F457930

General Info

Members Datasets Scaffolds Average Seq Length
515 261 514 233

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0013264|Ga0500637_0013264_3303_4070
Length 255
Sequence MAAGSNEKSRPPLMSATAPGADASSAQRQFRYYDFIMAAYVCVLLCANLIGPAKLSTVRVPVFGDVTFLAGVLFFPISYVFGDVLTEVYGYARDRRVVWAGFGALAFASFMAAVVVHLPPATNWKDQSAVDTIFGNTPRIILGSITAFWSGSFVNSYVLAKMKIWTQGRWLWTRTIGSTLCGELVDSAIFYTIAFYGLWPVDQLIAVLFTQYVLKSTWEIVATPLTYKVVGFLKRKESEDFYDRATNFTPFSLKT

Samples

Sample ID Description Type Environment
1 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
260 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
261 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.58
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.19
Rhizoplane 4.85
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10172240 3300003316 Unclassified 1346
2 rootH1_10318854 3300003323 Bacteria 1326
3 Ga0065707_10083043 3300005295 Bacteria 10704
4 Ga0070658_10000547 3300005327 Bacteria 32575
5 Ga0070683_100148294 3300005329 Bacteria 2224
6 Ga0070690_100039753 3300005330 Bacteria 2973
7 Ga0070670_100033604 3300005331 Bacteria 4417
8 Ga0070670_100308222 3300005331 Bacteria 1385
9 Ga0070666_10010472 3300005335 Bacteria 5803
10 Ga0070666_10028306 3300005335 Bacteria 3676
11 Ga0070680_100005294 3300005336 Bacteria 9761
12 Ga0070680_100016607 3300005336 Bacteria 5793
13 Ga0070680_100056162 3300005336 Bacteria 3218
14 Ga0070682_100100571 3300005337 Bacteria 1908
15 Ga0068868_100003004 3300005338 Bacteria 11727
16 Ga0070660_100232638 3300005339 Unclassified 1500
17 Ga0070661_100021618 3300005344 Bacteria 4598
18 Ga0070675_100289231 3300005354 Bacteria 1442
19 Ga0070671_100000199 3300005355 Bacteria 40241
20 Ga0070671_100010893 3300005355 Bacteria 7302
21 Ga0070671_100533157 3300005355 Bacteria 1011
22 Ga0070673_100161018 3300005364 Bacteria 1909
23 Ga0070667_100000069 3300005367 Bacteria 126807
24 Ga0070667_100004680 3300005367 Bacteria 11487
25 Ga0070667_100012032 3300005367 Bacteria 7162
26 Ga0070667_100050279 3300005367 Bacteria 3513
27 Ga0070667_100313066 3300005367 Bacteria 1415
28 Ga0070709_10000986 3300005434 Bacteria 15746
29 Ga0070709_10101605 3300005434 Bacteria 1916
30 Ga0070709_10189511 3300005434 Bacteria 1450
31 Ga0070714_100005208 3300005435 Bacteria 9896
32 Ga0070714_100216354 3300005435 Bacteria 1759
33 Ga0070714_100235041 3300005435 Bacteria 1690
34 Ga0070713_100002662 3300005436 Bacteria 11640
35 Ga0070713_100029679 3300005436 Bacteria 4333
36 Ga0070713_100216741 3300005436 Bacteria 1735
37 Ga0070713_100481725 3300005436 Bacteria 1169
38 Ga0070710_10012975 3300005437 Bacteria 4156
39 Ga0070710_10451029 3300005437 Bacteria 872
40 Ga0070711_100000649 3300005439 Bacteria 18137
41 Ga0070711_100124324 3300005439 Bacteria 1913
42 Ga0070705_100403395 3300005440 Bacteria 1013
43 Ga0070678_100051360 3300005456 Bacteria 2988
44 Ga0070662_100021488 3300005457 Bacteria 4407
45 Ga0070662_100116405 3300005457 Bacteria 2043
46 Ga0070681_10001618 3300005458 Bacteria 20059
47 Ga0070681_10002712 3300005458 Bacteria 16300
48 Ga0070681_10016827 3300005458 Bacteria 7302
49 Ga0070681_10017608 3300005458 Bacteria 7141
50 Ga0070681_10066376 3300005458 Bacteria 3577
51 Ga0070681_10119294 3300005458 Bacteria 2574
52 Ga0070681_10120157 3300005458 Bacteria 2563
53 Ga0070681_10154498 3300005458 Bacteria 2220
54 Ga0070681_10410151 3300005458 Unclassified 1266
55 Ga0070685_10078657 3300005466 Bacteria 1972
56 Ga0070679_100004670 3300005530 Bacteria 12639
57 Ga0070679_100011264 3300005530 Bacteria 8524
58 Ga0070679_100042103 3300005530 Bacteria 4548
59 Ga0070679_100181141 3300005530 Bacteria 2079
60 Ga0070679_100295438 3300005530 Bacteria 1571
61 Ga0070697_100150041 3300005536 Bacteria 1964
62 Ga0068853_100002295 3300005539 Bacteria 14297
63 Ga0068853_100007799 3300005539 Bacteria 8584
64 Ga0068853_100077837 3300005539 Unclassified 2898
65 Ga0068853_100197453 3300005539 Bacteria 1830
66 Ga0068853_100359937 3300005539 Bacteria 1355
67 Ga0070686_100109309 3300005544 Unclassified 1881
68 Ga0070695_100030241 3300005545 Bacteria 3371
69 Ga0070695_100059795 3300005545 Bacteria 2468
70 Ga0070696_100000233 3300005546 Bacteria 33711
71 Ga0070693_100599201 3300005547 Bacteria 795
72 Ga0070665_100002460 3300005548 Bacteria 20415
73 Ga0070665_100012162 3300005548 Bacteria 8677
74 Ga0070665_100138108 3300005548 Bacteria 2440
75 Ga0070665_100238596 3300005548 Bacteria 1819
76 Ga0070665_100596548 3300005548 Bacteria 1117
77 Ga0068855_100000592 3300005563 Bacteria 44394
78 Ga0068855_100004608 3300005563 Bacteria 16829
79 Ga0068855_100220388 3300005563 Bacteria 2128
80 Ga0068855_100301393 3300005563 Bacteria 1775
81 Ga0070664_100002024 3300005564 Bacteria 16250
82 Ga0070664_100013450 3300005564 Bacteria 6664
83 Ga0068857_100034436 3300005577 Bacteria 4480
84 Ga0068857_100321171 3300005577 Bacteria 1430
85 Ga0068854_100105587 3300005578 Bacteria 2118
86 Ga0068856_100046028 3300005614 Bacteria 4297
87 Ga0068852_100341005 3300005616 Bacteria 1460
88 Ga0068852_100432356 3300005616 Bacteria 1300
89 Ga0068852_100443987 3300005616 Bacteria 1283
90 Ga0068859_100002486 3300005617 Bacteria 18754
91 Ga0068859_100063169 3300005617 Bacteria 3734
92 Ga0068859_100072520 3300005617 Bacteria 3480
93 Ga0068859_100385853 3300005617 Bacteria 1496
94 Ga0068864_100079163 3300005618 Bacteria 2877
95 Ga0068864_100308824 3300005618 Bacteria 1482
96 Ga0068864_100423801 3300005618 Bacteria 1268
97 Ga0068866_10007506 3300005718 Bacteria 4567
98 Ga0068861_100430065 3300005719 Bacteria 1178
99 Ga0068851_10360481 3300005834 Bacteria 848
100 Ga0068863_100016434 3300005841 Bacteria 7099
101 Ga0068863_100081510 3300005841 Bacteria 3065
102 Ga0068863_100086151 3300005841 Bacteria 2976
103 Ga0068863_100231147 3300005841 Bacteria 1784
104 Ga0068863_100865186 3300005841 Unclassified 903
105 Ga0068858_100000285 3300005842 Bacteria 54696
106 Ga0068858_100005143 3300005842 Bacteria 12816
107 Ga0068858_100012491 3300005842 Bacteria 8010
108 Ga0068858_100101833 3300005842 Bacteria 2679
109 Ga0068860_100001390 3300005843 Bacteria 26246
110 Ga0068860_100005786 3300005843 Bacteria 12457
111 Ga0068860_100012863 3300005843 Bacteria 8226
112 Ga0068862_100033959 3300005844 Bacteria 4315
113 Ga0068862_100152003 3300005844 Bacteria 2061
114 Ga0068862_100788189 3300005844 Unclassified 927
115 Ga0070715_10000239 3300006163 Bacteria 13132
116 Ga0070716_100014146 3300006173 Bacteria 4083
117 Ga0070716_100015412 3300006173 Bacteria 3927
118 Ga0070716_100129708 3300006173 Bacteria 1592
119 Ga0070712_100000751 3300006175 Bacteria 19153
120 Ga0070712_100054077 3300006175 Bacteria 2805
121 Ga0097621_100244832 3300006237 Unclassified 1568
122 Ga0068871_100128773 3300006358 Bacteria 2144
123 Ga0075434_100207272 3300006871 Bacteria 1981
124 Ga0068865_100033036 3300006881 Bacteria 3462
125 Ga0097620_100002486 3300006931 Bacteria 18754
126 Ga0097620_100063167 3300006931 Bacteria 3734
127 Ga0097620_100072519 3300006931 Bacteria 3480
128 Ga0097620_100385829 3300006931 Bacteria 1496
129 Ga0099795_10011101 3300007788 Bacteria 2678
130 Ga0105251_10007536 3300009011 Bacteria 6686
131 Ga0105250_10154128 3300009092 Unclassified 957
132 Ga0105240_10014082 3300009093 Bacteria 10929
133 Ga0105240_10024226 3300009093 Bacteria 8008
