F457930
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 515 | 261 | 514 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300053178|Ga0500637_0013264|Ga0500637_0013264_3303_4070 |
| Length | 255 |
| Sequence | MAAGSNEKSRPPLMSATAPGADASSAQRQFRYYDFIMAAYVCVLLCANLIGPAKLSTVRVPVFGDVTFLAGVLFFPISYVFGDVLTEVYGYARDRRVVWAGFGALAFASFMAAVVVHLPPATNWKDQSAVDTIFGNTPRIILGSITAFWSGSFVNSYVLAKMKIWTQGRWLWTRTIGSTLCGELVDSAIFYTIAFYGLWPVDQLIAVLFTQYVLKSTWEIVATPLTYKVVGFLKRKESEDFYDRATNFTPFSLKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 256 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 257 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 259 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 260 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 261 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.58 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.14 |
| Nodule | 0.19 |
| Rhizoplane | 4.85 |
| Rhizosphere | 84.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10172240 | 3300003316 | Unclassified | 1346 |
| 2 | rootH1_10318854 | 3300003323 | Bacteria | 1326 |
| 3 | Ga0065707_10083043 | 3300005295 | Bacteria | 10704 |
| 4 | Ga0070658_10000547 | 3300005327 | Bacteria | 32575 |
| 5 | Ga0070683_100148294 | 3300005329 | Bacteria | 2224 |
| 6 | Ga0070690_100039753 | 3300005330 | Bacteria | 2973 |
| 7 | Ga0070670_100033604 | 3300005331 | Bacteria | 4417 |
| 8 | Ga0070670_100308222 | 3300005331 | Bacteria | 1385 |
| 9 | Ga0070666_10010472 | 3300005335 | Bacteria | 5803 |
| 10 | Ga0070666_10028306 | 3300005335 | Bacteria | 3676 |
| 11 | Ga0070680_100005294 | 3300005336 | Bacteria | 9761 |
| 12 | Ga0070680_100016607 | 3300005336 | Bacteria | 5793 |
| 13 | Ga0070680_100056162 | 3300005336 | Bacteria | 3218 |
| 14 | Ga0070682_100100571 | 3300005337 | Bacteria | 1908 |
| 15 | Ga0068868_100003004 | 3300005338 | Bacteria | 11727 |
| 16 | Ga0070660_100232638 | 3300005339 | Unclassified | 1500 |
| 17 | Ga0070661_100021618 | 3300005344 | Bacteria | 4598 |
| 18 | Ga0070675_100289231 | 3300005354 | Bacteria | 1442 |
| 19 | Ga0070671_100000199 | 3300005355 | Bacteria | 40241 |
| 20 | Ga0070671_100010893 | 3300005355 | Bacteria | 7302 |
| 21 | Ga0070671_100533157 | 3300005355 | Bacteria | 1011 |
| 22 | Ga0070673_100161018 | 3300005364 | Bacteria | 1909 |
| 23 | Ga0070667_100000069 | 3300005367 | Bacteria | 126807 |
| 24 | Ga0070667_100004680 | 3300005367 | Bacteria | 11487 |
| 25 | Ga0070667_100012032 | 3300005367 | Bacteria | 7162 |
| 26 | Ga0070667_100050279 | 3300005367 | Bacteria | 3513 |
| 27 | Ga0070667_100313066 | 3300005367 | Bacteria | 1415 |
| 28 | Ga0070709_10000986 | 3300005434 | Bacteria | 15746 |
| 29 | Ga0070709_10101605 | 3300005434 | Bacteria | 1916 |
| 30 | Ga0070709_10189511 | 3300005434 | Bacteria | 1450 |
| 31 | Ga0070714_100005208 | 3300005435 | Bacteria | 9896 |
| 32 | Ga0070714_100216354 | 3300005435 | Bacteria | 1759 |
| 33 | Ga0070714_100235041 | 3300005435 | Bacteria | 1690 |
| 34 | Ga0070713_100002662 | 3300005436 | Bacteria | 11640 |
| 35 | Ga0070713_100029679 | 3300005436 | Bacteria | 4333 |
| 36 | Ga0070713_100216741 | 3300005436 | Bacteria | 1735 |
| 37 | Ga0070713_100481725 | 3300005436 | Bacteria | 1169 |
| 38 | Ga0070710_10012975 | 3300005437 | Bacteria | 4156 |
| 39 | Ga0070710_10451029 | 3300005437 | Bacteria | 872 |
| 40 | Ga0070711_100000649 | 3300005439 | Bacteria | 18137 |
| 41 | Ga0070711_100124324 | 3300005439 | Bacteria | 1913 |
| 42 | Ga0070705_100403395 | 3300005440 | Bacteria | 1013 |
| 43 | Ga0070678_100051360 | 3300005456 | Bacteria | 2988 |
| 44 | Ga0070662_100021488 | 3300005457 | Bacteria | 4407 |
| 45 | Ga0070662_100116405 | 3300005457 | Bacteria | 2043 |
| 46 | Ga0070681_10001618 | 3300005458 | Bacteria | 20059 |
| 47 | Ga0070681_10002712 | 3300005458 | Bacteria | 16300 |
| 48 | Ga0070681_10016827 | 3300005458 | Bacteria | 7302 |
| 49 | Ga0070681_10017608 | 3300005458 | Bacteria | 7141 |
| 50 | Ga0070681_10066376 | 3300005458 | Bacteria | 3577 |
| 51 | Ga0070681_10119294 | 3300005458 | Bacteria | 2574 |
| 52 | Ga0070681_10120157 | 3300005458 | Bacteria | 2563 |
| 53 | Ga0070681_10154498 | 3300005458 | Bacteria | 2220 |
| 54 | Ga0070681_10410151 | 3300005458 | Unclassified | 1266 |
| 55 | Ga0070685_10078657 | 3300005466 | Bacteria | 1972 |
| 56 | Ga0070679_100004670 | 3300005530 | Bacteria | 12639 |
| 57 | Ga0070679_100011264 | 3300005530 | Bacteria | 8524 |
| 58 | Ga0070679_100042103 | 3300005530 | Bacteria | 4548 |
| 59 | Ga0070679_100181141 | 3300005530 | Bacteria | 2079 |
| 60 | Ga0070679_100295438 | 3300005530 | Bacteria | 1571 |
| 61 | Ga0070697_100150041 | 3300005536 | Bacteria | 1964 |
| 62 | Ga0068853_100002295 | 3300005539 | Bacteria | 14297 |
| 63 | Ga0068853_100007799 | 3300005539 | Bacteria | 8584 |
| 64 | Ga0068853_100077837 | 3300005539 | Unclassified | 2898 |
| 65 | Ga0068853_100197453 | 3300005539 | Bacteria | 1830 |
| 66 | Ga0068853_100359937 | 3300005539 | Bacteria | 1355 |
| 67 | Ga0070686_100109309 | 3300005544 | Unclassified | 1881 |
| 68 | Ga0070695_100030241 | 3300005545 | Bacteria | 3371 |
| 69 | Ga0070695_100059795 | 3300005545 | Bacteria | 2468 |
| 70 | Ga0070696_100000233 | 3300005546 | Bacteria | 33711 |
| 71 | Ga0070693_100599201 | 3300005547 | Bacteria | 795 |
| 72 | Ga0070665_100002460 | 3300005548 | Bacteria | 20415 |
| 73 | Ga0070665_100012162 | 3300005548 | Bacteria | 8677 |
| 74 | Ga0070665_100138108 | 3300005548 | Bacteria | 2440 |
| 75 | Ga0070665_100238596 | 3300005548 | Bacteria | 1819 |
| 76 | Ga0070665_100596548 | 3300005548 | Bacteria | 1117 |
| 77 | Ga0068855_100000592 | 3300005563 | Bacteria | 44394 |
| 78 | Ga0068855_100004608 | 3300005563 | Bacteria | 16829 |
| 79 | Ga0068855_100220388 | 3300005563 | Bacteria | 2128 |
| 80 | Ga0068855_100301393 | 3300005563 | Bacteria | 1775 |
| 81 | Ga0070664_100002024 | 3300005564 | Bacteria | 16250 |
| 82 | Ga0070664_100013450 | 3300005564 | Bacteria | 6664 |
| 83 | Ga0068857_100034436 | 3300005577 | Bacteria | 4480 |
| 84 | Ga0068857_100321171 | 3300005577 | Bacteria | 1430 |
| 85 | Ga0068854_100105587 | 3300005578 | Bacteria | 2118 |
| 86 | Ga0068856_100046028 | 3300005614 | Bacteria | 4297 |
| 87 | Ga0068852_100341005 | 3300005616 | Bacteria | 1460 |
| 88 | Ga0068852_100432356 | 3300005616 | Bacteria | 1300 |
| 89 | Ga0068852_100443987 | 3300005616 | Bacteria | 1283 |
| 90 | Ga0068859_100002486 | 3300005617 | Bacteria | 18754 |
| 91 | Ga0068859_100063169 | 3300005617 | Bacteria | 3734 |
| 92 | Ga0068859_100072520 | 3300005617 | Bacteria | 3480 |
| 93 | Ga0068859_100385853 | 3300005617 | Bacteria | 1496 |
| 94 | Ga0068864_100079163 | 3300005618 | Bacteria | 2877 |
| 95 | Ga0068864_100308824 | 3300005618 | Bacteria | 1482 |
| 96 | Ga0068864_100423801 | 3300005618 | Bacteria | 1268 |
| 97 | Ga0068866_10007506 | 3300005718 | Bacteria | 4567 |
| 98 | Ga0068861_100430065 | 3300005719 | Bacteria | 1178 |
| 99 | Ga0068851_10360481 | 3300005834 | Bacteria | 848 |
| 100 | Ga0068863_100016434 | 3300005841 | Bacteria | 7099 |
| 101 | Ga0068863_100081510 | 3300005841 | Bacteria | 3065 |
| 102 | Ga0068863_100086151 | 3300005841 | Bacteria | 2976 |
| 103 | Ga0068863_100231147 | 3300005841 | Bacteria | 1784 |
| 104 | Ga0068863_100865186 | 3300005841 | Unclassified | 903 |
| 105 | Ga0068858_100000285 | 3300005842 | Bacteria | 54696 |
| 106 | Ga0068858_100005143 | 3300005842 | Bacteria | 12816 |
| 107 | Ga0068858_100012491 | 3300005842 | Bacteria | 8010 |
| 108 | Ga0068858_100101833 | 3300005842 | Bacteria | 2679 |
| 109 | Ga0068860_100001390 | 3300005843 | Bacteria | 26246 |
| 110 | Ga0068860_100005786 | 3300005843 | Bacteria | 12457 |
| 111 | Ga0068860_100012863 | 3300005843 | Bacteria | 8226 |
| 112 | Ga0068862_100033959 | 3300005844 | Bacteria | 4315 |
| 113 | Ga0068862_100152003 | 3300005844 | Bacteria | 2061 |
| 114 | Ga0068862_100788189 | 3300005844 | Unclassified | 927 |
| 115 | Ga0070715_10000239 | 3300006163 | Bacteria | 13132 |
| 116 | Ga0070716_100014146 | 3300006173 | Bacteria | 4083 |
| 117 | Ga0070716_100015412 | 3300006173 | Bacteria | 3927 |
| 118 | Ga0070716_100129708 | 3300006173 | Bacteria | 1592 |
| 119 | Ga0070712_100000751 | 3300006175 | Bacteria | 19153 |
| 120 | Ga0070712_100054077 | 3300006175 | Bacteria | 2805 |
| 121 | Ga0097621_100244832 | 3300006237 | Unclassified | 1568 |
| 122 | Ga0068871_100128773 | 3300006358 | Bacteria | 2144 |
| 123 | Ga0075434_100207272 | 3300006871 | Bacteria | 1981 |
| 124 | Ga0068865_100033036 | 3300006881 | Bacteria | 3462 |
| 125 | Ga0097620_100002486 | 3300006931 | Bacteria | 18754 |
| 126 | Ga0097620_100063167 | 3300006931 | Bacteria | 3734 |
| 127 | Ga0097620_100072519 | 3300006931 | Bacteria | 3480 |
| 128 | Ga0097620_100385829 | 3300006931 | Bacteria | 1496 |
| 129 | Ga0099795_10011101 | 3300007788 | Bacteria | 2678 |
| 130 | Ga0105251_10007536 | 3300009011 | Bacteria | 6686 |
