
777 Ga0307409_100572469
778 Ga0307409_100590347
779 Ga0307409_100868897
780 Ga0307416_100006134
781 Ga0307416_100169926
782 Ga0307416_100690692
783 Ga0307416_100700132
784 Ga0307416_100957700
785 Ga0307414_10070620
786 Ga0307414_10209494
787 Ga0307414_10557400
788 Ga0307414_10718167
789 Ga0307411_10058554
790 Ga0307415_100092951
791 Ga0307415_100238210
792 Ga0307415_100514167
793 Ga0373949_0078127
794 Ga0373953_0021152
795 Ga0373954_0022104
796 Ga0373957_0056611
797 Ga0373946_0277031
798 Ga0316574_0068583
799 Ga0373933_0308816
800 Ga0373937_0024988
801 Ga0316584_0110090
802 Ga0373925_0348231
803 Ga0395900_0002246
804 Ga0395898_0003455
805 Ga0395898_0105497
806 Ga0395898_0328615
807 Ga0395898_0350362
808 Ga0436364_1438537
809 Ga0395901_0006802
810 Ga0395901_0180843
811 Ga0395901_0519269
812 Ga0436365_0824534
813 Ga0436365_1102108
814 Ga0436365_1725409
815 Ga0436363_0012859
816 Ga0436363_0669888
817 Ga0436363_0850733
818 Ga0436362_0239758
819 Ga0451791_0327589
820 Ga0439448_0013856
821 Ga0439455_0014762
822 Ga0439463_037411
823 Ga0466972_0290006
824 Ga0466965_0056854
825 Ga0466965_0193315
826 Ga0466966_0033106
827 Ga0466963_0006643
828 Ga0466963_0019103
829 Ga0466963_0056025
830 Ga0466963_0237275
831 Ga0466963_0319092
832 Ga0466963_0323368
833 Ga0466963_0421331
834 Ga0466971_0030125
835 Ga0466971_0164061
836 Ga0466971_0207401
837 Ga0466968_0300984
838 Ga0466970_0223929
839 Ga0466970_0424286
840 Ga0466957_0023685
841 Ga0466957_0045760
842 Ga0466957_0049437
843 Ga0466957_0091952
844 Ga0466957_0156531
845 Ga0466957_0222145
846 Ga0466960_0000181
847 Ga0466960_0007477
848 Ga0466959_0000694
849 Ga0466959_0001464
850 Ga0466959_0014631
851 Ga0466959_0046460
852 Ga0466958_0001617
853 Ga0466958_0005363
854 Ga0466958_0091739
855 Ga0466958_0162550
856 Ga0466967_0001002
857 Ga0466967_0004740
858 Ga0466967_0006851
859 Ga0466967_0027823
860 Ga0466967_0040152
861 Ga0466967_0064248
862 Ga0466967_0099987
863 Ga0466967_0300195
864 Ga0466967_0335872
865 Ga0466967_0351525
866 Ga0466967_0353698
867 Ga0466967_0747992
868 Ga0495592_0145852
869 Ga0495629_0202789
870 Ga0495641_0006906
871 Ga0495641_0034868
872 Ga0495641_0042503
873 Ga0495651_0010955
874 Ga0495650_0000053
875 Ga0495582_0099192
876 Ga0495662_0111604
877 Ga0495664_0205994
878 Ga0495664_0342590
879 Ga0495596_0076942
880 Ga0495618_0027308
881 Ga0495631_0187082
882 Ga0495632_0179314
883 Ga0495644_0008448
884 Ga0495652_0106110
885 Ga0495667_0046512
886 Ga0495656_0008515
887 Ga0495635_0011412
888 Ga0495657_0010844
889 Ga0495647_0021635
890 Ga0495658_0014291
891 Ga0495658_0202614
892 Ga0495589_0187057
893 Ga0495600_0135576
894 Ga0495604_0223686
895 Ga0495674_0015458
896 Ga0495674_0532214
897 Ga0495672_0052078
898 Ga0495676_0109852
899 Ga0495680_0003599
900 Ga0495675_0027217
901 Ga0495673_0012407
902 Ga0495684_0011380
903 Ga0496100_0001662
904 Ga0496100_0358450
905 Ga0496100_0679951
906 Ga0496101_0001032
907 Ga0496101_0001988
908 Ga0496101_0111063
909 Ga0496102_0450930
910 Ga0496104_0013656
911 Ga0496104_0058522
912 Ga0496104_0066408
913 Ga0496105_0217134
914 Ga0496105_0473789
915 Ga0496106_0015340
916 Ga0496106_0213273
917 Ga0496107_0002155
918 Ga0496107_0038123
919 Ga0496107_0250323
920 Ga0496108_0002529
921 Ga0496108_0013342
922 Ga0496108_0085236
923 Ga0496108_0124361
924 Ga0496108_0695403
925 Ga0496109_0007698
926 Ga0496109_0035002
927 Ga0496109_0215502
928 Ga0496109_0336368
929 Ga0496110_0001092
930 Ga0496110_0555201
931 Ga0496111_0024384
932 Ga0496111_0042675
933 Ga0496111_0135410
934 Ga0496112_0000095
935 Ga0496112_0036205
936 Ga0496112_0042428
937 Ga0496112_0097313
938 Ga0496112_0145218
939 Ga0496112_0520338
940 Ga0496112_0533058
941 Ga0496113_0003866
942 Ga0496113_0066251
943 Ga0496113_0113703
944 Ga0496113_0742114
945 Ga0496114_0174589
946 Ga0496114_0217393
947 Ga0496115_0005651
948 Ga0496115_0478963
949 Ga0496119_0200835
950 Ga0496121_0002770
951 Ga0496126_0207358
952 Ga0501034_0008091
953 Ga0501034_0385490
954 Ga0501036_0235928
955 Ga0501039_0113175
956 Ga0501039_0548008
957 Ga0501040_0010625
958 Ga0501040_0091759
959 Ga0501041_0211450
960 Ga0501042_0141260
961 Ga0501046_0449740
962 Ga0501048_0046630
963 Ga0501048_0063398
964 Ga0501048_0111621
965 Ga0501070_0185229
966 Ga0501070_0694103
967 Ga0501070_0729182
968 Ga0501071_0087176
969 Ga0501071_0121839
970 Ga0501071_0144586
971 Ga0501071_0264094
972 Ga0501072_0016803
973 Ga0501072_0038280
974 Ga0501074_0068386
975 Ga0501075_0020119
976 Ga0501075_0115517
977 Ga0501076_0030426
978 Ga0501076_0147010
979 Ga0501076_0529315
980 Ga0501077_0016549
981 Ga0501079_0019643
982 Ga0501080_0081359
983 Ga0501080_0203012
984 Ga0501081_0018355
985 Ga0501081_0226238
986 Ga0501081_0482873
987 Ga0501083_0025105
988 Ga0501035_0101777
989 Ga0501035_0151660
990 Ga0501035_0332672
991 Ga0501044_0467623
992 Ga0501045_0010013
993 Ga0501045_0244219
994 nmdc:mga00v17_24681_c1
995 nmdc:mga00v17_34256_c1
996 nmdc:mga00v17_78772_c1
997 nmdc:mga00v17_80638_c1
998 nmdc:mga0yw44_200428_c1
999 nmdc:mga0yw44_3109_c1
1000 nmdc:mga0yw44_77001_c1
1001 nmdc:mga0yw44_80072_c1
1002 nmdc:mga0yw44_88197_c1
1003 nmdc:mga05p37_185386_c1
1004 nmdc:mga09592_151397_c1
1005 nmdc:mga08y16_114787_c1
1006 nmdc:mga08y16_226079_c1
1007 nmdc:mga0n895_336090_c1
1008 nmdc:mga0n895_458595_c1
1009 nmdc:mga0a205_50302_c1
1010 Ga0495601_0035823
1011 Ga0495612_0247195
1012 Ga0495655_0066949
1013 Ga0495655_0096628
1014 Ga0495619_0018953
1015 Ga0500616_0006584
1016 Ga0501084_0014085
1017 Ga0501084_0033542
1018 Ga0501084_0261983
1019 Ga0590075_051026
1020 Ga0587083_0059437
1021 Ga0587090_019800
1022 Ga0587111_0020888
1023 Ga0501082_0176203
1024 Ga0501082_0280830
1025 Ga0466962_0015902
1026 Ga0466962_0016871
1027 Ga0466962_0223274
1028 Ga0530510_0076350
1029 Ga0530510_0100672
1030 Ga0530510_0169453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