134 Ga0105240_10044583 3300009093 Bacteria 5635
135 Ga0105240_10049421 3300009093 Bacteria 5308
136 Ga0105240_10060987 3300009093 Bacteria 4701
137 Ga0105240_10085366 3300009093 Bacteria 3867
138 Ga0105240_10096276 3300009093 Bacteria 3607
139 Ga0105240_10097222 3300009093 Bacteria 3588
140 Ga0105240_10252307 3300009093 Bacteria 2040
141 Ga0105240_10286210 3300009093 Bacteria 1891
142 Ga0105240_11000919 3300009093 Bacteria 894
143 Ga0105245_10017497 3300009098 Bacteria 6254
144 Ga0105247_10000072 3300009101 Bacteria 113959
145 Ga0105247_10010957 3300009101 Bacteria 5474
146 Ga0105247_10072899 3300009101 Bacteria 2150
147 Ga0105247_10167367 3300009101 Bacteria 1459
148 Ga0105241_10004905 3300009174 Bacteria 9868
149 Ga0105241_10162684 3300009174 Bacteria 1836
150 Ga0105241_10758046 3300009174 Bacteria 891
151 Ga0105242_10001357 3300009176 Bacteria 19306
152 Ga0105242_10044453 3300009176 Bacteria 3598
153 Ga0105248_10024681 3300009177 Bacteria 6685
154 Ga0105248_10156395 3300009177 Bacteria 2573
155 Ga0105248_10283034 3300009177 Bacteria 1867
156 Ga0105237_10041800 3300009545 Bacteria 4622
157 Ga0105237_10055385 3300009545 Bacteria 3972
158 Ga0105237_10160215 3300009545 Bacteria 2248
159 Ga0105237_10165993 3300009545 Bacteria 2207
160 Ga0105237_10214698 3300009545 Bacteria 1924
161 Ga0105237_10237202 3300009545 Bacteria 1825
162 Ga0105238_10001369 3300009551 Bacteria 24451
163 Ga0105238_10074591 3300009551 Bacteria 3385
164 Ga0105238_10121155 3300009551 Bacteria 2595
165 Ga0105238_10556983 3300009551 Bacteria 1151
166 Ga0105249_10123348 3300009553 Bacteria 2464
167 Ga0105249_10127726 3300009553 Bacteria 2423
168 Ga0105249_10138848 3300009553 Bacteria 2328
169 Ga0105249_10355709 3300009553 Bacteria 1485
170 Ga0105249_10598732 3300009553 Bacteria 1157
171 Ga0099796_10008949 3300010159 Bacteria 2689
172 Ga0099796_10009133 3300010159 Bacteria 2671
173 Ga0105239_10108339 3300010375 Bacteria 3078
174 Ga0105239_10119087 3300010375 Bacteria 2930
175 Ga0105239_10213673 3300010375 Bacteria 2162
176 Ga0105239_11093170 3300010375 Bacteria 918
177 Ga0105246_10124287 3300011119 Bacteria 1917
178 Ga0157373_10035286 3300013100 Bacteria 3591
179 Ga0157370_10001792 3300013104 Bacteria 26474
180 Ga0157370_10169615 3300013104 Unclassified 2029
181 Ga0157369_10008374 3300013105 Bacteria 11859
182 Ga0157369_10020588 3300013105 Bacteria 7374
183 Ga0157369_10248168 3300013105 Bacteria 1858
184 Ga0157369_10402517 3300013105 Unclassified 1420
185 Ga0157369_10911709 3300013105 Bacteria 901
186 Ga0157374_10024555 3300013296 Bacteria 5405
187 Ga0157374_10143663 3300013296 Bacteria 2317
188 Ga0157378_10014547 3300013297 Bacteria 6890
189 Ga0163162_10080654 3300013306 Bacteria 3322
190 Ga0163162_10151550 3300013306 Unclassified 2437
191 Ga0163162_10229947 3300013306 Bacteria 1985
192 Ga0163162_10457560 3300013306 Bacteria 1408
193 Ga0157375_10096475 3300013308 Bacteria 3029
194 Ga0157375_10391035 3300013308 Bacteria 1557
195 Ga0163163_10043200 3300014325 Bacteria 4418
196 Ga0163163_10080037 3300014325 Bacteria 3267
197 Ga0163163_10249199 3300014325 Bacteria 1826
198 Ga0163163_10251471 3300014325 Bacteria 1818
199 Ga0163163_10872868 3300014325 Bacteria 963
200 Ga0157377_10210600 3300014745 Bacteria 1239
201 Ga0157379_10002427 3300014968 Bacteria 15597
202 Ga0157379_10157471 3300014968 Bacteria 2049
203 Ga0157379_10283657 3300014968 Bacteria 1507
204 Ga0157376_10534142 3300014969 Bacteria 1158
205 Ga0213873_10027418 3300021358 Bacteria 1389
206 Ga0213874_10007878 3300021377 Bacteria 2574
207 Ga0213876_10093751 3300021384 Bacteria 1591
208 Ga0213876_10110787 3300021384 Bacteria 1457
209 Ga0207656_10062917 3300025321 Unclassified 1632
210 Ga0207692_10061923 3300025898 Bacteria 1941
211 Ga0207642_10005524 3300025899 Bacteria 4130
212 Ga0207710_10000238 3300025900 Bacteria 47168
213 Ga0207710_10011690 3300025900 Bacteria 3692
214 Ga0207688_10157665 3300025901 Bacteria 1344
215 Ga0207680_10015552 3300025903 Unclassified 3973
216 Ga0207680_10018594 3300025903 Bacteria 3698
217 Ga0207680_10060528 3300025903 Bacteria 2305
218 Ga0207699_10002835 3300025906 Bacteria 8210
219 Ga0207699_10052276 3300025906 Bacteria 2418
220 Ga0207705_10003787 3300025909 Bacteria 11520
221 Ga0207654_10018236 3300025911 Bacteria 3679
222 Ga0207654_10323801 3300025911 Bacteria 1054
223 Ga0207654_10392955 3300025911 Bacteria 963
224 Ga0207707_10000411 3300025912 Bacteria 44888
225 Ga0207707_10009225 3300025912 Bacteria 8562
226 Ga0207707_10037473 3300025912 Bacteria 4238
227 Ga0207707_10101983 3300025912 Bacteria 2508
228 Ga0207707_10508912 3300025912 Bacteria 1026
229 Ga0207695_10007491 3300025913 Bacteria 13865
230 Ga0207695_10043261 3300025913 Bacteria 4800
231 Ga0207695_10044022 3300025913 Bacteria 4752
232 Ga0207695_10047312 3300025913 Bacteria 4553
233 Ga0207695_10089287 3300025913 Bacteria 3099
234 Ga0207695_10091540 3300025913 Bacteria 3055
235 Ga0207695_10238573 3300025913 Bacteria 1720
236 Ga0207695_10374491 3300025913 Bacteria 1310
237 Ga0207695_10395213 3300025913 Bacteria 1267
238 Ga0207695_10524458 3300025913 Bacteria 1066
239 Ga0207671_10073699 3300025914 Bacteria 2550
240 Ga0207671_10311797 3300025914 Bacteria 1244
241 Ga0207693_10000161 3300025915 Bacteria 61727
242 Ga0207693_10038794 3300025915 Bacteria 3750
243 Ga0207663_10015294 3300025916 Bacteria 4231
244 Ga0207663_10036946 3300025916 Bacteria 2941
245 Ga0207663_10173553 3300025916 Bacteria 1533
246 Ga0207660_10005790 3300025917 Bacteria 8023
247 Ga0207660_10095700 3300025917 Bacteria 2210
248 Ga0207657_10089443 3300025919 Bacteria 2572
249 Ga0207652_10005406 3300025921 Bacteria 10365
250 Ga0207652_10034482 3300025921 Bacteria 4265
251 Ga0207652_10040082 3300025921 Bacteria 3977
252 Ga0207652_10151656 3300025921 Bacteria 2075
253 Ga0207694_10016981 3300025924 Bacteria 5497
254 Ga0207694_10019306 3300025924 Bacteria 5153
255 Ga0207694_10081266 3300025924 Bacteria 2545
256 Ga0207694_10209384 3300025924 Unclassified 1588
257 Ga0207694_10502874 3300025924 Bacteria 1015
258 Ga0207694_10511297 3300025924 Bacteria 1006
259 Ga0207659_10369824 3300025926 Bacteria 1193
260 Ga0207687_10056552 3300025927 Bacteria 2753
261 Ga0207700_10010500 3300025928 Bacteria 5848
262 Ga0207700_10011997 3300025928 Bacteria 5561
263 Ga0207700_10184670 3300025928 Bacteria 1748
264 Ga0207700_10212562 3300025928 Bacteria 1636
265 Ga0207664_10185910 3300025929 Bacteria 1786
266 Ga0207644_10004142 3300025931 Bacteria 9403
267 Ga0207644_10302045 3300025931 Bacteria 1290
268 Ga0207644_10480932 3300025931 Unclassified 1023
269 Ga0207690_10081363 3300025932 Bacteria 2263
270 Ga0207706_10231017 3300025933 Bacteria 1618
271 Ga0207686_10012371 3300025934 Bacteria 4692
272 Ga0207686_10266948 3300025934 Bacteria 1257
273 Ga0207686_10484394 3300025934 Bacteria 957
274 Ga0207670_10010211 3300025936 Bacteria 5399
275 Ga0207704_10117860 3300025938 Bacteria 1809
276 Ga0207665_10013204 3300025939 Bacteria 5432
277 Ga0207665_10015339 3300025939 Bacteria 5031
278 Ga0207665_10410189 3300025939 Bacteria 1033
279 Ga0207711_10058578 3300025941 Bacteria 3315
280 Ga0207711_10071438 3300025941 Bacteria 3011
281 Ga0207661_10103487 3300025944 Bacteria 2396
282 Ga0207661_10203090 3300025944 Bacteria 1743
283 Ga0207679_10015619 3300025945 Bacteria 5024