| 131 | Ga0105250_10154128 | 3300009092 | Unclassified | 957 |
| 132 | Ga0105240_10014082 | 3300009093 | Bacteria | 10929 |
| 133 | Ga0105240_10024226 | 3300009093 | Bacteria | 8008 |
| 134 | Ga0105240_10044583 | 3300009093 | Bacteria | 5635 |
| 135 | Ga0105240_10049421 | 3300009093 | Bacteria | 5308 |
| 136 | Ga0105240_10060987 | 3300009093 | Bacteria | 4701 |
| 137 | Ga0105240_10085366 | 3300009093 | Bacteria | 3867 |
| 138 | Ga0105240_10096276 | 3300009093 | Bacteria | 3607 |
| 139 | Ga0105240_10097222 | 3300009093 | Bacteria | 3588 |
| 140 | Ga0105240_10252307 | 3300009093 | Bacteria | 2040 |
| 141 | Ga0105240_10286210 | 3300009093 | Bacteria | 1891 |
| 142 | Ga0105240_11000919 | 3300009093 | Bacteria | 894 |
| 143 | Ga0105245_10017497 | 3300009098 | Bacteria | 6254 |
| 144 | Ga0105247_10000072 | 3300009101 | Bacteria | 113959 |
| 145 | Ga0105247_10010957 | 3300009101 | Bacteria | 5474 |
| 146 | Ga0105247_10072899 | 3300009101 | Bacteria | 2150 |
| 147 | Ga0105247_10167367 | 3300009101 | Bacteria | 1459 |
| 148 | Ga0105241_10004905 | 3300009174 | Bacteria | 9868 |
| 149 | Ga0105241_10162684 | 3300009174 | Bacteria | 1836 |
| 150 | Ga0105241_10758046 | 3300009174 | Bacteria | 891 |
| 151 | Ga0105242_10001357 | 3300009176 | Bacteria | 19306 |
| 152 | Ga0105242_10044453 | 3300009176 | Bacteria | 3598 |
| 153 | Ga0105248_10024681 | 3300009177 | Bacteria | 6685 |
| 154 | Ga0105248_10156395 | 3300009177 | Bacteria | 2573 |
| 155 | Ga0105248_10283034 | 3300009177 | Bacteria | 1867 |
| 156 | Ga0105237_10041800 | 3300009545 | Bacteria | 4622 |
| 157 | Ga0105237_10055385 | 3300009545 | Bacteria | 3972 |
| 158 | Ga0105237_10160215 | 3300009545 | Bacteria | 2248 |
| 159 | Ga0105237_10165993 | 3300009545 | Bacteria | 2207 |
| 160 | Ga0105237_10214698 | 3300009545 | Bacteria | 1924 |
| 161 | Ga0105237_10237202 | 3300009545 | Bacteria | 1825 |
| 162 | Ga0105238_10001369 | 3300009551 | Bacteria | 24451 |
| 163 | Ga0105238_10074591 | 3300009551 | Bacteria | 3385 |
| 164 | Ga0105238_10121155 | 3300009551 | Bacteria | 2595 |
| 165 | Ga0105238_10556983 | 3300009551 | Bacteria | 1151 |
| 166 | Ga0105249_10123348 | 3300009553 | Bacteria | 2464 |
| 167 | Ga0105249_10127726 | 3300009553 | Bacteria | 2423 |
| 168 | Ga0105249_10138848 | 3300009553 | Bacteria | 2328 |
| 169 | Ga0105249_10355709 | 3300009553 | Bacteria | 1485 |
| 170 | Ga0105249_10598732 | 3300009553 | Bacteria | 1157 |
| 171 | Ga0099796_10008949 | 3300010159 | Bacteria | 2689 |
| 172 | Ga0099796_10009133 | 3300010159 | Bacteria | 2671 |
| 173 | Ga0105239_10108339 | 3300010375 | Bacteria | 3078 |
| 174 | Ga0105239_10119087 | 3300010375 | Bacteria | 2930 |
| 175 | Ga0105239_10213673 | 3300010375 | Bacteria | 2162 |
| 176 | Ga0105239_11093170 | 3300010375 | Bacteria | 918 |
| 177 | Ga0105246_10124287 | 3300011119 | Bacteria | 1917 |
| 178 | Ga0157373_10035286 | 3300013100 | Bacteria | 3591 |
| 179 | Ga0157370_10001792 | 3300013104 | Bacteria | 26474 |
| 180 | Ga0157370_10169615 | 3300013104 | Unclassified | 2029 |
| 181 | Ga0157369_10008374 | 3300013105 | Bacteria | 11859 |
| 182 | Ga0157369_10020588 | 3300013105 | Bacteria | 7374 |
| 183 | Ga0157369_10248168 | 3300013105 | Bacteria | 1858 |
| 184 | Ga0157369_10402517 | 3300013105 | Unclassified | 1420 |
| 185 | Ga0157369_10911709 | 3300013105 | Bacteria | 901 |
| 186 | Ga0157374_10024555 | 3300013296 | Bacteria | 5405 |
| 187 | Ga0157374_10143663 | 3300013296 | Bacteria | 2317 |
| 188 | Ga0157378_10014547 | 3300013297 | Bacteria | 6890 |
| 189 | Ga0163162_10080654 | 3300013306 | Bacteria | 3322 |
| 190 | Ga0163162_10151550 | 3300013306 | Unclassified | 2437 |
| 191 | Ga0163162_10229947 | 3300013306 | Bacteria | 1985 |
| 192 | Ga0163162_10457560 | 3300013306 | Bacteria | 1408 |
| 193 | Ga0157375_10096475 | 3300013308 | Bacteria | 3029 |
| 194 | Ga0157375_10391035 | 3300013308 | Bacteria | 1557 |
| 195 | Ga0163163_10043200 | 3300014325 | Bacteria | 4418 |
| 196 | Ga0163163_10080037 | 3300014325 | Bacteria | 3267 |
| 197 | Ga0163163_10249199 | 3300014325 | Bacteria | 1826 |
| 198 | Ga0163163_10251471 | 3300014325 | Bacteria | 1818 |
| 199 | Ga0163163_10872868 | 3300014325 | Bacteria | 963 |
| 200 | Ga0157377_10210600 | 3300014745 | Bacteria | 1239 |
| 201 | Ga0157379_10002427 | 3300014968 | Bacteria | 15597 |
| 202 | Ga0157379_10157471 | 3300014968 | Bacteria | 2049 |
| 203 | Ga0157379_10283657 | 3300014968 | Bacteria | 1507 |
| 204 | Ga0157376_10534142 | 3300014969 | Bacteria | 1158 |
| 205 | Ga0213873_10027418 | 3300021358 | Bacteria | 1389 |
| 206 | Ga0213874_10007878 | 3300021377 | Bacteria | 2574 |
| 207 | Ga0213876_10093751 | 3300021384 | Bacteria | 1591 |
| 208 | Ga0213876_10110787 | 3300021384 | Bacteria | 1457 |
| 209 | Ga0207656_10062917 | 3300025321 | Unclassified | 1632 |
| 210 | Ga0207692_10061923 | 3300025898 | Bacteria | 1941 |
| 211 | Ga0207642_10005524 | 3300025899 | Bacteria | 4130 |
| 212 | Ga0207710_10000238 | 3300025900 | Bacteria | 47168 |
| 213 | Ga0207710_10011690 | 3300025900 | Bacteria | 3692 |
| 214 | Ga0207688_10157665 | 3300025901 | Bacteria | 1344 |
| 215 | Ga0207680_10015552 | 3300025903 | Unclassified | 3973 |
| 216 | Ga0207680_10018594 | 3300025903 | Bacteria | 3698 |
| 217 | Ga0207680_10060528 | 3300025903 | Bacteria | 2305 |
| 218 | Ga0207699_10002835 | 3300025906 | Bacteria | 8210 |
| 219 | Ga0207699_10052276 | 3300025906 | Bacteria | 2418 |
| 220 | Ga0207705_10003787 | 3300025909 | Bacteria | 11520 |
| 221 | Ga0207654_10018236 | 3300025911 | Bacteria | 3679 |
| 222 | Ga0207654_10323801 | 3300025911 | Bacteria | 1054 |
| 223 | Ga0207654_10392955 | 3300025911 | Bacteria | 963 |
| 224 | Ga0207707_10000411 | 3300025912 | Bacteria | 44888 |
| 225 | Ga0207707_10009225 | 3300025912 | Bacteria | 8562 |
| 226 | Ga0207707_10037473 | 3300025912 | Bacteria | 4238 |
| 227 | Ga0207707_10101983 | 3300025912 | Bacteria | 2508 |
| 228 | Ga0207707_10508912 | 3300025912 | Bacteria | 1026 |
| 229 | Ga0207695_10007491 | 3300025913 | Bacteria | 13865 |
| 230 | Ga0207695_10043261 | 3300025913 | Bacteria | 4800 |
| 231 | Ga0207695_10044022 | 3300025913 | Bacteria | 4752 |
| 232 | Ga0207695_10047312 | 3300025913 | Bacteria | 4553 |
| 233 | Ga0207695_10089287 | 3300025913 | Bacteria | 3099 |
| 234 | Ga0207695_10091540 | 3300025913 | Bacteria | 3055 |
| 235 | Ga0207695_10238573 | 3300025913 | Bacteria | 1720 |
| 236 | Ga0207695_10374491 | 3300025913 | Bacteria | 1310 |
| 237 | Ga0207695_10395213 | 3300025913 | Bacteria | 1267 |
| 238 | Ga0207695_10524458 | 3300025913 | Bacteria | 1066 |
| 239 | Ga0207671_10073699 | 3300025914 | Bacteria | 2550 |
| 240 | Ga0207671_10311797 | 3300025914 | Bacteria | 1244 |
| 241 | Ga0207693_10000161 | 3300025915 | Bacteria | 61727 |
| 242 | Ga0207693_10038794 | 3300025915 | Bacteria | 3750 |
| 243 | Ga0207663_10015294 | 3300025916 | Bacteria | 4231 |
| 244 | Ga0207663_10036946 | 3300025916 | Bacteria | 2941 |
| 245 | Ga0207663_10173553 | 3300025916 | Bacteria | 1533 |
| 246 | Ga0207660_10005790 | 3300025917 | Bacteria | 8023 |
| 247 | Ga0207660_10095700 | 3300025917 | Bacteria | 2210 |
| 248 | Ga0207657_10089443 | 3300025919 | Bacteria | 2572 |
| 249 | Ga0207652_10005406 | 3300025921 | Bacteria | 10365 |
| 250 | Ga0207652_10034482 | 3300025921 | Bacteria | 4265 |
| 251 | Ga0207652_10040082 | 3300025921 | Bacteria | 3977 |
| 252 | Ga0207652_10151656 | 3300025921 | Bacteria | 2075 |
| 253 | Ga0207694_10016981 | 3300025924 | Bacteria | 5497 |
| 254 | Ga0207694_10019306 | 3300025924 | Bacteria | 5153 |
| 255 | Ga0207694_10081266 | 3300025924 | Bacteria | 2545 |
| 256 | Ga0207694_10209384 | 3300025924 | Unclassified | 1588 |
| 257 | Ga0207694_10502874 | 3300025924 | Bacteria | 1015 |
| 258 | Ga0207694_10511297 | 3300025924 | Bacteria | 1006 |
| 259 | Ga0207659_10369824 | 3300025926 | Bacteria | 1193 |
| 260 | Ga0207687_10056552 | 3300025927 | Bacteria | 2753 |
| 261 | Ga0207700_10010500 | 3300025928 | Bacteria | 5848 |
| 262 | Ga0207700_10011997 | 3300025928 | Bacteria | 5561 |
| 263 | Ga0207700_10184670 | 3300025928 | Bacteria | 1748 |
| 264 | Ga0207700_10212562 | 3300025928 | Bacteria | 1636 |
| 265 | Ga0207664_10185910 | 3300025929 | Bacteria | 1786 |
| 266 | Ga0207644_10004142 | 3300025931 | Bacteria | 9403 |
| 267 | Ga0207644_10302045 | 3300025931 | Bacteria | 1290 |
| 268 | Ga0207644_10480932 | 3300025931 | Unclassified | 1023 |
| 269 | Ga0207690_10081363 | 3300025932 | Bacteria | 2263 |
| 270 | Ga0207706_10231017 | 3300025933 | Bacteria | 1618 |
| 271 | Ga0207686_10012371 | 3300025934 | Bacteria | 4692 |
| 272 | Ga0207686_10266948 | 3300025934 | Bacteria | 1257 |
| 273 | Ga0207686_10484394 | 3300025934 | Bacteria | 957 |
| 274 | Ga0207670_10010211 | 3300025936 | Bacteria | 5399 |
| 275 | Ga0207704_10117860 | 3300025938 | Bacteria | 1809 |
| 276 | Ga0207665_10013204 | 3300025939 | Bacteria | 5432 |
| 277 | Ga0207665_10015339 | 3300025939 | Bacteria | 5031 |