65

174

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p7j-assembly1.cif.gz_B complex i from e. coli, ddm/lmng-purified, with dq, open state 0.8845 40 181
6ziy-assembly1.cif.gz_6 respiratory complex i from thermus thermophilus, nadh dataset, major state 0.8831 44 180
6i0d-assembly2.cif.gz_G respiratory complex i from thermus thermophilus with bound decyl-ubiquinone 0.8816 44 180
7z80-assembly1.cif.gz_B complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, closed state 0.8794 44 181
5gpn-assembly1.cif.gz_a architecture of mammalian respirasome 0.8697 40 182
ID Description Score Start End Superfamily
3iasF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8622 41 180 3.40.50.12280
af_P0AFC7_20_188_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8346 28 182 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8338 55 181 3.40.50.12280
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8061 56 178 3.40.50.12280
af_P9WJH1_2_170_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8024 24 190 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A7C5BKH7-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.9036 35 181 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A7C3E9X9-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.9009 38 181 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A2G6MGY7-F1-model_v4 deleted 0.8989 45 181
AF-A0A257V0H8-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.8984 38 181 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539
AF-A0A1F9III3-F1-model_v4 NADH-quinone oxidoreductase subunit B (EC 7.1.1.-) (NADH dehydrogenase I subunit B) (NDH-1 subunit B) 0.8977 37 182 GO:0005506
GO:0005886
GO:0008137
GO:0009060
GO:0015990
GO:0045271
GO:0048038
GO:0050136
GO:0051539

Map