284 Ga0207679_10151861 3300025945 Unclassified 1886
285 Ga0207667_10012498 3300025949 Bacteria 9775
286 Ga0207667_10045762 3300025949 Bacteria 4633
287 Ga0207667_10184786 3300025949 Bacteria 2140
288 Ga0207667_10604637 3300025949 Bacteria 1105
289 Ga0207651_10333301 3300025960 Bacteria 1272
290 Ga0207712_10080295 3300025961 Bacteria 2372
291 Ga0207712_10110678 3300025961 Unclassified 2060
292 Ga0207712_10143993 3300025961 Bacteria 1833
293 Ga0207658_10000038 3300025986 Bacteria 145669
294 Ga0207658_10070283 3300025986 Bacteria 2648
295 Ga0207658_10073432 3300025986 Bacteria 2596
296 Ga0207658_10130178 3300025986 Bacteria 2020
297 Ga0207677_10139594 3300026023 Bacteria 1853
298 Ga0207703_10000605 3300026035 Bacteria 36427
299 Ga0207703_10000754 3300026035 Bacteria 31947
300 Ga0207639_10022623 3300026041 Bacteria 4529
301 Ga0207639_10120224 3300026041 Unclassified 2157
302 Ga0207639_10264184 3300026041 Bacteria 1507
303 Ga0207639_10460345 3300026041 Bacteria 1156
304 Ga0207678_10627293 3300026067 Bacteria 943
305 Ga0207702_10094289 3300026078 Bacteria 2627
306 Ga0207702_10187066 3300026078 Bacteria 1910
307 Ga0207641_10000083 3300026088 Bacteria 134703
308 Ga0207641_10007436 3300026088 Bacteria 9113
309 Ga0207641_10091759 3300026088 Bacteria 2659
310 Ga0207641_10113790 3300026088 Bacteria 2403
311 Ga0207676_10037279 3300026095 Bacteria 3704
312 Ga0207676_10310065 3300026095 Unclassified 1444
313 Ga0207676_10636925 3300026095 Unclassified 1027
314 Ga0207676_10735490 3300026095 Bacteria 958
315 Ga0207674_10017178 3300026116 Bacteria 7897
316 Ga0207674_10288644 3300026116 Bacteria 1589
317 Ga0207675_100211102 3300026118 Unclassified 1867
318 Ga0207683_10002925 3300026121 Bacteria 14881
319 Ga0207683_10341977 3300026121 Unclassified 1372
320 Ga0207698_10143352 3300026142 Bacteria 2062
321 Ga0209282_1000048 3300027666 Bacteria 111312
322 Ga0268266_10004881 3300028379 Bacteria 12720
323 Ga0268266_10108106 3300028379 Bacteria 2460
324 Ga0268266_10172365 3300028379 Bacteria 1964
325 Ga0268265_10036855 3300028380 Bacteria 3585
326 Ga0268265_10497682 3300028380 Bacteria 1148
327 Ga0268264_10000122 3300028381 Bacteria 189690
328 Ga0268264_10073145 3300028381 Unclassified 2908
329 Ga0265319_1003256 3300028563 Bacteria 8545
330 Ga0265334_10000783 3300028573 Bacteria 15888
331 Ga0265318_10000270 3300028577 Bacteria 44032
332 Ga0265338_10000908 3300028800 Bacteria 49878
333 Ga0265338_10038982 3300028800 Bacteria 4491
334 Ga0265338_10049953 3300028800 Bacteria 3785
335 Ga0307511_10000519 3300030521 Bacteria 41413
336 Ga0307511_10031086 3300030521 Bacteria 4778
337 Ga0265762_1020903 3300030760 Bacteria 1205
338 Ga0265760_10006363 3300031090 Bacteria 3378
339 Ga0265760_10023643 3300031090 Unclassified 1786
340 Ga0265330_10006183 3300031235 Bacteria 5927
341 Ga0265330_10210951 3300031235 Bacteria 820
342 Ga0265332_10002881 3300031238 Bacteria 8502
343 Ga0265328_10006797 3300031239 Bacteria 4810
344 Ga0265320_10031924 3300031240 Bacteria 2701
345 Ga0265325_10001369 3300031241 Bacteria 17208
346 Ga0265329_10013346 3300031242 Bacteria 2931
347 Ga0265340_10001829 3300031247 Bacteria 12159
348 Ga0265340_10018843 3300031247 Bacteria 3557
349 Ga0265339_10011088 3300031249 Bacteria 5565
350 Ga0265339_10118631 3300031249 Bacteria 1362
351 Ga0265331_10009402 3300031250 Bacteria 5486
352 Ga0265327_10103801 3300031251 Unclassified 1367
353 Ga0265316_10008294 3300031344 Bacteria 9651
354 Ga0307509_10000001 3300031507 Bacteria 629324
355 Ga0307408_100622058 3300031548 Bacteria 962
356 Ga0265313_10002084 3300031595 Bacteria 17870
357 Ga0265314_10097362 3300031711 Bacteria 1900
358 Ga0265342_10002903 3300031712 Bacteria 14458
359 Ga0307516_10002208 3300031730 Bacteria 26358
360 Ga0307405_10134929 3300031731 Bacteria 1712
361 Ga0307413_10048890 3300031824 Bacteria 2531
362 Ga0307410_10008017 3300031852 Bacteria 5826
363 Ga0307410_10032832 3300031852 Bacteria 3346
364 Ga0307410_10033002 3300031852 Unclassified 3339
365 Ga0307406_10027106 3300031901 Bacteria 3449
366 Ga0307406_10355896 3300031901 Bacteria 1146
367 Ga0307407_10017706 3300031903 Bacteria 3583
368 Ga0307412_10020830 3300031911 Bacteria 3997
369 Ga0307409_100000356 3300031995 Bacteria 19078
370 Ga0307409_100292940 3300031995 Unclassified 1510
371 Ga0307414_10056028 3300032004 Bacteria 2763
372 Ga0307414_10084890 3300032004 Bacteria 2331
373 Ga0307411_10006059 3300032005 Bacteria 6011
374 Ga0307411_10030516 3300032005 Bacteria 3305
375 Ga0307411_10082409 3300032005 Bacteria 2218
376 Ga0307415_100033941 3300032126 Unclassified 3317
377 Ga0307510_10000013 3300033180 Bacteria 274569
378 Ga0373936_0017786 3300035113 Bacteria 2739
379 Ga0373953_0136743 3300035117 Bacteria 1047
380 Ga0373955_0035877 3300035172 Bacteria 2629
381 Ga0373955_0058555 3300035172 Bacteria 2120
382 Ga0373935_0324629 3300035692 Bacteria 1093
383 Ga0373933_0060350 3300035724 Bacteria 2286
384 Ga0373933_0603161 3300035724 Bacteria 721
385 Ga0373937_0005526 3300036401 Bacteria 10838
386 Ga0373937_0043643 3300036401 Bacteria 4094
387 Ga0373925_0054851 3300037068 Bacteria 2982
388 Ga0373925_0224708 3300037068 Bacteria 1500
389 Ga0395900_0813295 3300037418 Unclassified 862
390 Ga0395898_0013420 3300037466 Bacteria 8439
391 Ga0395905_1059260 3300037471 Unclassified 714
392 Ga0436365_0041046 3300039437 Bacteria 2443
393 Ga0436365_0654174 3300039437 Bacteria 8534
394 Ga0436365_1776384 3300039437 Bacteria 4806
395 Ga0436360_0095064 3300039438 Bacteria 1122
396 Ga0436361_0643956 3300039447 Bacteria 1719
397 Ga0436363_0398788 3300039450 Bacteria 9929
398 Ga0436363_0640180 3300039450 Bacteria 9406
399 Ga0436363_0744495 3300039450 Bacteria 894
400 Ga0436363_1588902 3300039450 Bacteria 2178
401 Ga0436362_0756794 3300039453 Bacteria 1410
402 Ga0451577_0026927 3300042876 Bacteria 5205
403 Ga0451577_0028852 3300042876 Bacteria 5018
404 Ga0466969_0002181 3300044656 Bacteria 10461
405 Ga0466969_0004908 3300044656 Bacteria 7125
406 Ga0453683_0074790 3300044673 Bacteria 2121
407 Ga0453683_0129756 3300044673 Bacteria 1588
408 Ga0466966_0015501 3300044684 Bacteria 5038
409 Ga0466961_0000883 3300044693 Bacteria 18652
410 Ga0466961_0042763 3300044693 Bacteria 2904
411 Ga0466964_0001017 3300044706 Bacteria 9319
412 Ga0453684_0142663 3300044712 Bacteria 2857
413 Ga0466971_0015284 3300044719 Bacteria 3377
414 Ga0466970_0001756 3300044765 Bacteria 10459
415 Ga0466957_0000555 3300044842 Bacteria 18825
416 Ga0466959_0000561 3300045049 Bacteria 21601
417 Ga0466959_0012373 3300045049 Bacteria 6164
418 Ga0466959_0052795 3300045049 Bacteria 2975
419 Ga0466959_0074097 3300045049 Bacteria 2462
420 Ga0466958_0129169 3300045836 Bacteria 1586
421 Ga0495580_0013461 3300046472 Bacteria 6239
422 Ga0495580_0028584 3300046472 Bacteria 4052
423 Ga0495582_0354006 3300046473 Bacteria 846
424 Ga0495605_0004939 3300046474 Bacteria 7791
425 Ga0495596_0006299 3300046500 Bacteria 5485
426 Ga0495607_0014138 3300046501 Bacteria 5208
427 Ga0495583_0008086 3300046506 Bacteria 6484
428 Ga0495610_0003749 3300046512 Bacteria 11632
429 Ga0495616_0010536 3300046513 Bacteria 5347
430 Ga0495618_0033195 3300046514 Bacteria 3236
431 Ga0495630_0086457 3300046517 Bacteria 2368
432 Ga0495630_0225345 3300046517 Bacteria 1431
433 Ga0495643_0035857 3300046522 Bacteria 2729