| 278 | Ga0207665_10410189 | 3300025939 | Bacteria | 1033 |
| 279 | Ga0207711_10058578 | 3300025941 | Bacteria | 3315 |
| 280 | Ga0207711_10071438 | 3300025941 | Bacteria | 3011 |
| 281 | Ga0207661_10103487 | 3300025944 | Bacteria | 2396 |
| 282 | Ga0207661_10203090 | 3300025944 | Bacteria | 1743 |
| 283 | Ga0207679_10015619 | 3300025945 | Bacteria | 5024 |
| 284 | Ga0207679_10151861 | 3300025945 | Unclassified | 1886 |
| 285 | Ga0207667_10012498 | 3300025949 | Bacteria | 9775 |
| 286 | Ga0207667_10045762 | 3300025949 | Bacteria | 4633 |
| 287 | Ga0207667_10184786 | 3300025949 | Bacteria | 2140 |
| 288 | Ga0207667_10604637 | 3300025949 | Bacteria | 1105 |
| 289 | Ga0207651_10333301 | 3300025960 | Bacteria | 1272 |
| 290 | Ga0207712_10080295 | 3300025961 | Bacteria | 2372 |
| 291 | Ga0207712_10110678 | 3300025961 | Unclassified | 2060 |
| 292 | Ga0207712_10143993 | 3300025961 | Bacteria | 1833 |
| 293 | Ga0207658_10000038 | 3300025986 | Bacteria | 145669 |
| 294 | Ga0207658_10070283 | 3300025986 | Bacteria | 2648 |
| 295 | Ga0207658_10073432 | 3300025986 | Bacteria | 2596 |
| 296 | Ga0207658_10130178 | 3300025986 | Bacteria | 2020 |
| 297 | Ga0207677_10139594 | 3300026023 | Bacteria | 1853 |
| 298 | Ga0207703_10000605 | 3300026035 | Bacteria | 36427 |
| 299 | Ga0207703_10000754 | 3300026035 | Bacteria | 31947 |
| 300 | Ga0207639_10022623 | 3300026041 | Bacteria | 4529 |
| 301 | Ga0207639_10120224 | 3300026041 | Unclassified | 2157 |
| 302 | Ga0207639_10264184 | 3300026041 | Bacteria | 1507 |
| 303 | Ga0207639_10460345 | 3300026041 | Bacteria | 1156 |
| 304 | Ga0207678_10627293 | 3300026067 | Bacteria | 943 |
| 305 | Ga0207702_10094289 | 3300026078 | Bacteria | 2627 |
| 306 | Ga0207702_10187066 | 3300026078 | Bacteria | 1910 |
| 307 | Ga0207641_10000083 | 3300026088 | Bacteria | 134703 |
| 308 | Ga0207641_10007436 | 3300026088 | Bacteria | 9113 |
| 309 | Ga0207641_10091759 | 3300026088 | Bacteria | 2659 |
| 310 | Ga0207641_10113790 | 3300026088 | Bacteria | 2403 |
| 311 | Ga0207676_10037279 | 3300026095 | Bacteria | 3704 |
| 312 | Ga0207676_10310065 | 3300026095 | Unclassified | 1444 |
| 313 | Ga0207676_10636925 | 3300026095 | Unclassified | 1027 |
| 314 | Ga0207676_10735490 | 3300026095 | Bacteria | 958 |
| 315 | Ga0207674_10017178 | 3300026116 | Bacteria | 7897 |
| 316 | Ga0207674_10288644 | 3300026116 | Bacteria | 1589 |
| 317 | Ga0207675_100211102 | 3300026118 | Unclassified | 1867 |
| 318 | Ga0207683_10002925 | 3300026121 | Bacteria | 14881 |
| 319 | Ga0207683_10341977 | 3300026121 | Unclassified | 1372 |
| 320 | Ga0207698_10143352 | 3300026142 | Bacteria | 2062 |
| 321 | Ga0209282_1000048 | 3300027666 | Bacteria | 111312 |
| 322 | Ga0268266_10004881 | 3300028379 | Bacteria | 12720 |
| 323 | Ga0268266_10108106 | 3300028379 | Bacteria | 2460 |
| 324 | Ga0268266_10172365 | 3300028379 | Bacteria | 1964 |
| 325 | Ga0268265_10036855 | 3300028380 | Bacteria | 3585 |
| 326 | Ga0268265_10497682 | 3300028380 | Bacteria | 1148 |
| 327 | Ga0268264_10000122 | 3300028381 | Bacteria | 189690 |
| 328 | Ga0268264_10073145 | 3300028381 | Unclassified | 2908 |
| 329 | Ga0265319_1003256 | 3300028563 | Bacteria | 8545 |
| 330 | Ga0265334_10000783 | 3300028573 | Bacteria | 15888 |
| 331 | Ga0265318_10000270 | 3300028577 | Bacteria | 44032 |
| 332 | Ga0265338_10000908 | 3300028800 | Bacteria | 49878 |
| 333 | Ga0265338_10038982 | 3300028800 | Bacteria | 4491 |
| 334 | Ga0265338_10049953 | 3300028800 | Bacteria | 3785 |
| 335 | Ga0307511_10000519 | 3300030521 | Bacteria | 41413 |
| 336 | Ga0307511_10031086 | 3300030521 | Bacteria | 4778 |
| 337 | Ga0265762_1020903 | 3300030760 | Bacteria | 1205 |
| 338 | Ga0265760_10006363 | 3300031090 | Bacteria | 3378 |
| 339 | Ga0265760_10023643 | 3300031090 | Unclassified | 1786 |
| 340 | Ga0265330_10006183 | 3300031235 | Bacteria | 5927 |
| 341 | Ga0265330_10210951 | 3300031235 | Bacteria | 820 |
| 342 | Ga0265332_10002881 | 3300031238 | Bacteria | 8502 |
| 343 | Ga0265328_10006797 | 3300031239 | Bacteria | 4810 |
| 344 | Ga0265320_10031924 | 3300031240 | Bacteria | 2701 |
| 345 | Ga0265325_10001369 | 3300031241 | Bacteria | 17208 |
| 346 | Ga0265329_10013346 | 3300031242 | Bacteria | 2931 |
| 347 | Ga0265340_10001829 | 3300031247 | Bacteria | 12159 |
| 348 | Ga0265340_10018843 | 3300031247 | Bacteria | 3557 |
| 349 | Ga0265339_10011088 | 3300031249 | Bacteria | 5565 |
| 350 | Ga0265339_10118631 | 3300031249 | Bacteria | 1362 |
| 351 | Ga0265331_10009402 | 3300031250 | Bacteria | 5486 |
| 352 | Ga0265327_10103801 | 3300031251 | Unclassified | 1367 |
| 353 | Ga0265316_10008294 | 3300031344 | Bacteria | 9651 |
| 354 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 355 | Ga0307408_100622058 | 3300031548 | Bacteria | 962 |
| 356 | Ga0265313_10002084 | 3300031595 | Bacteria | 17870 |
| 357 | Ga0265314_10097362 | 3300031711 | Bacteria | 1900 |
| 358 | Ga0265342_10002903 | 3300031712 | Bacteria | 14458 |
| 359 | Ga0307516_10002208 | 3300031730 | Bacteria | 26358 |
| 360 | Ga0307405_10134929 | 3300031731 | Bacteria | 1712 |
| 361 | Ga0307413_10048890 | 3300031824 | Bacteria | 2531 |
| 362 | Ga0307410_10008017 | 3300031852 | Bacteria | 5826 |
| 363 | Ga0307410_10032832 | 3300031852 | Bacteria | 3346 |
| 364 | Ga0307410_10033002 | 3300031852 | Unclassified | 3339 |
| 365 | Ga0307406_10027106 | 3300031901 | Bacteria | 3449 |
| 366 | Ga0307406_10355896 | 3300031901 | Bacteria | 1146 |
| 367 | Ga0307407_10017706 | 3300031903 | Bacteria | 3583 |
| 368 | Ga0307412_10020830 | 3300031911 | Bacteria | 3997 |
| 369 | Ga0307409_100000356 | 3300031995 | Bacteria | 19078 |
| 370 | Ga0307409_100292940 | 3300031995 | Unclassified | 1510 |
| 371 | Ga0307414_10056028 | 3300032004 | Bacteria | 2763 |
| 372 | Ga0307414_10084890 | 3300032004 | Bacteria | 2331 |
| 373 | Ga0307411_10006059 | 3300032005 | Bacteria | 6011 |
| 374 | Ga0307411_10030516 | 3300032005 | Bacteria | 3305 |
| 375 | Ga0307411_10082409 | 3300032005 | Bacteria | 2218 |
| 376 | Ga0307415_100033941 | 3300032126 | Unclassified | 3317 |
| 377 | Ga0307510_10000013 | 3300033180 | Bacteria | 274569 |
| 378 | Ga0373936_0017786 | 3300035113 | Bacteria | 2739 |
| 379 | Ga0373953_0136743 | 3300035117 | Bacteria | 1047 |
| 380 | Ga0373955_0035877 | 3300035172 | Bacteria | 2629 |
| 381 | Ga0373955_0058555 | 3300035172 | Bacteria | 2120 |
| 382 | Ga0373935_0324629 | 3300035692 | Bacteria | 1093 |
| 383 | Ga0373933_0060350 | 3300035724 | Bacteria | 2286 |
| 384 | Ga0373933_0603161 | 3300035724 | Bacteria | 721 |
| 385 | Ga0373937_0005526 | 3300036401 | Bacteria | 10838 |
| 386 | Ga0373937_0043643 | 3300036401 | Bacteria | 4094 |
| 387 | Ga0373925_0054851 | 3300037068 | Bacteria | 2982 |
| 388 | Ga0373925_0224708 | 3300037068 | Bacteria | 1500 |
| 389 | Ga0395900_0813295 | 3300037418 | Unclassified | 862 |
| 390 | Ga0395898_0013420 | 3300037466 | Bacteria | 8439 |
| 391 | Ga0395905_1059260 | 3300037471 | Unclassified | 714 |
| 392 | Ga0436365_0041046 | 3300039437 | Bacteria | 2443 |
| 393 | Ga0436365_0654174 | 3300039437 | Bacteria | 8534 |
| 394 | Ga0436365_1776384 | 3300039437 | Bacteria | 4806 |
| 395 | Ga0436360_0095064 | 3300039438 | Bacteria | 1122 |
| 396 | Ga0436361_0643956 | 3300039447 | Bacteria | 1719 |
| 397 | Ga0436363_0398788 | 3300039450 | Bacteria | 9929 |
| 398 | Ga0436363_0640180 | 3300039450 | Bacteria | 9406 |
| 399 | Ga0436363_0744495 | 3300039450 | Bacteria | 894 |
| 400 | Ga0436363_1588902 | 3300039450 | Bacteria | 2178 |
| 401 | Ga0436362_0756794 | 3300039453 | Bacteria | 1410 |
| 402 | Ga0451577_0026927 | 3300042876 | Bacteria | 5205 |
| 403 | Ga0451577_0028852 | 3300042876 | Bacteria | 5018 |
| 404 | Ga0466969_0002181 | 3300044656 | Bacteria | 10461 |
| 405 | Ga0466969_0004908 | 3300044656 | Bacteria | 7125 |
| 406 | Ga0453683_0074790 | 3300044673 | Bacteria | 2121 |
| 407 | Ga0453683_0129756 | 3300044673 | Bacteria | 1588 |
| 408 | Ga0466966_0015501 | 3300044684 | Bacteria | 5038 |
| 409 | Ga0466961_0000883 | 3300044693 | Bacteria | 18652 |
| 410 | Ga0466961_0042763 | 3300044693 | Bacteria | 2904 |
| 411 | Ga0466964_0001017 | 3300044706 | Bacteria | 9319 |
| 412 | Ga0453684_0142663 | 3300044712 | Bacteria | 2857 |
| 413 | Ga0466971_0015284 | 3300044719 | Bacteria | 3377 |
| 414 | Ga0466970_0001756 | 3300044765 | Bacteria | 10459 |
| 415 | Ga0466957_0000555 | 3300044842 | Bacteria | 18825 |
| 416 | Ga0466959_0000561 | 3300045049 | Bacteria | 21601 |
| 417 | Ga0466959_0012373 | 3300045049 | Bacteria | 6164 |
| 418 | Ga0466959_0052795 | 3300045049 | Bacteria | 2975 |
| 419 | Ga0466959_0074097 | 3300045049 | Bacteria | 2462 |
| 420 | Ga0466958_0129169 | 3300045836 | Bacteria | 1586 |
| 421 | Ga0495580_0013461 | 3300046472 | Bacteria | 6239 |
| 422 | Ga0495580_0028584 | 3300046472 | Bacteria | 4052 |
| 423 | Ga0495582_0354006 | 3300046473 | Bacteria | 846 |
| 424 | Ga0495605_0004939 | 3300046474 | Bacteria | 7791 |
| 425 | Ga0495596_0006299 | 3300046500 | Bacteria | 5485 |
| 426 | Ga0495607_0014138 | 3300046501 | Bacteria | 5208 |
| 427 | Ga0495583_0008086 | 3300046506 | Bacteria | 6484 |
| 428 | Ga0495610_0003749 | 3300046512 | Bacteria | 11632 |
| 429 | Ga0495616_0010536 | 3300046513 | Bacteria | 5347 |
| 430 | Ga0495618_0033195 | 3300046514 | Bacteria | 3236 |
| 431 | Ga0495630_0086457 | 3300046517 | Bacteria | 2368 |
| 432 | Ga0495630_0225345 | 3300046517 | Bacteria | 1431 |
| 433 | Ga0495643_0035857 | 3300046522 | Bacteria | 2729 |
| 434 | Ga0495652_0546507 | 3300046529 | Bacteria | 797 |
| 435 | Ga0495668_0004686 | 3300046616 | Bacteria | 9599 |
| 436 | Ga0495611_0181309 | 3300046648 | Unclassified | 984 |
| 437 | Ga0495661_0024022 | 3300046665 | Bacteria | 3949 |
| 438 | Ga0495623_0359631 | 3300046679 | Bacteria | 791 |
| 439 | Ga0495669_0033086 | 3300046684 | Bacteria | 2275 |
| 440 | Ga0495671_0002656 | 3300046692 | Bacteria | 11224 |
| 441 | Ga0495671_0094010 | 3300046692 | Bacteria | 1467 |
| 442 | Ga0495649_0020169 | 3300046694 | Bacteria | 3740 |
| 443 | Ga0495649_0077675 | 3300046694 | Bacteria | 1777 |
| 444 | Ga0495649_0371357 | 3300046694 | Bacteria | 721 |
| 445 | Ga0495604_0026945 | 3300047317 | Bacteria | 4572 |
| 446 | Ga0495674_0650761 | 3300047319 | Bacteria | 831 |
| 447 | Ga0495672_0026130 | 3300047320 | Bacteria | 3728 |
| 448 | Ga0495687_140187 | 3300047443 | Unclassified | 842 |
| 449 | Ga0495602_0011818 | 3300048088 | Bacteria | 9016 |
| 450 | Ga0496100_0052554 | 3300048903 | Bacteria | 2649 |
| 451 | Ga0496100_0149501 | 3300048903 | Bacteria | 1664 |
| 452 | Ga0496102_0012705 | 3300048905 | Bacteria | 7294 |
| 453 | Ga0496102_0095871 | 3300048905 | Bacteria | 2750 |
| 454 | Ga0496102_0162387 | 3300048905 | Bacteria | 2102 |
| 455 | Ga0496102_0262188 | 3300048905 | Unclassified | 1629 |
| 456 | Ga0496103_0048989 | 3300048906 | Bacteria | 2612 |
| 457 | Ga0496104_0038244 | 3300048907 | Bacteria | 4489 |
| 458 | Ga0496104_0047261 | 3300048907 | Bacteria | 4056 |
| 459 | Ga0496105_0016416 | 3300048908 | Bacteria | 5912 |
| 460 | Ga0496105_0025716 | 3300048908 | Bacteria | 4794 |
| 461 | Ga0496106_0005765 | 3300048909 | Bacteria | 9158 |
| 462 | Ga0496106_0154031 | 3300048909 | Bacteria | 1814 |
| 463 | Ga0496106_0516825 | 3300048909 | Bacteria | 959 |
| 464 | Ga0496107_0016395 | 3300048910 | Bacteria | 5201 |
| 465 | Ga0496108_0031433 | 3300048911 | Bacteria | 4405 |
| 466 | Ga0496109_0043447 | 3300048912 | Bacteria | 4073 |
| 467 | Ga0496109_0267254 | 3300048912 | Unclassified | 1611 |
| 468 | Ga0496110_0119998 | 3300048913 | Bacteria | 2368 |
| 469 | Ga0496111_0138066 | 3300048914 | Bacteria | 1806 |
| 470 | Ga0496112_0048810 | 3300048915 | Bacteria | 4148 |
| 471 | Ga0496112_0574636 | 3300048915 | Unclassified | 1060 |
| 472 | Ga0496114_0067118 | 3300048917 | Bacteria | 3008 |
| 473 | Ga0496115_0019186 | 3300048918 | Bacteria | 5260 |
| 474 | Ga0496115_0216419 | 3300048918 | Bacteria | 1581 |
| 475 | Ga0496116_0008195 | 3300048919 | Bacteria | 9113 |
| 476 | Ga0496116_0098775 | 3300048919 | Unclassified | 1751 |
| 477 | Ga0496117_0001448 | 3300048920 | Bacteria | 34207 |
| 478 | Ga0496118_0000028 | 3300048921 | Bacteria | 366490 |
| 479 | Ga0496119_0006996 | 3300048922 | Bacteria | 10276 |
| 480 | Ga0496119_0014332 | 3300048922 | Bacteria | 6215 |
| 481 | Ga0496119_0043873 | 3300048922 | Bacteria | 2821 |
| 482 | Ga0496120_0000930 | 3300048923 | Bacteria | 40517 |
| 483 | Ga0496120_0009373 | 3300048923 | Bacteria | 6956 |
| 484 | Ga0496120_0022795 | 3300048923 | Bacteria | 3934 |
| 485 | Ga0496121_0000808 | 3300048924 | Bacteria | 57011 |
| 486 | Ga0496121_0057967 | 3300048924 | Bacteria | 3206 |
| 487 | Ga0496121_0086434 | 3300048924 | Bacteria | 2464 |
| 488 | Ga0496122_0005665 | 3300048925 | Bacteria | 14746 |
| 489 | Ga0496123_0006518 | 3300048926 | Bacteria | 11284 |
| 490 | Ga0496124_0181785 | 3300048927 | Unclassified | 1617 |
| 491 | Ga0496125_0000936 | 3300048928 | Bacteria | 45858 |
| 492 | Ga0496125_0003776 | 3300048928 | Bacteria | 18018 |
| 493 | Ga0496125_0004532 | 3300048928 | Bacteria | 15960 |
| 494 | Ga0496125_0108056 | 3300048928 | Bacteria | 2025 |
| 495 | Ga0496126_0005881 | 3300048929 | Bacteria | 13833 |
| 496 | Ga0496126_0025325 | 3300048929 | Bacteria | 5710 |
| 497 | Ga0496126_0216523 | 3300048929 | Bacteria | 1611 |
| 498 | Ga0496126_0234813 | 3300048929 | Bacteria | 1535 |
| 499 | Ga0496126_0350528 | 3300048929 | Bacteria | 1207 |
| 500 | Ga0501072_0250521 | 3300049588 | Unclassified | 1410 |
| 501 | nmdc:mga0n895_335419_c1 | 3300050512 | Bacteria | 1532 |
| 502 | nmdc:mga08x19_150260_c1 | 3300050514 | Bacteria | 1577 |
| 503 | Ga0495612_0144924 | 3300053078 | Bacteria | 1032 |
| 504 | Ga0500556_0000540 | 3300053104 | Bacteria | 25527 |
| 505 | Ga0500558_151348 | 3300053106 | Bacteria | 861 |
| 506 | Ga0500618_001110 | 3300053125 | Bacteria | 13191 |
| 507 | Ga0500559_0051111 | 3300053136 | Bacteria | 1825 |
| 508 | Ga0500559_0272247 | 3300053136 | Bacteria | 797 |
| 509 | Ga0500624_039535 | 3300053157 | Bacteria | 843 |
| 510 | Ga0500639_090697 | 3300053163 | Bacteria | 1523 |
| 511 | Ga0500637_0013264 | 3300053178 | Bacteria | 4317 |
| 512 | Ga0500637_0056244 | 3300053178 | Bacteria | 2248 |
| 513 | Ga0500637_0160481 | 3300053178 | Bacteria | 1296 |
| 514 | Ga0500637_0270166 | 3300053178 | Unclassified | 940 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100033604 | Ga0070670_1000336042 | 208 |
| 2 | 3300005354 | Ga0070675_100289231 | Ga0070675_1002892311 | 208 |
| 3 | 3300005466 | Ga0070685_10078657 | Ga0070685_100786572 | 208 |
| 4 | 3300005618 | Ga0068864_100079163 | Ga0068864_1000791632 | 208 |
| 5 | 3300005719 | Ga0068861_100430065 | Ga0068861_1004300651 | 208 |
| 6 | 3300005841 | Ga0068863_100086151 | Ga0068863_1000861513 | 208 |
| 7 | 3300014325 | Ga0163163_10249199 | Ga0163163_102491992 | 208 |
| 8 | 3300035724 | Ga0373933_0603161 | Ga0373933_0603161_20_646 | 208 |
| 9 | 3300026095 | Ga0207676_10037279 | Ga0207676_100372793 | 209 |
| 10 | 3300009093 | Ga0105240_10060987 | Ga0105240_100609874 | 213 |
| 11 | 3300048915 | Ga0496112_0574636 | Ga0496112_0574636_310_1047 | 213 |
| 12 | 3300046694 | Ga0495649_0371357 | Ga0495649_0371357_10_660 | 214 |
| 13 | 3300009011 | Ga0105251_10007536 | Ga0105251_100075363 | 220 |
| 14 | 3300025916 | Ga0207663_10036946 | Ga0207663_100369462 | 220 |
| 15 | 3300044693 | Ga0466961_0042763 | Ga0466961_0042763_2152_2853 | 220 |
| 16 | 3300045049 | Ga0466959_0012373 | Ga0466959_0012373_3333_4034 | 220 |
| 17 | 3300048929 | Ga0496126_0216523 | Ga0496126_0216523_747_1409 | 220 |
| 18 | 3300005327 | Ga0070658_10000547 | Ga0070658_1000054718 | 221 |
| 19 | 3300005331 | Ga0070670_100308222 | Ga0070670_1003082222 | 221 |
| 20 | 3300005339 | Ga0070660_100232638 | Ga0070660_1002326382 | 221 |
| 21 | 3300005344 | Ga0070661_100021618 | Ga0070661_1000216183 | 221 |
| 22 | 3300005457 | Ga0070662_100116405 | Ga0070662_1001164052 | 221 |
| 23 | 3300005458 | Ga0070681_10120157 | Ga0070681_101201572 | 221 |
| 24 | 3300005458 | Ga0070681_10410151 | Ga0070681_104101512 | 221 |
| 25 | 3300005539 | Ga0068853_100002295 | Ga0068853_1000022953 | 221 |
| 26 | 3300005539 | Ga0068853_100077837 | Ga0068853_1000778372 | 221 |
| 27 | 3300005564 | Ga0070664_100002024 | Ga0070664_1000020245 | 221 |
| 28 | 3300005564 | Ga0070664_100013450 | Ga0070664_1000134506 | 221 |
| 29 | 3300005577 | Ga0068857_100034436 | Ga0068857_1000344366 | 221 |
| 30 | 3300005577 | Ga0068857_100321171 | Ga0068857_1003211712 | 221 |
| 31 | 3300013104 | Ga0157370_10169615 | Ga0157370_101696153 | 221 |
| 32 | 3300013105 | Ga0157369_10402517 | Ga0157369_104025171 | 221 |
| 33 | 3300013296 | Ga0157374_10143663 | Ga0157374_101436632 | 221 |
| 34 | 3300013306 | Ga0163162_10229947 | Ga0163162_102299472 | 221 |
| 35 | 3300014745 | Ga0157377_10210600 | Ga0157377_102106002 | 221 |
| 36 | 3300025909 | Ga0207705_10003787 | Ga0207705_100037873 | 221 |
| 37 | 3300025931 | Ga0207644_10480932 | Ga0207644_104809322 | 221 |
| 38 | 3300025932 | Ga0207690_10081363 | Ga0207690_100813632 | 221 |
| 39 | 3300025933 | Ga0207706_10231017 | Ga0207706_102310171 | 221 |
| 40 | 3300025944 | Ga0207661_10203090 | Ga0207661_102030902 | 221 |
| 41 | 3300025945 | Ga0207679_10015619 | Ga0207679_100156192 | 221 |
| 42 | 3300025945 | Ga0207679_10151861 | Ga0207679_101518613 | 221 |
| 43 | 3300026041 | Ga0207639_10120224 | Ga0207639_101202242 | 221 |
| 44 | 3300026116 | Ga0207674_10017178 | Ga0207674_100171784 | 221 |
| 45 | 3300026116 | Ga0207674_10288644 | Ga0207674_102886442 | 221 |
| 46 | 3300031901 | Ga0307406_10355896 | Ga0307406_103558962 | 221 |
| 47 | 3300037471 | Ga0395905_1059260 | Ga0395905_1059260_22_687 | 221 |
| 48 | 3300031247 | Ga0265340_10018843 | Ga0265340_100188434 | 222 |
| 49 | 3300031852 | Ga0307410_10033002 | Ga0307410_100330022 | 222 |