434 Ga0495652_0546507 3300046529 Bacteria 797
435 Ga0495668_0004686 3300046616 Bacteria 9599
436 Ga0495611_0181309 3300046648 Unclassified 984
437 Ga0495661_0024022 3300046665 Bacteria 3949
438 Ga0495623_0359631 3300046679 Bacteria 791
439 Ga0495669_0033086 3300046684 Bacteria 2275
440 Ga0495671_0002656 3300046692 Bacteria 11224
441 Ga0495671_0094010 3300046692 Bacteria 1467
442 Ga0495649_0020169 3300046694 Bacteria 3740
443 Ga0495649_0077675 3300046694 Bacteria 1777
444 Ga0495649_0371357 3300046694 Bacteria 721
445 Ga0495604_0026945 3300047317 Bacteria 4572
446 Ga0495674_0650761 3300047319 Bacteria 831
447 Ga0495672_0026130 3300047320 Bacteria 3728
448 Ga0495687_140187 3300047443 Unclassified 842
449 Ga0495602_0011818 3300048088 Bacteria 9016
450 Ga0496100_0052554 3300048903 Bacteria 2649
451 Ga0496100_0149501 3300048903 Bacteria 1664
452 Ga0496102_0012705 3300048905 Bacteria 7294
453 Ga0496102_0095871 3300048905 Bacteria 2750
454 Ga0496102_0162387 3300048905 Bacteria 2102
455 Ga0496102_0262188 3300048905 Unclassified 1629
456 Ga0496103_0048989 3300048906 Bacteria 2612
457 Ga0496104_0038244 3300048907 Bacteria 4489
458 Ga0496104_0047261 3300048907 Bacteria 4056
459 Ga0496105_0016416 3300048908 Bacteria 5912
460 Ga0496105_0025716 3300048908 Bacteria 4794
461 Ga0496106_0005765 3300048909 Bacteria 9158
462 Ga0496106_0154031 3300048909 Bacteria 1814
463 Ga0496106_0516825 3300048909 Bacteria 959
464 Ga0496107_0016395 3300048910 Bacteria 5201
465 Ga0496108_0031433 3300048911 Bacteria 4405
466 Ga0496109_0043447 3300048912 Bacteria 4073
467 Ga0496109_0267254 3300048912 Unclassified 1611
468 Ga0496110_0119998 3300048913 Bacteria 2368
469 Ga0496111_0138066 3300048914 Bacteria 1806
470 Ga0496112_0048810 3300048915 Bacteria 4148
471 Ga0496112_0574636 3300048915 Unclassified 1060
472 Ga0496114_0067118 3300048917 Bacteria 3008
473 Ga0496115_0019186 3300048918 Bacteria 5260
474 Ga0496115_0216419 3300048918 Bacteria 1581
475 Ga0496116_0008195 3300048919 Bacteria 9113
476 Ga0496116_0098775 3300048919 Unclassified 1751
477 Ga0496117_0001448 3300048920 Bacteria 34207
478 Ga0496118_0000028 3300048921 Bacteria 366490
479 Ga0496119_0006996 3300048922 Bacteria 10276
480 Ga0496119_0014332 3300048922 Bacteria 6215
481 Ga0496119_0043873 3300048922 Bacteria 2821
482 Ga0496120_0000930 3300048923 Bacteria 40517
483 Ga0496120_0009373 3300048923 Bacteria 6956
484 Ga0496120_0022795 3300048923 Bacteria 3934
485 Ga0496121_0000808 3300048924 Bacteria 57011
486 Ga0496121_0057967 3300048924 Bacteria 3206
487 Ga0496121_0086434 3300048924 Bacteria 2464
488 Ga0496122_0005665 3300048925 Bacteria 14746
489 Ga0496123_0006518 3300048926 Bacteria 11284
490 Ga0496124_0181785 3300048927 Unclassified 1617
491 Ga0496125_0000936 3300048928 Bacteria 45858
492 Ga0496125_0003776 3300048928 Bacteria 18018
493 Ga0496125_0004532 3300048928 Bacteria 15960
494 Ga0496125_0108056 3300048928 Bacteria 2025
495 Ga0496126_0005881 3300048929 Bacteria 13833
496 Ga0496126_0025325 3300048929 Bacteria 5710
497 Ga0496126_0216523 3300048929 Bacteria 1611
498 Ga0496126_0234813 3300048929 Bacteria 1535
499 Ga0496126_0350528 3300048929 Bacteria 1207
500 Ga0501072_0250521 3300049588 Unclassified 1410
501 nmdc:mga0n895_335419_c1 3300050512 Bacteria 1532
502 nmdc:mga08x19_150260_c1 3300050514 Bacteria 1577
503 Ga0495612_0144924 3300053078 Bacteria 1032
504 Ga0500556_0000540 3300053104 Bacteria 25527
505 Ga0500558_151348 3300053106 Bacteria 861
506 Ga0500618_001110 3300053125 Bacteria 13191
507 Ga0500559_0051111 3300053136 Bacteria 1825
508 Ga0500559_0272247 3300053136 Bacteria 797
509 Ga0500624_039535 3300053157 Bacteria 843
510 Ga0500639_090697 3300053163 Bacteria 1523
511 Ga0500637_0013264 3300053178 Bacteria 4317
512 Ga0500637_0056244 3300053178 Bacteria 2248
513 Ga0500637_0160481 3300053178 Bacteria 1296
514 Ga0500637_0270166 3300053178 Unclassified 940

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100033604 Ga0070670_1000336042 208
2 3300005354 Ga0070675_100289231 Ga0070675_1002892311 208
3 3300005466 Ga0070685_10078657 Ga0070685_100786572 208
4 3300005618 Ga0068864_100079163 Ga0068864_1000791632 208
5 3300005719 Ga0068861_100430065 Ga0068861_1004300651 208
6 3300005841 Ga0068863_100086151 Ga0068863_1000861513 208
7 3300014325 Ga0163163_10249199 Ga0163163_102491992 208
8 3300035724 Ga0373933_0603161 Ga0373933_0603161_20_646 208
9 3300026095 Ga0207676_10037279 Ga0207676_100372793 209
10 3300009093 Ga0105240_10060987 Ga0105240_100609874 213
11 3300048915 Ga0496112_0574636 Ga0496112_0574636_310_1047 213
12 3300046694 Ga0495649_0371357 Ga0495649_0371357_10_660 214
13 3300009011 Ga0105251_10007536 Ga0105251_100075363 220
14 3300025916 Ga0207663_10036946 Ga0207663_100369462 220
15 3300044693 Ga0466961_0042763 Ga0466961_0042763_2152_2853 220
16 3300045049 Ga0466959_0012373 Ga0466959_0012373_3333_4034 220
17 3300048929 Ga0496126_0216523 Ga0496126_0216523_747_1409 220
18 3300005327 Ga0070658_10000547 Ga0070658_1000054718 221
19 3300005331 Ga0070670_100308222 Ga0070670_1003082222 221
20 3300005339 Ga0070660_100232638 Ga0070660_1002326382 221
21 3300005344 Ga0070661_100021618 Ga0070661_1000216183 221
22 3300005457 Ga0070662_100116405 Ga0070662_1001164052 221
23 3300005458 Ga0070681_10120157 Ga0070681_101201572 221
24 3300005458 Ga0070681_10410151 Ga0070681_104101512 221
25 3300005539 Ga0068853_100002295 Ga0068853_1000022953 221
26 3300005539 Ga0068853_100077837 Ga0068853_1000778372 221
27 3300005564 Ga0070664_100002024 Ga0070664_1000020245 221
28 3300005564 Ga0070664_100013450 Ga0070664_1000134506 221
29 3300005577 Ga0068857_100034436 Ga0068857_1000344366 221
30 3300005577 Ga0068857_100321171 Ga0068857_1003211712 221
31 3300013104 Ga0157370_10169615 Ga0157370_101696153 221
32 3300013105 Ga0157369_10402517 Ga0157369_104025171 221
33 3300013296 Ga0157374_10143663 Ga0157374_101436632 221
34 3300013306 Ga0163162_10229947 Ga0163162_102299472 221
35 3300014745 Ga0157377_10210600 Ga0157377_102106002 221
36 3300025909 Ga0207705_10003787 Ga0207705_100037873 221
37 3300025931 Ga0207644_10480932 Ga0207644_104809322 221
38 3300025932 Ga0207690_10081363 Ga0207690_100813632 221
39 3300025933 Ga0207706_10231017 Ga0207706_102310171 221
40 3300025944 Ga0207661_10203090 Ga0207661_102030902 221
41 3300025945 Ga0207679_10015619 Ga0207679_100156192 221
42 3300025945 Ga0207679_10151861 Ga0207679_101518613 221
43 3300026041 Ga0207639_10120224 Ga0207639_101202242 221
44 3300026116 Ga0207674_10017178 Ga0207674_100171784 221
45 3300026116 Ga0207674_10288644 Ga0207674_102886442 221
46 3300031901 Ga0307406_10355896 Ga0307406_103558962 221
47 3300037471 Ga0395905_1059260 Ga0395905_1059260_22_687 221
48 3300031247 Ga0265340_10018843 Ga0265340_100188434 222
49 3300031852 Ga0307410_10033002 Ga0307410_100330022 222
50 3300032005 Ga0307411_10006059 Ga0307411_100060597 222
51 3300032126 Ga0307415_100033941 Ga0307415_1000339412 222
52 3300035117 Ga0373953_0136743 Ga0373953_0136743_289_981 222
53 3300005336 Ga0070680_100016607 Ga0070680_1000166072 223
54 3300005458 Ga0070681_10119294 Ga0070681_101192944 223
55 3300025912 Ga0207707_10101983 Ga0207707_101019834 223
56 3300025917 Ga0207660_10095700 Ga0207660_100957002 223
57 3300025944 Ga0207661_10103487 Ga0207661_101034872 223
58 3300048905 Ga0496102_0095871 Ga0496102_0095871_1935_2627 225