| 50 | 3300032005 | Ga0307411_10006059 | Ga0307411_100060597 | 222 |
| 51 | 3300032126 | Ga0307415_100033941 | Ga0307415_1000339412 | 222 |
| 52 | 3300035117 | Ga0373953_0136743 | Ga0373953_0136743_289_981 | 222 |
| 53 | 3300005336 | Ga0070680_100016607 | Ga0070680_1000166072 | 223 |
| 54 | 3300005458 | Ga0070681_10119294 | Ga0070681_101192944 | 223 |
| 55 | 3300025912 | Ga0207707_10101983 | Ga0207707_101019834 | 223 |
| 56 | 3300025917 | Ga0207660_10095700 | Ga0207660_100957002 | 223 |
| 57 | 3300025944 | Ga0207661_10103487 | Ga0207661_101034872 | 223 |
| 58 | 3300048905 | Ga0496102_0095871 | Ga0496102_0095871_1935_2627 | 225 |
| 59 | 3300044712 | Ga0453684_0142663 | Ga0453684_0142663_1506_2189 | 227 |
| 60 | 3300005336 | Ga0070680_100005294 | Ga0070680_1000052947 | 229 |
| 61 | 3300005337 | Ga0070682_100100571 | Ga0070682_1001005712 | 229 |
| 62 | 3300005458 | Ga0070681_10017608 | Ga0070681_100176083 | 229 |
| 63 | 3300005458 | Ga0070681_10154498 | Ga0070681_101544982 | 229 |
| 64 | 3300005530 | Ga0070679_100004670 | Ga0070679_10000467010 | 229 |
| 65 | 3300005530 | Ga0070679_100011264 | Ga0070679_1000112643 | 229 |
| 66 | 3300005539 | Ga0068853_100197453 | Ga0068853_1001974532 | 229 |
| 67 | 3300005563 | Ga0068855_100004608 | Ga0068855_1000046088 | 229 |
| 68 | 3300009545 | Ga0105237_10237202 | Ga0105237_102372022 | 229 |
| 69 | 3300009551 | Ga0105238_10001369 | Ga0105238_1000136926 | 229 |
| 70 | 3300009551 | Ga0105238_10074591 | Ga0105238_100745913 | 229 |
| 71 | 3300010375 | Ga0105239_11093170 | Ga0105239_110931702 | 229 |
| 72 | 3300013104 | Ga0157370_10001792 | Ga0157370_100017926 | 229 |
| 73 | 3300013105 | Ga0157369_10008374 | Ga0157369_100083741 | 229 |
| 74 | 3300013105 | Ga0157369_10248168 | Ga0157369_102481682 | 229 |
| 75 | 3300025912 | Ga0207707_10000411 | Ga0207707_100004118 | 229 |
| 76 | 3300025912 | Ga0207707_10009225 | Ga0207707_100092259 | 229 |
| 77 | 3300025912 | Ga0207707_10508912 | Ga0207707_105089121 | 229 |
| 78 | 3300025913 | Ga0207695_10007491 | Ga0207695_100074918 | 229 |
| 79 | 3300025914 | Ga0207671_10311797 | Ga0207671_103117972 | 229 |
| 80 | 3300025917 | Ga0207660_10005790 | Ga0207660_100057905 | 229 |
| 81 | 3300025921 | Ga0207652_10005406 | Ga0207652_100054066 | 229 |
| 82 | 3300025921 | Ga0207652_10034482 | Ga0207652_100344823 | 229 |
| 83 | 3300025921 | Ga0207652_10040082 | Ga0207652_100400824 | 229 |
| 84 | 3300025924 | Ga0207694_10019306 | Ga0207694_100193062 | 229 |
| 85 | 3300025924 | Ga0207694_10511297 | Ga0207694_105112971 | 229 |
| 86 | 3300025949 | Ga0207667_10012498 | Ga0207667_100124985 | 229 |
| 87 | 3300031247 | Ga0265340_10001829 | Ga0265340_1000182911 | 229 |
| 88 | 3300031249 | Ga0265339_10118631 | Ga0265339_101186312 | 229 |
| 89 | 3300003323 | rootH1_10318854 | rootH1_103188542 | 230 |
| 90 | 3300005295 | Ga0065707_10083043 | Ga0065707_100830436 | 230 |
| 91 | 3300005330 | Ga0070690_100039753 | Ga0070690_1000397533 | 230 |
| 92 | 3300005335 | Ga0070666_10010472 | Ga0070666_100104724 | 230 |
| 93 | 3300005335 | Ga0070666_10028306 | Ga0070666_100283063 | 230 |
| 94 | 3300005338 | Ga0068868_100003004 | Ga0068868_1000030042 | 230 |
| 95 | 3300005355 | Ga0070671_100000199 | Ga0070671_10000019917 | 230 |
| 96 | 3300005355 | Ga0070671_100010893 | Ga0070671_1000108933 | 230 |
| 97 | 3300005355 | Ga0070671_100533157 | Ga0070671_1005331571 | 230 |
| 98 | 3300005364 | Ga0070673_100161018 | Ga0070673_1001610182 | 230 |
| 99 | 3300005367 | Ga0070667_100000069 | Ga0070667_10000006985 | 230 |
| 100 | 3300005367 | Ga0070667_100004680 | Ga0070667_10000468010 | 230 |
| 101 | 3300005367 | Ga0070667_100012032 | Ga0070667_1000120322 | 230 |
| 102 | 3300005367 | Ga0070667_100313066 | Ga0070667_1003130661 | 230 |
| 103 | 3300005434 | Ga0070709_10000986 | Ga0070709_1000098610 | 230 |
| 104 | 3300005434 | Ga0070709_10101605 | Ga0070709_101016051 | 230 |
| 105 | 3300005434 | Ga0070709_10189511 | Ga0070709_101895113 | 230 |
| 106 | 3300005435 | Ga0070714_100005208 | Ga0070714_1000052083 | 230 |
| 107 | 3300005435 | Ga0070714_100216354 | Ga0070714_1002163542 | 230 |
| 108 | 3300005435 | Ga0070714_100235041 | Ga0070714_1002350412 | 230 |
| 109 | 3300005436 | Ga0070713_100002662 | Ga0070713_1000026627 | 230 |
| 110 | 3300005436 | Ga0070713_100029679 | Ga0070713_1000296792 | 230 |
| 111 | 3300005436 | Ga0070713_100481725 | Ga0070713_1004817252 | 230 |
| 112 | 3300005437 | Ga0070710_10012975 | Ga0070710_100129754 | 230 |
| 113 | 3300005437 | Ga0070710_10451029 | Ga0070710_104510291 | 230 |
| 114 | 3300005439 | Ga0070711_100000649 | Ga0070711_10000064911 | 230 |
| 115 | 3300005439 | Ga0070711_100124324 | Ga0070711_1001243242 | 230 |
| 116 | 3300005440 | Ga0070705_100403395 | Ga0070705_1004033951 | 230 |
| 117 | 3300005456 | Ga0070678_100051360 | Ga0070678_1000513603 | 230 |
| 118 | 3300005458 | Ga0070681_10016827 | Ga0070681_100168272 | 230 |
| 119 | 3300005458 | Ga0070681_10066376 | Ga0070681_100663761 | 230 |
| 120 | 3300005530 | Ga0070679_100181141 | Ga0070679_1001811413 | 230 |
| 121 | 3300005530 | Ga0070679_100295438 | Ga0070679_1002954382 | 230 |
| 122 | 3300005539 | Ga0068853_100359937 | Ga0068853_1003599372 | 230 |
| 123 | 3300005544 | Ga0070686_100109309 | Ga0070686_1001093092 | 230 |
| 124 | 3300005545 | Ga0070695_100030241 | Ga0070695_1000302412 | 230 |
| 125 | 3300005547 | Ga0070693_100599201 | Ga0070693_1005992011 | 230 |
| 126 | 3300005548 | Ga0070665_100012162 | Ga0070665_1000121625 | 230 |
| 127 | 3300005548 | Ga0070665_100138108 | Ga0070665_1001381082 | 230 |
| 128 | 3300005548 | Ga0070665_100238596 | Ga0070665_1002385962 | 230 |
| 129 | 3300005548 | Ga0070665_100596548 | Ga0070665_1005965482 | 230 |
| 130 | 3300005563 | Ga0068855_100000592 | Ga0068855_10000059210 | 230 |
| 131 | 3300005563 | Ga0068855_100301393 | Ga0068855_1003013933 | 230 |
| 132 | 3300005578 | Ga0068854_100105587 | Ga0068854_1001055872 | 230 |
| 133 | 3300005614 | Ga0068856_100046028 | Ga0068856_1000460282 | 230 |
| 134 | 3300005616 | Ga0068852_100341005 | Ga0068852_1003410052 | 230 |
| 135 | 3300005617 | Ga0068859_100002486 | Ga0068859_10000248610 | 230 |
| 136 | 3300005617 | Ga0068859_100063169 | Ga0068859_1000631692 | 230 |
| 137 | 3300005617 | Ga0068859_100072520 | Ga0068859_1000725205 | 230 |
| 138 | 3300005718 | Ga0068866_10007506 | Ga0068866_100075064 | 230 |
| 139 | 3300005834 | Ga0068851_10360481 | Ga0068851_103604811 | 230 |
| 140 | 3300005841 | Ga0068863_100016434 | Ga0068863_1000164342 | 230 |
| 141 | 3300005841 | Ga0068863_100081510 | Ga0068863_1000815102 | 230 |
| 142 | 3300005841 | Ga0068863_100865186 | Ga0068863_1008651861 | 230 |
| 143 | 3300005842 | Ga0068858_100000285 | Ga0068858_1000002856 | 230 |
| 144 | 3300005842 | Ga0068858_100005143 | Ga0068858_10000514312 | 230 |
| 145 | 3300005842 | Ga0068858_100012491 | Ga0068858_1000124913 | 230 |
| 146 | 3300005843 | Ga0068860_100001390 | Ga0068860_10000139016 | 230 |
| 147 | 3300005843 | Ga0068860_100005786 | Ga0068860_1000057864 | 230 |
| 148 | 3300005843 | Ga0068860_100012863 | Ga0068860_1000128636 | 230 |
| 149 | 3300005844 | Ga0068862_100033959 | Ga0068862_1000339593 | 230 |
| 150 | 3300005844 | Ga0068862_100152003 | Ga0068862_1001520032 | 230 |
| 151 | 3300005844 | Ga0068862_100788189 | Ga0068862_1007881892 | 230 |
| 152 | 3300006163 | Ga0070715_10000239 | Ga0070715_100002396 | 230 |
| 153 | 3300006173 | Ga0070716_100014146 | Ga0070716_1000141463 | 230 |
| 154 | 3300006173 | Ga0070716_100015412 | Ga0070716_1000154123 | 230 |
| 155 | 3300006173 | Ga0070716_100129708 | Ga0070716_1001297082 | 230 |
| 156 | 3300006175 | Ga0070712_100000751 | Ga0070712_1000007513 | 230 |
| 157 | 3300006175 | Ga0070712_100054077 | Ga0070712_1000540773 | 230 |
| 158 | 3300006871 | Ga0075434_100207272 | Ga0075434_1002072722 | 230 |
| 159 | 3300006881 | Ga0068865_100033036 | Ga0068865_1000330363 | 230 |
| 160 | 3300006931 | Ga0097620_100002486 | Ga0097620_10000248610 | 230 |
| 161 | 3300006931 | Ga0097620_100063167 | Ga0097620_1000631672 | 230 |
| 162 | 3300006931 | Ga0097620_100072519 | Ga0097620_1000725193 | 230 |
| 163 | 3300009092 | Ga0105250_10154128 | Ga0105250_101541281 | 230 |
| 164 | 3300009093 | Ga0105240_10024226 | Ga0105240_100242266 | 230 |
| 165 | 3300009093 | Ga0105240_10044583 | Ga0105240_100445835 | 230 |
| 166 | 3300009093 | Ga0105240_10049421 | Ga0105240_100494213 | 230 |
| 167 | 3300009093 | Ga0105240_10085366 | Ga0105240_100853664 | 230 |
| 168 | 3300009093 | Ga0105240_10286210 | Ga0105240_102862102 | 230 |
| 169 | 3300009093 | Ga0105240_11000919 | Ga0105240_110009192 | 230 |
| 170 | 3300009098 | Ga0105245_10017497 | Ga0105245_100174972 | 230 |
| 171 | 3300009101 | Ga0105247_10000072 | Ga0105247_1000007221 | 230 |
| 172 | 3300009101 | Ga0105247_10010957 | Ga0105247_100109576 | 230 |
| 173 | 3300009101 | Ga0105247_10072899 | Ga0105247_100728992 | 230 |
| 174 | 3300009101 | Ga0105247_10167367 | Ga0105247_101673672 | 230 |
| 175 | 3300009174 | Ga0105241_10004905 | Ga0105241_100049055 | 230 |
| 176 | 3300009176 | Ga0105242_10001357 | Ga0105242_1000135717 | 230 |
| 177 | 3300009177 | Ga0105248_10024681 | Ga0105248_100246813 | 230 |
| 178 | 3300009177 | Ga0105248_10156395 | Ga0105248_101563953 | 230 |
| 179 | 3300009545 | Ga0105237_10041800 | Ga0105237_100418004 | 230 |
| 180 | 3300009545 | Ga0105237_10160215 | Ga0105237_101602153 | 230 |
| 181 | 3300009545 | Ga0105237_10165993 | Ga0105237_101659932 | 230 |
| 182 | 3300009545 | Ga0105237_10214698 | Ga0105237_102146982 | 230 |
| 183 | 3300009551 | Ga0105238_10121155 | Ga0105238_101211552 | 230 |
| 184 | 3300009551 | Ga0105238_10556983 | Ga0105238_105569832 | 230 |
| 185 | 3300009553 | Ga0105249_10123348 | Ga0105249_101233482 | 230 |
| 186 | 3300009553 | Ga0105249_10127726 | Ga0105249_101277263 | 230 |
| 187 | 3300009553 | Ga0105249_10355709 | Ga0105249_103557092 | 230 |
| 188 | 3300009553 | Ga0105249_10598732 | Ga0105249_105987322 | 230 |
| 189 | 3300010159 | Ga0099796_10008949 | Ga0099796_100089492 | 230 |
| 190 | 3300010375 | Ga0105239_10108339 | Ga0105239_101083392 | 230 |
| 191 | 3300010375 | Ga0105239_10119087 | Ga0105239_101190872 | 230 |
| 192 | 3300010375 | Ga0105239_10213673 | Ga0105239_102136732 | 230 |
| 193 | 3300011119 | Ga0105246_10124287 | Ga0105246_101242872 | 230 |
| 194 | 3300013105 | Ga0157369_10020588 | Ga0157369_100205884 | 230 |
| 195 | 3300013105 | Ga0157369_10911709 | Ga0157369_109117092 | 230 |
| 196 | 3300013296 | Ga0157374_10024555 | Ga0157374_100245556 | 230 |
| 197 | 3300013297 | Ga0157378_10014547 | Ga0157378_100145474 | 230 |
| 198 | 3300013306 | Ga0163162_10080654 | Ga0163162_100806543 | 230 |
| 199 | 3300013306 | Ga0163162_10151550 | Ga0163162_101515502 | 230 |
| 200 | 3300013308 | Ga0157375_10096475 | Ga0157375_100964753 | 230 |
| 201 | 3300014325 | Ga0163163_10043200 | Ga0163163_100432002 | 230 |
| 202 | 3300014325 | Ga0163163_10080037 | Ga0163163_100800372 | 230 |
| 203 | 3300014325 | Ga0163163_10251471 | Ga0163163_102514712 | 230 |
| 204 | 3300014325 | Ga0163163_10872868 | Ga0163163_108728682 | 230 |
| 205 | 3300014968 | Ga0157379_10002427 | Ga0157379_100024273 | 230 |
| 206 | 3300014968 | Ga0157379_10157471 | Ga0157379_101574712 | 230 |
| 207 | 3300014968 | Ga0157379_10283657 | Ga0157379_102836572 | 230 |
| 208 | 3300014969 | Ga0157376_10534142 | Ga0157376_105341422 | 230 |
| 209 | 3300021358 | Ga0213873_10027418 | Ga0213873_100274182 | 230 |
| 210 | 3300021377 | Ga0213874_10007878 | Ga0213874_100078783 | 230 |
| 211 | 3300021384 | Ga0213876_10093751 | Ga0213876_100937512 | 230 |
| 212 | 3300021384 | Ga0213876_10110787 | Ga0213876_101107872 | 230 |
| 213 | 3300025321 | Ga0207656_10062917 | Ga0207656_100629172 | 230 |
| 214 | 3300025898 | Ga0207692_10061923 | Ga0207692_100619232 | 230 |
| 215 | 3300025899 | Ga0207642_10005524 | Ga0207642_100055242 | 230 |
| 216 | 3300025900 | Ga0207710_10000238 | Ga0207710_1000023827 | 230 |
| 217 | 3300025900 | Ga0207710_10011690 | Ga0207710_100116906 | 230 |
| 218 | 3300025903 | Ga0207680_10015552 | Ga0207680_100155523 | 230 |
| 219 | 3300025903 | Ga0207680_10018594 | Ga0207680_100185943 | 230 |
| 220 | 3300025903 | Ga0207680_10060528 | Ga0207680_100605282 | 230 |
| 221 | 3300025906 | Ga0207699_10002835 | Ga0207699_100028353 | 230 |
| 222 | 3300025906 | Ga0207699_10052276 | Ga0207699_100522762 | 230 |
| 223 | 3300025911 | Ga0207654_10323801 | Ga0207654_103238012 | 230 |
| 224 | 3300025912 | Ga0207707_10037473 | Ga0207707_100374735 | 230 |
| 225 | 3300025913 | Ga0207695_10043261 | Ga0207695_100432612 | 230 |
| 226 | 3300025913 | Ga0207695_10044022 | Ga0207695_100440222 | 230 |
| 227 | 3300025913 | Ga0207695_10047312 | Ga0207695_100473125 | 230 |
| 228 | 3300025913 | Ga0207695_10091540 | Ga0207695_100915403 | 230 |
| 229 | 3300025913 | Ga0207695_10238573 | Ga0207695_102385732 | 230 |
| 230 | 3300025913 | Ga0207695_10395213 | Ga0207695_103952131 | 230 |
| 231 | 3300025913 | Ga0207695_10524458 | Ga0207695_105244582 | 230 |
| 232 | 3300025914 | Ga0207671_10073699 | Ga0207671_100736992 | 230 |
| 233 | 3300025915 | Ga0207693_10000161 | Ga0207693_1000016127 | 230 |
| 234 | 3300025915 | Ga0207693_10038794 | Ga0207693_100387942 | 230 |
| 235 | 3300025916 | Ga0207663_10015294 | Ga0207663_100152943 | 230 |
| 236 | 3300025916 | Ga0207663_10173553 | Ga0207663_101735532 | 230 |
| 237 | 3300025921 | Ga0207652_10151656 | Ga0207652_101516563 | 230 |
| 238 | 3300025924 | Ga0207694_10016981 | Ga0207694_100169812 | 230 |
| 239 | 3300025924 | Ga0207694_10081266 | Ga0207694_100812662 | 230 |
| 240 | 3300025924 | Ga0207694_10209384 | Ga0207694_102093842 | 230 |
| 241 | 3300025924 | Ga0207694_10502874 | Ga0207694_105028742 | 230 |
| 242 | 3300025927 | Ga0207687_10056552 | Ga0207687_100565522 | 230 |
| 243 | 3300025928 | Ga0207700_10010500 | Ga0207700_100105001 | 230 |
| 244 | 3300025928 | Ga0207700_10011997 | Ga0207700_100119973 | 230 |
| 245 | 3300025928 | Ga0207700_10184670 | Ga0207700_101846702 | 230 |
| 246 | 3300025929 | Ga0207664_10185910 | Ga0207664_101859102 | 230 |
| 247 | 3300025931 | Ga0207644_10004142 | Ga0207644_100041423 | 230 |
| 248 | 3300025931 | Ga0207644_10302045 | Ga0207644_103020452 | 230 |
| 249 | 3300025934 | Ga0207686_10012371 | Ga0207686_100123712 | 230 |
| 250 | 3300025938 | Ga0207704_10117860 | Ga0207704_101178602 | 230 |
| 251 | 3300025939 | Ga0207665_10013204 | Ga0207665_100132044 | 230 |
| 252 | 3300025939 | Ga0207665_10015339 | Ga0207665_100153395 | 230 |
| 253 | 3300025941 | Ga0207711_10058578 | Ga0207711_100585782 | 230 |
| 254 | 3300025941 | Ga0207711_10071438 | Ga0207711_100714382 | 230 |
| 255 | 3300025949 | Ga0207667_10045762 | Ga0207667_100457624 | 230 |
| 256 | 3300025949 | Ga0207667_10184786 | Ga0207667_101847863 | 230 |
| 257 | 3300025949 | Ga0207667_10604637 | Ga0207667_106046372 | 230 |
| 258 | 3300025960 | Ga0207651_10333301 | Ga0207651_103333012 | 230 |
| 259 | 3300025961 | Ga0207712_10110678 | Ga0207712_101106782 | 230 |
| 260 | 3300025986 | Ga0207658_10000038 | Ga0207658_10000038103 | 230 |
| 261 | 3300025986 | Ga0207658_10073432 | Ga0207658_100734322 | 230 |
| 262 | 3300025986 | Ga0207658_10130178 | Ga0207658_101301781 | 230 |
| 263 | 3300026023 | Ga0207677_10139594 | Ga0207677_101395942 | 230 |
| 264 | 3300026035 | Ga0207703_10000605 | Ga0207703_1000060527 | 230 |
| 265 | 3300026035 | Ga0207703_10000754 | Ga0207703_100007545 | 230 |
| 266 | 3300026041 | Ga0207639_10264184 | Ga0207639_102641842 | 230 |
| 267 | 3300026041 | Ga0207639_10460345 | Ga0207639_104603452 | 230 |
| 268 | 3300026067 | Ga0207678_10627293 | Ga0207678_106272932 | 230 |
| 269 | 3300026078 | Ga0207702_10094289 | Ga0207702_100942893 | 230 |
| 270 | 3300026078 | Ga0207702_10187066 | Ga0207702_101870662 | 230 |
| 271 | 3300026088 | Ga0207641_10000083 | Ga0207641_1000008372 | 230 |
| 272 | 3300026088 | Ga0207641_10007436 | Ga0207641_100074363 | 230 |
| 273 | 3300026088 | Ga0207641_10113790 | Ga0207641_101137903 | 230 |
| 274 | 3300026118 | Ga0207675_100211102 | Ga0207675_1002111022 | 230 |
| 275 | 3300026121 | Ga0207683_10002925 | Ga0207683_100029258 | 230 |
| 276 | 3300028379 | Ga0268266_10108106 | Ga0268266_101081062 | 230 |
| 277 | 3300028379 | Ga0268266_10172365 | Ga0268266_101723653 | 230 |
| 278 | 3300028380 | Ga0268265_10036855 | Ga0268265_100368553 | 230 |
| 279 | 3300028381 | Ga0268264_10000122 | Ga0268264_10000122170 | 230 |
| 280 | 3300028381 | Ga0268264_10073145 | Ga0268264_100731453 | 230 |
| 281 | 3300030521 | Ga0307511_10000519 | Ga0307511_1000051921 | 230 |
| 282 | 3300030521 | Ga0307511_10031086 | Ga0307511_100310862 | 230 |
| 283 | 3300031507 | Ga0307509_10000001 | Ga0307509_10000001111 | 230 |
| 284 | 3300033180 | Ga0307510_10000013 | Ga0307510_1000001358 | 230 |
| 285 | 3300035113 | Ga0373936_0017786 | Ga0373936_0017786_39_731 | 230 |
| 286 | 3300035172 | Ga0373955_0035877 | Ga0373955_0035877_1113_1805 | 230 |
| 287 | 3300035172 | Ga0373955_0058555 | Ga0373955_0058555_615_1307 | 230 |
| 288 | 3300035692 | Ga0373935_0324629 | Ga0373935_0324629_221_913 | 230 |
| 289 | 3300035724 | Ga0373933_0060350 | Ga0373933_0060350_493_1185 | 230 |
| 290 | 3300036401 | Ga0373937_0005526 | Ga0373937_0005526_1806_2498 | 230 |
| 291 | 3300036401 | Ga0373937_0043643 | Ga0373937_0043643_2408_3100 | 230 |
| 292 | 3300037068 | Ga0373925_0054851 | Ga0373925_0054851_198_890 | 230 |
| 293 | 3300037466 | Ga0395898_0013420 | Ga0395898_0013420_2000_2749 | 230 |
| 294 | 3300039437 | Ga0436365_0041046 | Ga0436365_0041046_425_1138 | 230 |
| 295 | 3300039437 | Ga0436365_0654174 | Ga0436365_0654174_7027_7719 | 230 |
| 296 | 3300039437 | Ga0436365_1776384 | Ga0436365_1776384_3974_4684 | 230 |
| 297 | 3300039438 | Ga0436360_0095064 | Ga0436360_0095064_313_1044 | 230 |
| 298 | 3300039447 | Ga0436361_0643956 | Ga0436361_0643956_129_860 | 230 |
| 299 | 3300039450 | Ga0436363_0398788 | Ga0436363_0398788_1800_2513 | 230 |