59 3300044712 Ga0453684_0142663 Ga0453684_0142663_1506_2189 227
60 3300005336 Ga0070680_100005294 Ga0070680_1000052947 229
61 3300005337 Ga0070682_100100571 Ga0070682_1001005712 229
62 3300005458 Ga0070681_10017608 Ga0070681_100176083 229
63 3300005458 Ga0070681_10154498 Ga0070681_101544982 229
64 3300005530 Ga0070679_100004670 Ga0070679_10000467010 229
65 3300005530 Ga0070679_100011264 Ga0070679_1000112643 229
66 3300005539 Ga0068853_100197453 Ga0068853_1001974532 229
67 3300005563 Ga0068855_100004608 Ga0068855_1000046088 229
68 3300009545 Ga0105237_10237202 Ga0105237_102372022 229
69 3300009551 Ga0105238_10001369 Ga0105238_1000136926 229
70 3300009551 Ga0105238_10074591 Ga0105238_100745913 229
71 3300010375 Ga0105239_11093170 Ga0105239_110931702 229
72 3300013104 Ga0157370_10001792 Ga0157370_100017926 229
73 3300013105 Ga0157369_10008374 Ga0157369_100083741 229
74 3300013105 Ga0157369_10248168 Ga0157369_102481682 229
75 3300025912 Ga0207707_10000411 Ga0207707_100004118 229
76 3300025912 Ga0207707_10009225 Ga0207707_100092259 229
77 3300025912 Ga0207707_10508912 Ga0207707_105089121 229
78 3300025913 Ga0207695_10007491 Ga0207695_100074918 229
79 3300025914 Ga0207671_10311797 Ga0207671_103117972 229
80 3300025917 Ga0207660_10005790 Ga0207660_100057905 229
81 3300025921 Ga0207652_10005406 Ga0207652_100054066 229
82 3300025921 Ga0207652_10034482 Ga0207652_100344823 229
83 3300025921 Ga0207652_10040082 Ga0207652_100400824 229
84 3300025924 Ga0207694_10019306 Ga0207694_100193062 229
85 3300025924 Ga0207694_10511297 Ga0207694_105112971 229
86 3300025949 Ga0207667_10012498 Ga0207667_100124985 229
87 3300031247 Ga0265340_10001829 Ga0265340_1000182911 229
88 3300031249 Ga0265339_10118631 Ga0265339_101186312 229
89 3300003323 rootH1_10318854 rootH1_103188542 230
90 3300005295 Ga0065707_10083043 Ga0065707_100830436 230
91 3300005330 Ga0070690_100039753 Ga0070690_1000397533 230
92 3300005335 Ga0070666_10010472 Ga0070666_100104724 230
93 3300005335 Ga0070666_10028306 Ga0070666_100283063 230
94 3300005338 Ga0068868_100003004 Ga0068868_1000030042 230
95 3300005355 Ga0070671_100000199 Ga0070671_10000019917 230
96 3300005355 Ga0070671_100010893 Ga0070671_1000108933 230
97 3300005355 Ga0070671_100533157 Ga0070671_1005331571 230
98 3300005364 Ga0070673_100161018 Ga0070673_1001610182 230
99 3300005367 Ga0070667_100000069 Ga0070667_10000006985 230
100 3300005367 Ga0070667_100004680 Ga0070667_10000468010 230
101 3300005367 Ga0070667_100012032 Ga0070667_1000120322 230
102 3300005367 Ga0070667_100313066 Ga0070667_1003130661 230
103 3300005434 Ga0070709_10000986 Ga0070709_1000098610 230
104 3300005434 Ga0070709_10101605 Ga0070709_101016051 230
105 3300005434 Ga0070709_10189511 Ga0070709_101895113 230
106 3300005435 Ga0070714_100005208 Ga0070714_1000052083 230
107 3300005435 Ga0070714_100216354 Ga0070714_1002163542 230
108 3300005435 Ga0070714_100235041 Ga0070714_1002350412 230
109 3300005436 Ga0070713_100002662 Ga0070713_1000026627 230
110 3300005436 Ga0070713_100029679 Ga0070713_1000296792 230
111 3300005436 Ga0070713_100481725 Ga0070713_1004817252 230
112 3300005437 Ga0070710_10012975 Ga0070710_100129754 230
113 3300005437 Ga0070710_10451029 Ga0070710_104510291 230
114 3300005439 Ga0070711_100000649 Ga0070711_10000064911 230
115 3300005439 Ga0070711_100124324 Ga0070711_1001243242 230
116 3300005440 Ga0070705_100403395 Ga0070705_1004033951 230
117 3300005456 Ga0070678_100051360 Ga0070678_1000513603 230
118 3300005458 Ga0070681_10016827 Ga0070681_100168272 230
119 3300005458 Ga0070681_10066376 Ga0070681_100663761 230
120 3300005530 Ga0070679_100181141 Ga0070679_1001811413 230
121 3300005530 Ga0070679_100295438 Ga0070679_1002954382 230
122 3300005539 Ga0068853_100359937 Ga0068853_1003599372 230
123 3300005544 Ga0070686_100109309 Ga0070686_1001093092 230
124 3300005545 Ga0070695_100030241 Ga0070695_1000302412 230
125 3300005547 Ga0070693_100599201 Ga0070693_1005992011 230
126 3300005548 Ga0070665_100012162 Ga0070665_1000121625 230
127 3300005548 Ga0070665_100138108 Ga0070665_1001381082 230
128 3300005548 Ga0070665_100238596 Ga0070665_1002385962 230
129 3300005548 Ga0070665_100596548 Ga0070665_1005965482 230
130 3300005563 Ga0068855_100000592 Ga0068855_10000059210 230
131 3300005563 Ga0068855_100301393 Ga0068855_1003013933 230
132 3300005578 Ga0068854_100105587 Ga0068854_1001055872 230
133 3300005614 Ga0068856_100046028 Ga0068856_1000460282 230
134 3300005616 Ga0068852_100341005 Ga0068852_1003410052 230
135 3300005617 Ga0068859_100002486 Ga0068859_10000248610 230
136 3300005617 Ga0068859_100063169 Ga0068859_1000631692 230
137 3300005617 Ga0068859_100072520 Ga0068859_1000725205 230
138 3300005718 Ga0068866_10007506 Ga0068866_100075064 230
139 3300005834 Ga0068851_10360481 Ga0068851_103604811 230
140 3300005841 Ga0068863_100016434 Ga0068863_1000164342 230
141 3300005841 Ga0068863_100081510 Ga0068863_1000815102 230
142 3300005841 Ga0068863_100865186 Ga0068863_1008651861 230
143 3300005842 Ga0068858_100000285 Ga0068858_1000002856 230
144 3300005842 Ga0068858_100005143 Ga0068858_10000514312 230
145 3300005842 Ga0068858_100012491 Ga0068858_1000124913 230
146 3300005843 Ga0068860_100001390 Ga0068860_10000139016 230
147 3300005843 Ga0068860_100005786 Ga0068860_1000057864 230
148 3300005843 Ga0068860_100012863 Ga0068860_1000128636 230
149 3300005844 Ga0068862_100033959 Ga0068862_1000339593 230
150 3300005844 Ga0068862_100152003 Ga0068862_1001520032 230
151 3300005844 Ga0068862_100788189 Ga0068862_1007881892 230
152 3300006163 Ga0070715_10000239 Ga0070715_100002396 230
153 3300006173 Ga0070716_100014146 Ga0070716_1000141463 230
154 3300006173 Ga0070716_100015412 Ga0070716_1000154123 230
155 3300006173 Ga0070716_100129708 Ga0070716_1001297082 230
156 3300006175 Ga0070712_100000751 Ga0070712_1000007513 230
157 3300006175 Ga0070712_100054077 Ga0070712_1000540773 230
158 3300006871 Ga0075434_100207272 Ga0075434_1002072722 230
159 3300006881 Ga0068865_100033036 Ga0068865_1000330363 230
160 3300006931 Ga0097620_100002486 Ga0097620_10000248610 230
161 3300006931 Ga0097620_100063167 Ga0097620_1000631672 230
162 3300006931 Ga0097620_100072519 Ga0097620_1000725193 230
163 3300009092 Ga0105250_10154128 Ga0105250_101541281 230
164 3300009093 Ga0105240_10024226 Ga0105240_100242266 230
165 3300009093 Ga0105240_10044583 Ga0105240_100445835 230
166 3300009093 Ga0105240_10049421 Ga0105240_100494213 230
167 3300009093 Ga0105240_10085366 Ga0105240_100853664 230
168 3300009093 Ga0105240_10286210 Ga0105240_102862102 230
169 3300009093 Ga0105240_11000919 Ga0105240_110009192 230
170 3300009098 Ga0105245_10017497 Ga0105245_100174972 230
171 3300009101 Ga0105247_10000072 Ga0105247_1000007221 230
172 3300009101 Ga0105247_10010957 Ga0105247_100109576 230
173 3300009101 Ga0105247_10072899 Ga0105247_100728992 230
174 3300009101 Ga0105247_10167367 Ga0105247_101673672 230
175 3300009174 Ga0105241_10004905 Ga0105241_100049055 230
176 3300009176 Ga0105242_10001357 Ga0105242_1000135717 230
177 3300009177 Ga0105248_10024681 Ga0105248_100246813 230
178 3300009177 Ga0105248_10156395 Ga0105248_101563953 230
179 3300009545 Ga0105237_10041800 Ga0105237_100418004 230
180 3300009545 Ga0105237_10160215 Ga0105237_101602153 230
181 3300009545 Ga0105237_10165993 Ga0105237_101659932 230
182 3300009545 Ga0105237_10214698 Ga0105237_102146982 230
183 3300009551 Ga0105238_10121155 Ga0105238_101211552 230
184 3300009551 Ga0105238_10556983 Ga0105238_105569832 230
185 3300009553 Ga0105249_10123348 Ga0105249_101233482 230
186 3300009553 Ga0105249_10127726 Ga0105249_101277263 230
187 3300009553 Ga0105249_10355709 Ga0105249_103557092 230
188 3300009553 Ga0105249_10598732 Ga0105249_105987322 230
189 3300010159 Ga0099796_10008949 Ga0099796_100089492 230
190 3300010375 Ga0105239_10108339 Ga0105239_101083392 230
191 3300010375 Ga0105239_10119087 Ga0105239_101190872 230
192 3300010375 Ga0105239_10213673 Ga0105239_102136732 230
193 3300011119 Ga0105246_10124287 Ga0105246_101242872 230
194 3300013105 Ga0157369_10020588 Ga0157369_100205884 230
195 3300013105 Ga0157369_10911709 Ga0157369_109117092 230
196 3300013296 Ga0157374_10024555 Ga0157374_100245556 230
197 3300013297 Ga0157378_10014547 Ga0157378_100145474 230
198 3300013306 Ga0163162_10080654 Ga0163162_100806543 230
199 3300013306 Ga0163162_10151550 Ga0163162_101515502 230
200 3300013308 Ga0157375_10096475 Ga0157375_100964753 230
201 3300014325 Ga0163163_10043200 Ga0163163_100432002 230
202 3300014325 Ga0163163_10080037 Ga0163163_100800372 230
203 3300014325 Ga0163163_10251471 Ga0163163_102514712 230
204 3300014325 Ga0163163_10872868 Ga0163163_108728682 230
205 3300014968 Ga0157379_10002427 Ga0157379_100024273 230
206 3300014968 Ga0157379_10157471 Ga0157379_101574712 230
207 3300014968 Ga0157379_10283657 Ga0157379_102836572 230
208 3300014969 Ga0157376_10534142 Ga0157376_105341422 230
209 3300021358 Ga0213873_10027418 Ga0213873_100274182 230
210 3300021377 Ga0213874_10007878 Ga0213874_100078783 230
211 3300021384 Ga0213876_10093751 Ga0213876_100937512 230
212 3300021384 Ga0213876_10110787 Ga0213876_101107872 230
213 3300025321 Ga0207656_10062917 Ga0207656_100629172 230
214 3300025898 Ga0207692_10061923 Ga0207692_100619232 230
215 3300025899 Ga0207642_10005524 Ga0207642_100055242 230
216 3300025900 Ga0207710_10000238 Ga0207710_1000023827 230
217 3300025900 Ga0207710_10011690 Ga0207710_100116906 230
218 3300025903 Ga0207680_10015552 Ga0207680_100155523 230
219 3300025903 Ga0207680_10018594 Ga0207680_100185943 230
220 3300025903 Ga0207680_10060528 Ga0207680_100605282 230
221 3300025906 Ga0207699_10002835 Ga0207699_100028353 230
222 3300025906 Ga0207699_10052276 Ga0207699_100522762 230
223 3300025911 Ga0207654_10323801 Ga0207654_103238012 230
224 3300025912 Ga0207707_10037473 Ga0207707_100374735 230
225 3300025913 Ga0207695_10043261 Ga0207695_100432612 230
226 3300025913 Ga0207695_10044022 Ga0207695_100440222 230
227 3300025913 Ga0207695_10047312 Ga0207695_100473125 230
228 3300025913 Ga0207695_10091540 Ga0207695_100915403 230
229 3300025913 Ga0207695_10238573 Ga0207695_102385732 230
230 3300025913 Ga0207695_10395213 Ga0207695_103952131 230
231 3300025913 Ga0207695_10524458 Ga0207695_105244582 230
232 3300025914 Ga0207671_10073699 Ga0207671_100736992 230
233 3300025915 Ga0207693_10000161 Ga0207693_1000016127 230
234 3300025915 Ga0207693_10038794 Ga0207693_100387942 230
235 3300025916 Ga0207663_10015294 Ga0207663_100152943 230
236 3300025916 Ga0207663_10173553 Ga0207663_101735532 230
237 3300025921 Ga0207652_10151656 Ga0207652_101516563 230
238 3300025924 Ga0207694_10016981 Ga0207694_100169812 230
239 3300025924 Ga0207694_10081266 Ga0207694_100812662 230
240 3300025924 Ga0207694_10209384 Ga0207694_102093842 230
241 3300025924 Ga0207694_10502874 Ga0207694_105028742 230
242 3300025927 Ga0207687_10056552 Ga0207687_100565522 230
243 3300025928 Ga0207700_10010500 Ga0207700_100105001 230
244 3300025928 Ga0207700_10011997 Ga0207700_100119973 230
245 3300025928 Ga0207700_10184670 Ga0207700_101846702 230
246 3300025929 Ga0207664_10185910 Ga0207664_101859102 230
247 3300025931 Ga0207644_10004142 Ga0207644_100041423 230
248 3300025931 Ga0207644_10302045 Ga0207644_103020452 230
249 3300025934 Ga0207686_10012371 Ga0207686_100123712 230
250 3300025938 Ga0207704_10117860 Ga0207704_101178602 230
251 3300025939 Ga0207665_10013204 Ga0207665_100132044 230
252 3300025939 Ga0207665_10015339 Ga0207665_100153395 230
253 3300025941 Ga0207711_10058578 Ga0207711_100585782 230
254 3300025941 Ga0207711_10071438 Ga0207711_100714382 230
255 3300025949 Ga0207667_10045762 Ga0207667_100457624 230
256 3300025949 Ga0207667_10184786 Ga0207667_101847863 230
257 3300025949 Ga0207667_10604637 Ga0207667_106046372 230
258 3300025960 Ga0207651_10333301 Ga0207651_103333012 230
259 3300025961 Ga0207712_10110678 Ga0207712_101106782 230
260 3300025986 Ga0207658_10000038 Ga0207658_10000038103 230
261 3300025986 Ga0207658_10073432 Ga0207658_100734322 230
262 3300025986 Ga0207658_10130178 Ga0207658_101301781 230
263 3300026023 Ga0207677_10139594 Ga0207677_101395942 230
264 3300026035 Ga0207703_10000605 Ga0207703_1000060527 230
265 3300026035 Ga0207703_10000754 Ga0207703_100007545 230
266 3300026041 Ga0207639_10264184 Ga0207639_102641842 230
267 3300026041 Ga0207639_10460345 Ga0207639_104603452 230
268 3300026067 Ga0207678_10627293 Ga0207678_106272932 230
269 3300026078 Ga0207702_10094289 Ga0207702_100942893 230
270 3300026078 Ga0207702_10187066 Ga0207702_101870662 230
271 3300026088 Ga0207641_10000083 Ga0207641_1000008372 230
272 3300026088 Ga0207641_10007436 Ga0207641_100074363 230
273 3300026088 Ga0207641_10113790 Ga0207641_101137903 230
274 3300026118 Ga0207675_100211102 Ga0207675_1002111022 230
275 3300026121 Ga0207683_10002925 Ga0207683_100029258 230
276 3300028379 Ga0268266_10108106 Ga0268266_101081062 230
277 3300028379 Ga0268266_10172365 Ga0268266_101723653 230
278 3300028380 Ga0268265_10036855 Ga0268265_100368553 230
279 3300028381 Ga0268264_10000122 Ga0268264_10000122170 230
280 3300028381 Ga0268264_10073145 Ga0268264_100731453 230
281 3300030521 Ga0307511_10000519 Ga0307511_1000051921 230
282 3300030521 Ga0307511_10031086 Ga0307511_100310862 230
283 3300031507 Ga0307509_10000001 Ga0307509_10000001111 230
284 3300033180 Ga0307510_10000013 Ga0307510_1000001358 230
285 3300035113 Ga0373936_0017786 Ga0373936_0017786_39_731 230
286 3300035172 Ga0373955_0035877 Ga0373955_0035877_1113_1805 230
287 3300035172 Ga0373955_0058555 Ga0373955_0058555_615_1307 230
288 3300035692 Ga0373935_0324629 Ga0373935_0324629_221_913 230
289 3300035724 Ga0373933_0060350 Ga0373933_0060350_493_1185 230
290 3300036401 Ga0373937_0005526 Ga0373937_0005526_1806_2498 230
291 3300036401 Ga0373937_0043643 Ga0373937_0043643_2408_3100 230
292 3300037068 Ga0373925_0054851 Ga0373925_0054851_198_890 230
293 3300037466 Ga0395898_0013420 Ga0395898_0013420_2000_2749 230
294 3300039437 Ga0436365_0041046 Ga0436365_0041046_425_1138 230
295 3300039437 Ga0436365_0654174 Ga0436365_0654174_7027_7719 230
296 3300039437 Ga0436365_1776384 Ga0436365_1776384_3974_4684 230
297 3300039438 Ga0436360_0095064 Ga0436360_0095064_313_1044 230
298 3300039447 Ga0436361_0643956 Ga0436361_0643956_129_860 230
299 3300039450 Ga0436363_0398788 Ga0436363_0398788_1800_2513 230
300 3300039450 Ga0436363_0640180 Ga0436363_0640180_3105_3836 230
301 3300039450 Ga0436363_1588902 Ga0436363_1588902_693_1385 230
302 3300039453 Ga0436362_0756794 Ga0436362_0756794_631_1341 230
303 3300042876 Ga0451577_0026927 Ga0451577_0026927_2684_3409 230