| 300 | 3300039450 | Ga0436363_0640180 | Ga0436363_0640180_3105_3836 | 230 |
| 301 | 3300039450 | Ga0436363_1588902 | Ga0436363_1588902_693_1385 | 230 |
| 302 | 3300039453 | Ga0436362_0756794 | Ga0436362_0756794_631_1341 | 230 |
| 303 | 3300042876 | Ga0451577_0026927 | Ga0451577_0026927_2684_3409 | 230 |
| 304 | 3300044656 | Ga0466969_0002181 | Ga0466969_0002181_6268_6960 | 230 |
| 305 | 3300044656 | Ga0466969_0004908 | Ga0466969_0004908_5302_5994 | 230 |
| 306 | 3300044684 | Ga0466966_0015501 | Ga0466966_0015501_2520_3212 | 230 |
| 307 | 3300044693 | Ga0466961_0000883 | Ga0466961_0000883_2891_3583 | 230 |
| 308 | 3300044706 | Ga0466964_0001017 | Ga0466964_0001017_6691_7383 | 230 |
| 309 | 3300044719 | Ga0466971_0015284 | Ga0466971_0015284_90_782 | 230 |
| 310 | 3300044765 | Ga0466970_0001756 | Ga0466970_0001756_5303_5995 | 230 |
| 311 | 3300044842 | Ga0466957_0000555 | Ga0466957_0000555_11608_12300 | 230 |
| 312 | 3300045049 | Ga0466959_0000561 | Ga0466959_0000561_5430_6122 | 230 |
| 313 | 3300045049 | Ga0466959_0052795 | Ga0466959_0052795_1382_2074 | 230 |
| 314 | 3300045049 | Ga0466959_0074097 | Ga0466959_0074097_1598_2332 | 230 |
| 315 | 3300045836 | Ga0466958_0129169 | Ga0466958_0129169_664_1356 | 230 |
| 316 | 3300046472 | Ga0495580_0013461 | Ga0495580_0013461_2809_3525 | 230 |
| 317 | 3300046472 | Ga0495580_0028584 | Ga0495580_0028584_2207_2899 | 230 |
| 318 | 3300046506 | Ga0495583_0008086 | Ga0495583_0008086_4733_5428 | 230 |
| 319 | 3300046514 | Ga0495618_0033195 | Ga0495618_0033195_2498_3190 | 230 |
| 320 | 3300046517 | Ga0495630_0225345 | Ga0495630_0225345_621_1313 | 230 |
| 321 | 3300046648 | Ga0495611_0181309 | Ga0495611_0181309_74_766 | 230 |
| 322 | 3300046679 | Ga0495623_0359631 | Ga0495623_0359631_40_732 | 230 |
| 323 | 3300046692 | Ga0495671_0094010 | Ga0495671_0094010_249_944 | 230 |
| 324 | 3300046694 | Ga0495649_0077675 | Ga0495649_0077675_16_708 | 230 |
| 325 | 3300047443 | Ga0495687_140187 | Ga0495687_140187_40_732 | 230 |
| 326 | 3300048088 | Ga0495602_0011818 | Ga0495602_0011818_44_736 | 230 |
| 327 | 3300048903 | Ga0496100_0052554 | Ga0496100_0052554_1417_2109 | 230 |
| 328 | 3300048903 | Ga0496100_0149501 | Ga0496100_0149501_782_1474 | 230 |
| 329 | 3300048905 | Ga0496102_0012705 | Ga0496102_0012705_5945_6637 | 230 |
| 330 | 3300048905 | Ga0496102_0162387 | Ga0496102_0162387_989_1720 | 230 |
| 331 | 3300048905 | Ga0496102_0262188 | Ga0496102_0262188_178_870 | 230 |
| 332 | 3300048906 | Ga0496103_0048989 | Ga0496103_0048989_412_1104 | 230 |
| 333 | 3300048907 | Ga0496104_0047261 | Ga0496104_0047261_2098_2790 | 230 |
| 334 | 3300048908 | Ga0496105_0025716 | Ga0496105_0025716_3572_4264 | 230 |
| 335 | 3300048909 | Ga0496106_0005765 | Ga0496106_0005765_2579_3271 | 230 |
| 336 | 3300048909 | Ga0496106_0154031 | Ga0496106_0154031_800_1531 | 230 |
| 337 | 3300048909 | Ga0496106_0516825 | Ga0496106_0516825_193_924 | 230 |
| 338 | 3300048910 | Ga0496107_0016395 | Ga0496107_0016395_2186_2878 | 230 |
| 339 | 3300048911 | Ga0496108_0031433 | Ga0496108_0031433_1702_2394 | 230 |
| 340 | 3300048912 | Ga0496109_0043447 | Ga0496109_0043447_1540_2232 | 230 |
| 341 | 3300048912 | Ga0496109_0267254 | Ga0496109_0267254_698_1390 | 230 |
| 342 | 3300048913 | Ga0496110_0119998 | Ga0496110_0119998_1145_1837 | 230 |
| 343 | 3300048914 | Ga0496111_0138066 | Ga0496111_0138066_570_1262 | 230 |
| 344 | 3300048915 | Ga0496112_0048810 | Ga0496112_0048810_1712_2404 | 230 |
| 345 | 3300048917 | Ga0496114_0067118 | Ga0496114_0067118_878_1570 | 230 |
| 346 | 3300048918 | Ga0496115_0216419 | Ga0496115_0216419_568_1260 | 230 |
| 347 | 3300048919 | Ga0496116_0098775 | Ga0496116_0098775_705_1397 | 230 |
| 348 | 3300048920 | Ga0496117_0001448 | Ga0496117_0001448_22033_22725 | 230 |
| 349 | 3300048921 | Ga0496118_0000028 | Ga0496118_0000028_233567_234259 | 230 |
| 350 | 3300048922 | Ga0496119_0006996 | Ga0496119_0006996_6147_6839 | 230 |
| 351 | 3300048922 | Ga0496119_0014332 | Ga0496119_0014332_3470_4162 | 230 |
| 352 | 3300048922 | Ga0496119_0043873 | Ga0496119_0043873_1131_1829 | 230 |
| 353 | 3300048923 | Ga0496120_0000930 | Ga0496120_0000930_23154_23846 | 230 |
| 354 | 3300048923 | Ga0496120_0009373 | Ga0496120_0009373_1813_2505 | 230 |
| 355 | 3300048923 | Ga0496120_0022795 | Ga0496120_0022795_2504_3196 | 230 |
| 356 | 3300048924 | Ga0496121_0000808 | Ga0496121_0000808_49306_49998 | 230 |
| 357 | 3300048924 | Ga0496121_0086434 | Ga0496121_0086434_1293_1985 | 230 |
| 358 | 3300048927 | Ga0496124_0181785 | Ga0496124_0181785_897_1589 | 230 |
| 359 | 3300048928 | Ga0496125_0000936 | Ga0496125_0000936_23022_23714 | 230 |
| 360 | 3300048928 | Ga0496125_0003776 | Ga0496125_0003776_3207_3899 | 230 |
| 361 | 3300048928 | Ga0496125_0004532 | Ga0496125_0004532_11398_12090 | 230 |
| 362 | 3300048928 | Ga0496125_0108056 | Ga0496125_0108056_748_1440 | 230 |
| 363 | 3300048929 | Ga0496126_0005881 | Ga0496126_0005881_8810_9502 | 230 |
| 364 | 3300048929 | Ga0496126_0025325 | Ga0496126_0025325_1770_2462 | 230 |
| 365 | 3300048929 | Ga0496126_0234813 | Ga0496126_0234813_696_1397 | 230 |
| 366 | 3300048929 | Ga0496126_0350528 | Ga0496126_0350528_443_1135 | 230 |
| 367 | 3300050512 | nmdc:mga0n895_335419_c1 | nmdc:mga0n895_335419_c1_254_985 | 230 |
| 368 | 3300050514 | nmdc:mga08x19_150260_c1 | nmdc:mga08x19_150260_c1_325_1056 | 230 |
| 369 | 3300053078 | Ga0495612_0144924 | Ga0495612_0144924_262_954 | 230 |
| 370 | 3300053104 | Ga0500556_0000540 | Ga0500556_0000540_1872_2567 | 230 |
| 371 | 3300053106 | Ga0500558_151348 | Ga0500558_151348_90_800 | 230 |
| 372 | 3300053136 | Ga0500559_0051111 | Ga0500559_0051111_1092_1784 | 230 |
| 373 | 3300053136 | Ga0500559_0272247 | Ga0500559_0272247_69_761 | 230 |
| 374 | 3300053157 | Ga0500624_039535 | Ga0500624_039535_75_767 | 230 |
| 375 | 3300053163 | Ga0500639_090697 | Ga0500639_090697_340_1032 | 230 |
| 376 | 3300053178 | Ga0500637_0056244 | Ga0500637_0056244_202_903 | 230 |
| 377 | 3300053178 | Ga0500637_0160481 | Ga0500637_0160481_532_1224 | 230 |
| 378 | 3300053178 | Ga0500637_0270166 | Ga0500637_0270166_92_784 | 230 |
| 379 | 3300005336 | Ga0070680_100056162 | Ga0070680_1000561622 | 231 |
| 380 | 3300005458 | Ga0070681_10002712 | Ga0070681_100027128 | 231 |
| 381 | 3300005530 | Ga0070679_100042103 | Ga0070679_1000421032 | 231 |
| 382 | 3300005548 | Ga0070665_100002460 | Ga0070665_1000024606 | 231 |
| 383 | 3300009093 | Ga0105240_10096276 | Ga0105240_100962762 | 231 |
| 384 | 3300009174 | Ga0105241_10162684 | Ga0105241_101626841 | 231 |
| 385 | 3300009174 | Ga0105241_10758046 | Ga0105241_107580462 | 231 |
| 386 | 3300009545 | Ga0105237_10055385 | Ga0105237_100553852 | 231 |
| 387 | 3300025911 | Ga0207654_10018236 | Ga0207654_100182362 | 231 |
| 388 | 3300025911 | Ga0207654_10392955 | Ga0207654_103929551 | 231 |
| 389 | 3300025934 | Ga0207686_10266948 | Ga0207686_102669482 | 231 |
| 390 | 3300028379 | Ga0268266_10004881 | Ga0268266_100048815 | 231 |
| 391 | 3300028800 | Ga0265338_10000908 | Ga0265338_1000090810 | 231 |
| 392 | 3300031251 | Ga0265327_10103801 | Ga0265327_101038012 | 231 |
| 393 | 3300042876 | Ga0451577_0028852 | Ga0451577_0028852_210_917 | 231 |
| 394 | 3300044673 | Ga0453683_0074790 | Ga0453683_0074790_891_1598 | 231 |
| 395 | 3300044673 | Ga0453683_0129756 | Ga0453683_0129756_736_1443 | 231 |
| 396 | 3300005329 | Ga0070683_100148294 | Ga0070683_1001482942 | 232 |
| 397 | 3300005458 | Ga0070681_10001618 | Ga0070681_100016184 | 232 |
| 398 | 3300009093 | Ga0105240_10014082 | Ga0105240_100140828 | 232 |
| 399 | 3300025913 | Ga0207695_10089287 | Ga0207695_100892872 | 232 |
| 400 | 3300025961 | Ga0207712_10080295 | Ga0207712_100802952 | 232 |
| 401 | 3300053178 | Ga0500637_0013264 | Ga0500637_0013264_3303_4070 | 232 |
| 402 | 3300028563 | Ga0265319_1003256 | Ga0265319_10032567 | 233 |
| 403 | 3300028573 | Ga0265334_10000783 | Ga0265334_100007837 | 233 |
| 404 | 3300028577 | Ga0265318_10000270 | Ga0265318_100002709 | 233 |
| 405 | 3300028800 | Ga0265338_10038982 | Ga0265338_100389824 | 233 |
| 406 | 3300031235 | Ga0265330_10006183 | Ga0265330_100061834 | 233 |
| 407 | 3300031238 | Ga0265332_10002881 | Ga0265332_100028819 | 233 |
| 408 | 3300031239 | Ga0265328_10006797 | Ga0265328_100067972 | 233 |
| 409 | 3300031240 | Ga0265320_10031924 | Ga0265320_100319244 | 233 |
| 410 | 3300031241 | Ga0265325_10001369 | Ga0265325_1000136914 | 233 |
| 411 | 3300031242 | Ga0265329_10013346 | Ga0265329_100133463 | 233 |
| 412 | 3300031249 | Ga0265339_10011088 | Ga0265339_100110885 | 233 |
| 413 | 3300031250 | Ga0265331_10009402 | Ga0265331_100094024 | 233 |
| 414 | 3300031344 | Ga0265316_10008294 | Ga0265316_100082944 | 233 |
| 415 | 3300031595 | Ga0265313_10002084 | Ga0265313_1000208412 | 233 |
| 416 | 3300031711 | Ga0265314_10097362 | Ga0265314_100973622 | 233 |
| 417 | 3300031712 | Ga0265342_10002903 | Ga0265342_1000290310 | 233 |
| 418 | 3300046517 | Ga0495630_0086457 | Ga0495630_0086457_1452_2159 | 233 |