304 3300044656 Ga0466969_0002181 Ga0466969_0002181_6268_6960 230
305 3300044656 Ga0466969_0004908 Ga0466969_0004908_5302_5994 230
306 3300044684 Ga0466966_0015501 Ga0466966_0015501_2520_3212 230
307 3300044693 Ga0466961_0000883 Ga0466961_0000883_2891_3583 230
308 3300044706 Ga0466964_0001017 Ga0466964_0001017_6691_7383 230
309 3300044719 Ga0466971_0015284 Ga0466971_0015284_90_782 230
310 3300044765 Ga0466970_0001756 Ga0466970_0001756_5303_5995 230
311 3300044842 Ga0466957_0000555 Ga0466957_0000555_11608_12300 230
312 3300045049 Ga0466959_0000561 Ga0466959_0000561_5430_6122 230
313 3300045049 Ga0466959_0052795 Ga0466959_0052795_1382_2074 230
314 3300045049 Ga0466959_0074097 Ga0466959_0074097_1598_2332 230
315 3300045836 Ga0466958_0129169 Ga0466958_0129169_664_1356 230
316 3300046472 Ga0495580_0013461 Ga0495580_0013461_2809_3525 230
317 3300046472 Ga0495580_0028584 Ga0495580_0028584_2207_2899 230
318 3300046506 Ga0495583_0008086 Ga0495583_0008086_4733_5428 230
319 3300046514 Ga0495618_0033195 Ga0495618_0033195_2498_3190 230
320 3300046517 Ga0495630_0225345 Ga0495630_0225345_621_1313 230
321 3300046648 Ga0495611_0181309 Ga0495611_0181309_74_766 230
322 3300046679 Ga0495623_0359631 Ga0495623_0359631_40_732 230
323 3300046692 Ga0495671_0094010 Ga0495671_0094010_249_944 230
324 3300046694 Ga0495649_0077675 Ga0495649_0077675_16_708 230
325 3300047443 Ga0495687_140187 Ga0495687_140187_40_732 230
326 3300048088 Ga0495602_0011818 Ga0495602_0011818_44_736 230
327 3300048903 Ga0496100_0052554 Ga0496100_0052554_1417_2109 230
328 3300048903 Ga0496100_0149501 Ga0496100_0149501_782_1474 230
329 3300048905 Ga0496102_0012705 Ga0496102_0012705_5945_6637 230
330 3300048905 Ga0496102_0162387 Ga0496102_0162387_989_1720 230
331 3300048905 Ga0496102_0262188 Ga0496102_0262188_178_870 230
332 3300048906 Ga0496103_0048989 Ga0496103_0048989_412_1104 230
333 3300048907 Ga0496104_0047261 Ga0496104_0047261_2098_2790 230
334 3300048908 Ga0496105_0025716 Ga0496105_0025716_3572_4264 230
335 3300048909 Ga0496106_0005765 Ga0496106_0005765_2579_3271 230
336 3300048909 Ga0496106_0154031 Ga0496106_0154031_800_1531 230
337 3300048909 Ga0496106_0516825 Ga0496106_0516825_193_924 230
338 3300048910 Ga0496107_0016395 Ga0496107_0016395_2186_2878 230
339 3300048911 Ga0496108_0031433 Ga0496108_0031433_1702_2394 230
340 3300048912 Ga0496109_0043447 Ga0496109_0043447_1540_2232 230
341 3300048912 Ga0496109_0267254 Ga0496109_0267254_698_1390 230
342 3300048913 Ga0496110_0119998 Ga0496110_0119998_1145_1837 230
343 3300048914 Ga0496111_0138066 Ga0496111_0138066_570_1262 230
344 3300048915 Ga0496112_0048810 Ga0496112_0048810_1712_2404 230
345 3300048917 Ga0496114_0067118 Ga0496114_0067118_878_1570 230
346 3300048918 Ga0496115_0216419 Ga0496115_0216419_568_1260 230
347 3300048919 Ga0496116_0098775 Ga0496116_0098775_705_1397 230
348 3300048920 Ga0496117_0001448 Ga0496117_0001448_22033_22725 230
349 3300048921 Ga0496118_0000028 Ga0496118_0000028_233567_234259 230
350 3300048922 Ga0496119_0006996 Ga0496119_0006996_6147_6839 230
351 3300048922 Ga0496119_0014332 Ga0496119_0014332_3470_4162 230
352 3300048922 Ga0496119_0043873 Ga0496119_0043873_1131_1829 230
353 3300048923 Ga0496120_0000930 Ga0496120_0000930_23154_23846 230
354 3300048923 Ga0496120_0009373 Ga0496120_0009373_1813_2505 230
355 3300048923 Ga0496120_0022795 Ga0496120_0022795_2504_3196 230
356 3300048924 Ga0496121_0000808 Ga0496121_0000808_49306_49998 230
357 3300048924 Ga0496121_0086434 Ga0496121_0086434_1293_1985 230
358 3300048927 Ga0496124_0181785 Ga0496124_0181785_897_1589 230
359 3300048928 Ga0496125_0000936 Ga0496125_0000936_23022_23714 230
360 3300048928 Ga0496125_0003776 Ga0496125_0003776_3207_3899 230
361 3300048928 Ga0496125_0004532 Ga0496125_0004532_11398_12090 230
362 3300048928 Ga0496125_0108056 Ga0496125_0108056_748_1440 230
363 3300048929 Ga0496126_0005881 Ga0496126_0005881_8810_9502 230
364 3300048929 Ga0496126_0025325 Ga0496126_0025325_1770_2462 230
365 3300048929 Ga0496126_0234813 Ga0496126_0234813_696_1397 230
366 3300048929 Ga0496126_0350528 Ga0496126_0350528_443_1135 230
367 3300050512 nmdc:mga0n895_335419_c1 nmdc:mga0n895_335419_c1_254_985 230
368 3300050514 nmdc:mga08x19_150260_c1 nmdc:mga08x19_150260_c1_325_1056 230
369 3300053078 Ga0495612_0144924 Ga0495612_0144924_262_954 230
370 3300053104 Ga0500556_0000540 Ga0500556_0000540_1872_2567 230
371 3300053106 Ga0500558_151348 Ga0500558_151348_90_800 230
372 3300053136 Ga0500559_0051111 Ga0500559_0051111_1092_1784 230
373 3300053136 Ga0500559_0272247 Ga0500559_0272247_69_761 230
374 3300053157 Ga0500624_039535 Ga0500624_039535_75_767 230
375 3300053163 Ga0500639_090697 Ga0500639_090697_340_1032 230
376 3300053178 Ga0500637_0056244 Ga0500637_0056244_202_903 230
377 3300053178 Ga0500637_0160481 Ga0500637_0160481_532_1224 230
378 3300053178 Ga0500637_0270166 Ga0500637_0270166_92_784 230
379 3300005336 Ga0070680_100056162 Ga0070680_1000561622 231
380 3300005458 Ga0070681_10002712 Ga0070681_100027128 231
381 3300005530 Ga0070679_100042103 Ga0070679_1000421032 231
382 3300005548 Ga0070665_100002460 Ga0070665_1000024606 231
383 3300009093 Ga0105240_10096276 Ga0105240_100962762 231
384 3300009174 Ga0105241_10162684 Ga0105241_101626841 231
385 3300009174 Ga0105241_10758046 Ga0105241_107580462 231
386 3300009545 Ga0105237_10055385 Ga0105237_100553852 231
387 3300025911 Ga0207654_10018236 Ga0207654_100182362 231
388 3300025911 Ga0207654_10392955 Ga0207654_103929551 231
389 3300025934 Ga0207686_10266948 Ga0207686_102669482 231
390 3300028379 Ga0268266_10004881 Ga0268266_100048815 231
391 3300028800 Ga0265338_10000908 Ga0265338_1000090810 231
392 3300031251 Ga0265327_10103801 Ga0265327_101038012 231
393 3300042876 Ga0451577_0028852 Ga0451577_0028852_210_917 231
394 3300044673 Ga0453683_0074790 Ga0453683_0074790_891_1598 231
395 3300044673 Ga0453683_0129756 Ga0453683_0129756_736_1443 231
396 3300005329 Ga0070683_100148294 Ga0070683_1001482942 232
397 3300005458 Ga0070681_10001618 Ga0070681_100016184 232
398 3300009093 Ga0105240_10014082 Ga0105240_100140828 232
399 3300025913 Ga0207695_10089287 Ga0207695_100892872 232
400 3300025961 Ga0207712_10080295 Ga0207712_100802952 232
401 3300053178 Ga0500637_0013264 Ga0500637_0013264_3303_4070 232
402 3300028563 Ga0265319_1003256 Ga0265319_10032567 233
403 3300028573 Ga0265334_10000783 Ga0265334_100007837 233
404 3300028577 Ga0265318_10000270 Ga0265318_100002709 233
405 3300028800 Ga0265338_10038982 Ga0265338_100389824 233
406 3300031235 Ga0265330_10006183 Ga0265330_100061834 233
407 3300031238 Ga0265332_10002881 Ga0265332_100028819 233
408 3300031239 Ga0265328_10006797 Ga0265328_100067972 233
409 3300031240 Ga0265320_10031924 Ga0265320_100319244 233
410 3300031241 Ga0265325_10001369 Ga0265325_1000136914 233
411 3300031242 Ga0265329_10013346 Ga0265329_100133463 233
412 3300031249 Ga0265339_10011088 Ga0265339_100110885 233
413 3300031250 Ga0265331_10009402 Ga0265331_100094024 233
414 3300031344 Ga0265316_10008294 Ga0265316_100082944 233
415 3300031595 Ga0265313_10002084 Ga0265313_1000208412 233
416 3300031711 Ga0265314_10097362 Ga0265314_100973622 233
417 3300031712 Ga0265342_10002903 Ga0265342_1000290310 233
418 3300046517 Ga0495630_0086457 Ga0495630_0086457_1452_2159 233
419 3300049588 Ga0501072_0250521 Ga0501072_0250521_581_1285 233
420 3300005367 Ga0070667_100050279 Ga0070667_1000502794 234
421 3300005436 Ga0070713_100216741 Ga0070713_1002167412 234
422 3300005457 Ga0070662_100021488 Ga0070662_1000214882 234
423 3300005536 Ga0070697_100150041 Ga0070697_1001500413 234
424 3300005539 Ga0068853_100007799 Ga0068853_1000077996 234
425 3300005545 Ga0070695_100059795 Ga0070695_1000597952 234
426 3300005546 Ga0070696_100000233 Ga0070696_10000023323 234
427 3300005563 Ga0068855_100220388 Ga0068855_1002203882 234
428 3300005616 Ga0068852_100432356 Ga0068852_1004323561 234
429 3300005616 Ga0068852_100443987 Ga0068852_1004439873 234
430 3300005617 Ga0068859_100385853 Ga0068859_1003858531 234
431 3300005618 Ga0068864_100308824 Ga0068864_1003088242 234
432 3300005618 Ga0068864_100423801 Ga0068864_1004238012 234
433 3300005841 Ga0068863_100231147 Ga0068863_1002311473 234
434 3300005842 Ga0068858_100101833 Ga0068858_1001018332 234
435 3300006237 Ga0097621_100244832 Ga0097621_1002448322 234
436 3300006358 Ga0068871_100128773 Ga0068871_1001287732 234
437 3300006931 Ga0097620_100385829 Ga0097620_1003858293 234
438 3300007788 Ga0099795_10011101 Ga0099795_100111012 234
439 3300009093 Ga0105240_10097222 Ga0105240_100972225 234
440 3300009093 Ga0105240_10252307 Ga0105240_102523072 234
441 3300009176 Ga0105242_10044453 Ga0105242_100444534 234
442 3300009177 Ga0105248_10283034 Ga0105248_102830342 234
443 3300009553 Ga0105249_10138848 Ga0105249_101388483 234
444 3300010159 Ga0099796_10009133 Ga0099796_100091332 234
445 3300013100 Ga0157373_10035286 Ga0157373_100352862 234
446 3300013306 Ga0163162_10457560 Ga0163162_104575602 234
447 3300013308 Ga0157375_10391035 Ga0157375_103910352 234
448 3300025901 Ga0207688_10157665 Ga0207688_101576653 234
449 3300025913 Ga0207695_10374491 Ga0207695_103744912 234
450 3300025919 Ga0207657_10089443 Ga0207657_100894434 234
451 3300025926 Ga0207659_10369824 Ga0207659_103698242 234
452 3300025928 Ga0207700_10212562 Ga0207700_102125622 234
453 3300025934 Ga0207686_10484394 Ga0207686_104843941 234
454 3300025936 Ga0207670_10010211 Ga0207670_100102112 234
455 3300025939 Ga0207665_10410189 Ga0207665_104101892 234
456 3300025961 Ga0207712_10143993 Ga0207712_101439933 234
457 3300025986 Ga0207658_10070283 Ga0207658_100702832 234
458 3300026041 Ga0207639_10022623 Ga0207639_100226234 234
459 3300026088 Ga0207641_10091759 Ga0207641_100917592 234
460 3300026095 Ga0207676_10310065 Ga0207676_103100652 234
461 3300026095 Ga0207676_10636925 Ga0207676_106369252 234
462 3300026095 Ga0207676_10735490 Ga0207676_107354902 234
463 3300026121 Ga0207683_10341977 Ga0207683_103419771 234
464 3300026142 Ga0207698_10143352 Ga0207698_101433522 234
465 3300027666 Ga0209282_1000048 Ga0209282_100004818 234
466 3300028380 Ga0268265_10497682 Ga0268265_104976821 234
467 3300028800 Ga0265338_10049953 Ga0265338_100499533 234
468 3300030760 Ga0265762_1020903 Ga0265762_10209032 234
469 3300031090 Ga0265760_10006363 Ga0265760_100063632 234
470 3300031090 Ga0265760_10023643 Ga0265760_100236432 234
471 3300031235 Ga0265330_10210951 Ga0265330_102109511 234
472 3300031548 Ga0307408_100622058 Ga0307408_1006220581 234
473 3300031730 Ga0307516_10002208 Ga0307516_1000220813 234
474 3300031731 Ga0307405_10134929 Ga0307405_101349293 234
475 3300031824 Ga0307413_10048890 Ga0307413_100488902 234
476 3300031852 Ga0307410_10008017 Ga0307410_100080176 234
477 3300031852 Ga0307410_10032832 Ga0307410_100328321 234
478 3300031901 Ga0307406_10027106 Ga0307406_100271063 234
479 3300031903 Ga0307407_10017706 Ga0307407_100177062 234
480 3300031911 Ga0307412_10020830 Ga0307412_100208303 234
481 3300031995 Ga0307409_100000356 Ga0307409_1000003567 234
482 3300031995 Ga0307409_100292940 Ga0307409_1002929402 234
483 3300032004 Ga0307414_10056028 Ga0307414_100560282 234
484 3300032004 Ga0307414_10084890 Ga0307414_100848902 234
485 3300032005 Ga0307411_10030516 Ga0307411_100305162 234
486 3300032005 Ga0307411_10082409 Ga0307411_100824092 234
487 3300037068 Ga0373925_0224708 Ga0373925_0224708_713_1423 234
488 3300037418 Ga0395900_0813295 Ga0395900_0813295_103_807 234
489 3300039450 Ga0436363_0744495 Ga0436363_0744495_25_843 234
490 3300046473 Ga0495582_0354006 Ga0495582_0354006_78_782 234
491 3300046474 Ga0495605_0004939 Ga0495605_0004939_4537_5298 234
492 3300046500 Ga0495596_0006299 Ga0495596_0006299_2496_3257 234
493 3300046501 Ga0495607_0014138 Ga0495607_0014138_2208_2969 234
494 3300046512 Ga0495610_0003749 Ga0495610_0003749_8629_9390 234
495 3300046513 Ga0495616_0010536 Ga0495616_0010536_2364_3125 234
496 3300046522 Ga0495643_0035857 Ga0495643_0035857_1063_1824 234
497 3300046529 Ga0495652_0546507 Ga0495652_0546507_48_758 234
498 3300046616 Ga0495668_0004686 Ga0495668_0004686_4486_5190 234
499 3300046665 Ga0495661_0024022 Ga0495661_0024022_1127_1888 234
500 3300046684 Ga0495669_0033086 Ga0495669_0033086_398_1159 234
501 3300046692 Ga0495671_0002656 Ga0495671_0002656_8413_9174 234
502 3300046694 Ga0495649_0020169 Ga0495649_0020169_1909_2670 234
503 3300047317 Ga0495604_0026945 Ga0495604_0026945_2155_2880 234
504 3300047319 Ga0495674_0650761 Ga0495674_0650761_49_759 234
505 3300047320 Ga0495672_0026130 Ga0495672_0026130_1883_2644 234
506 3300048907 Ga0496104_0038244 Ga0496104_0038244_694_1404 234
507 3300048908 Ga0496105_0016416 Ga0496105_0016416_310_1020 234
508 3300048918 Ga0496115_0019186 Ga0496115_0019186_4206_4916 234
509 3300048919 Ga0496116_0008195 Ga0496116_0008195_354_1115 234
510 3300048924 Ga0496121_0057967 Ga0496121_0057967_2253_3014 234
511 3300048925 Ga0496122_0005665 Ga0496122_0005665_2458_3219 234
512 3300048926 Ga0496123_0006518 Ga0496123_0006518_2264_3025 234
513 3300003316 rootH1_10172240 rootH1_101722401 235
514 3300053125 Ga0500618_001110 Ga0500618_001110_6926_7702 235
515 iso_pu_bacteria 2904434214 2904438196 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02592

Vut_1

Putative vitamin uptake transporter

69

229

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.5687 11 215
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.5001 11 215
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.4917 10 217
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.4587 10 217
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.3933 10 216
ID Description Score Start End Superfamily
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7581 49 208 1.10.1760.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7429 49 208 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6489 49 212 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6359 49 212 1.10.1760.20
5ajiF01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.517 120 212 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A3M1SL91-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9858 6 235 GO:0005886
GO:0022857
GO:1990397
AF-A0A3M2D398-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.985 6 235 GO:0005886
GO:0022857
GO:1990397
AF-A0A2V8RID3-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9838 4 235 GO:0005886
GO:0022857
GO:1990397
AF-A0A2V7TRP8-F1-model_v4 Queuosine precursor transporter 0.9819 2 235 GO:0016020
GO:1990397
AF-A0A031JI26-F1-model_v4 deleted 0.9804 5 232

Feature Viewer

pLDDT pTM Quality
85.66 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map