| 419 | 3300049588 | Ga0501072_0250521 | Ga0501072_0250521_581_1285 | 233 |
| 420 | 3300005367 | Ga0070667_100050279 | Ga0070667_1000502794 | 234 |
| 421 | 3300005436 | Ga0070713_100216741 | Ga0070713_1002167412 | 234 |
| 422 | 3300005457 | Ga0070662_100021488 | Ga0070662_1000214882 | 234 |
| 423 | 3300005536 | Ga0070697_100150041 | Ga0070697_1001500413 | 234 |
| 424 | 3300005539 | Ga0068853_100007799 | Ga0068853_1000077996 | 234 |
| 425 | 3300005545 | Ga0070695_100059795 | Ga0070695_1000597952 | 234 |
| 426 | 3300005546 | Ga0070696_100000233 | Ga0070696_10000023323 | 234 |
| 427 | 3300005563 | Ga0068855_100220388 | Ga0068855_1002203882 | 234 |
| 428 | 3300005616 | Ga0068852_100432356 | Ga0068852_1004323561 | 234 |
| 429 | 3300005616 | Ga0068852_100443987 | Ga0068852_1004439873 | 234 |
| 430 | 3300005617 | Ga0068859_100385853 | Ga0068859_1003858531 | 234 |
| 431 | 3300005618 | Ga0068864_100308824 | Ga0068864_1003088242 | 234 |
| 432 | 3300005618 | Ga0068864_100423801 | Ga0068864_1004238012 | 234 |
| 433 | 3300005841 | Ga0068863_100231147 | Ga0068863_1002311473 | 234 |
| 434 | 3300005842 | Ga0068858_100101833 | Ga0068858_1001018332 | 234 |
| 435 | 3300006237 | Ga0097621_100244832 | Ga0097621_1002448322 | 234 |
| 436 | 3300006358 | Ga0068871_100128773 | Ga0068871_1001287732 | 234 |
| 437 | 3300006931 | Ga0097620_100385829 | Ga0097620_1003858293 | 234 |
| 438 | 3300007788 | Ga0099795_10011101 | Ga0099795_100111012 | 234 |
| 439 | 3300009093 | Ga0105240_10097222 | Ga0105240_100972225 | 234 |
| 440 | 3300009093 | Ga0105240_10252307 | Ga0105240_102523072 | 234 |
| 441 | 3300009176 | Ga0105242_10044453 | Ga0105242_100444534 | 234 |
| 442 | 3300009177 | Ga0105248_10283034 | Ga0105248_102830342 | 234 |
| 443 | 3300009553 | Ga0105249_10138848 | Ga0105249_101388483 | 234 |
| 444 | 3300010159 | Ga0099796_10009133 | Ga0099796_100091332 | 234 |
| 445 | 3300013100 | Ga0157373_10035286 | Ga0157373_100352862 | 234 |
| 446 | 3300013306 | Ga0163162_10457560 | Ga0163162_104575602 | 234 |
| 447 | 3300013308 | Ga0157375_10391035 | Ga0157375_103910352 | 234 |
| 448 | 3300025901 | Ga0207688_10157665 | Ga0207688_101576653 | 234 |
| 449 | 3300025913 | Ga0207695_10374491 | Ga0207695_103744912 | 234 |
| 450 | 3300025919 | Ga0207657_10089443 | Ga0207657_100894434 | 234 |
| 451 | 3300025926 | Ga0207659_10369824 | Ga0207659_103698242 | 234 |
| 452 | 3300025928 | Ga0207700_10212562 | Ga0207700_102125622 | 234 |
| 453 | 3300025934 | Ga0207686_10484394 | Ga0207686_104843941 | 234 |
| 454 | 3300025936 | Ga0207670_10010211 | Ga0207670_100102112 | 234 |
| 455 | 3300025939 | Ga0207665_10410189 | Ga0207665_104101892 | 234 |
| 456 | 3300025961 | Ga0207712_10143993 | Ga0207712_101439933 | 234 |
| 457 | 3300025986 | Ga0207658_10070283 | Ga0207658_100702832 | 234 |
| 458 | 3300026041 | Ga0207639_10022623 | Ga0207639_100226234 | 234 |
| 459 | 3300026088 | Ga0207641_10091759 | Ga0207641_100917592 | 234 |
| 460 | 3300026095 | Ga0207676_10310065 | Ga0207676_103100652 | 234 |
| 461 | 3300026095 | Ga0207676_10636925 | Ga0207676_106369252 | 234 |
| 462 | 3300026095 | Ga0207676_10735490 | Ga0207676_107354902 | 234 |
| 463 | 3300026121 | Ga0207683_10341977 | Ga0207683_103419771 | 234 |
| 464 | 3300026142 | Ga0207698_10143352 | Ga0207698_101433522 | 234 |
| 465 | 3300027666 | Ga0209282_1000048 | Ga0209282_100004818 | 234 |
| 466 | 3300028380 | Ga0268265_10497682 | Ga0268265_104976821 | 234 |
| 467 | 3300028800 | Ga0265338_10049953 | Ga0265338_100499533 | 234 |
| 468 | 3300030760 | Ga0265762_1020903 | Ga0265762_10209032 | 234 |
| 469 | 3300031090 | Ga0265760_10006363 | Ga0265760_100063632 | 234 |
| 470 | 3300031090 | Ga0265760_10023643 | Ga0265760_100236432 | 234 |
| 471 | 3300031235 | Ga0265330_10210951 | Ga0265330_102109511 | 234 |
| 472 | 3300031548 | Ga0307408_100622058 | Ga0307408_1006220581 | 234 |
| 473 | 3300031730 | Ga0307516_10002208 | Ga0307516_1000220813 | 234 |
| 474 | 3300031731 | Ga0307405_10134929 | Ga0307405_101349293 | 234 |
| 475 | 3300031824 | Ga0307413_10048890 | Ga0307413_100488902 | 234 |
| 476 | 3300031852 | Ga0307410_10008017 | Ga0307410_100080176 | 234 |
| 477 | 3300031852 | Ga0307410_10032832 | Ga0307410_100328321 | 234 |
| 478 | 3300031901 | Ga0307406_10027106 | Ga0307406_100271063 | 234 |
| 479 | 3300031903 | Ga0307407_10017706 | Ga0307407_100177062 | 234 |
| 480 | 3300031911 | Ga0307412_10020830 | Ga0307412_100208303 | 234 |
| 481 | 3300031995 | Ga0307409_100000356 | Ga0307409_1000003567 | 234 |
| 482 | 3300031995 | Ga0307409_100292940 | Ga0307409_1002929402 | 234 |
| 483 | 3300032004 | Ga0307414_10056028 | Ga0307414_100560282 | 234 |
| 484 | 3300032004 | Ga0307414_10084890 | Ga0307414_100848902 | 234 |
| 485 | 3300032005 | Ga0307411_10030516 | Ga0307411_100305162 | 234 |
| 486 | 3300032005 | Ga0307411_10082409 | Ga0307411_100824092 | 234 |
| 487 | 3300037068 | Ga0373925_0224708 | Ga0373925_0224708_713_1423 | 234 |
| 488 | 3300037418 | Ga0395900_0813295 | Ga0395900_0813295_103_807 | 234 |
| 489 | 3300039450 | Ga0436363_0744495 | Ga0436363_0744495_25_843 | 234 |
| 490 | 3300046473 | Ga0495582_0354006 | Ga0495582_0354006_78_782 | 234 |
| 491 | 3300046474 | Ga0495605_0004939 | Ga0495605_0004939_4537_5298 | 234 |
| 492 | 3300046500 | Ga0495596_0006299 | Ga0495596_0006299_2496_3257 | 234 |
| 493 | 3300046501 | Ga0495607_0014138 | Ga0495607_0014138_2208_2969 | 234 |
| 494 | 3300046512 | Ga0495610_0003749 | Ga0495610_0003749_8629_9390 | 234 |
| 495 | 3300046513 | Ga0495616_0010536 | Ga0495616_0010536_2364_3125 | 234 |
| 496 | 3300046522 | Ga0495643_0035857 | Ga0495643_0035857_1063_1824 | 234 |
| 497 | 3300046529 | Ga0495652_0546507 | Ga0495652_0546507_48_758 | 234 |
| 498 | 3300046616 | Ga0495668_0004686 | Ga0495668_0004686_4486_5190 | 234 |
| 499 | 3300046665 | Ga0495661_0024022 | Ga0495661_0024022_1127_1888 | 234 |
| 500 | 3300046684 | Ga0495669_0033086 | Ga0495669_0033086_398_1159 | 234 |
| 501 | 3300046692 | Ga0495671_0002656 | Ga0495671_0002656_8413_9174 | 234 |
| 502 | 3300046694 | Ga0495649_0020169 | Ga0495649_0020169_1909_2670 | 234 |
| 503 | 3300047317 | Ga0495604_0026945 | Ga0495604_0026945_2155_2880 | 234 |
| 504 | 3300047319 | Ga0495674_0650761 | Ga0495674_0650761_49_759 | 234 |
| 505 | 3300047320 | Ga0495672_0026130 | Ga0495672_0026130_1883_2644 | 234 |
| 506 | 3300048907 | Ga0496104_0038244 | Ga0496104_0038244_694_1404 | 234 |
| 507 | 3300048908 | Ga0496105_0016416 | Ga0496105_0016416_310_1020 | 234 |
| 508 | 3300048918 | Ga0496115_0019186 | Ga0496115_0019186_4206_4916 | 234 |
| 509 | 3300048919 | Ga0496116_0008195 | Ga0496116_0008195_354_1115 | 234 |
| 510 | 3300048924 | Ga0496121_0057967 | Ga0496121_0057967_2253_3014 | 234 |
| 511 | 3300048925 | Ga0496122_0005665 | Ga0496122_0005665_2458_3219 | 234 |
| 512 | 3300048926 | Ga0496123_0006518 | Ga0496123_0006518_2264_3025 | 234 |
| 513 | 3300003316 | rootH1_10172240 | rootH1_101722401 | 235 |
| 514 | 3300053125 | Ga0500618_001110 | Ga0500618_001110_6926_7702 | 235 |
| 515 | iso_pu_bacteria | 2904434214 | 2904438196 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5edl-assembly1.cif.gz_A | crystal structure of an s-component of ecf transporter | 0.5687 | 11 | 215 |
| 5edl-assembly1.cif.gz_A | crystal structure of an s-component of ecf transporter | 0.5001 | 11 | 215 |
| 4rfs-assembly1.cif.gz_S | structure of a pantothenate energy coupling factor transporter | 0.4917 | 10 | 217 |
| 4rfs-assembly1.cif.gz_S | structure of a pantothenate energy coupling factor transporter | 0.4587 | 10 | 217 |
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.3933 | 10 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYK0_57_218_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7581 | 49 | 208 | 1.10.1760.20 |
| af_Q2FYK0_57_218_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7429 | 49 | 208 | 1.10.1760.20 |
| af_P37619_43_201_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6489 | 49 | 212 | 1.10.1760.20 |
| af_P37619_43_201_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6359 | 49 | 212 | 1.10.1760.20 |
| 5ajiF01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.517 | 120 | 212 | 1.10.287.1260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1SL91-F1-model_v4 | Probable queuosine precursor transporter (Q precursor transporter) | 0.9858 | 6 | 235 |
GO:0005886
GO:0022857 GO:1990397 |
| AF-A0A3M2D398-F1-model_v4 | Probable queuosine precursor transporter (Q precursor transporter) | 0.985 | 6 | 235 |
GO:0005886
GO:0022857 GO:1990397 |
| AF-A0A2V8RID3-F1-model_v4 | Probable queuosine precursor transporter (Q precursor transporter) | 0.9838 | 4 | 235 |
GO:0005886
GO:0022857 GO:1990397 |
| AF-A0A2V7TRP8-F1-model_v4 | Queuosine precursor transporter | 0.9819 | 2 | 235 |
GO:0016020
GO:1990397 |
| AF-A0A031JI26-F1-model_v4 | deleted | 0.9804 | 5 | 232 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar