F457945

General Info

Members Datasets Scaffolds Average Seq Length
516 302 1032 123

Family's Representative Sequence

Representative Sequence 3300002705|JGI25156J39149_1002217|JGI25156J39149_10022173
Length 141
Sequence MATPPEICDTGCGLNATLRIISGKWKTLILFFLRNGPKRYGQIKRLIDGWLQRQGADPALKYLEADRVLARTDHKEVPPRMDYSLSPLGRSLAEAIIPLCTWGTGNAAEMASTFAKRDALPXGPIHLRELVAISDVPRAKR

Samples

Sample ID Description Type Environment
1 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
116 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
117 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
118 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
119 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
125 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
126 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
127 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
128 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
129 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
229 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
230 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
231 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
232 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
233 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
234 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
245 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
248 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
249 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
250 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
253 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
254 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
267 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
270 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
271 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
272 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
273 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
274 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
275 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
276 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
277 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
278 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
279 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
280 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
281 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
282 2734482264 Dyella sp. AD052 Isolate Unclassified
283 2738543009 Luteibacter sp. OK325 Isolate Unclassified
284 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
285 2818991450 Burkholderia sp. 604 Isolate Unclassified
286 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
287 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
288 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
289 2842711865 Duganella sp. R-73148 Isolate Unclassified
290 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
291 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
292 2884411467 Dyella sp. AD56 Isolate Rhizosphere
293 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
294 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
295 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
296 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
297 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
298 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
299 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
300 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
301 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
302 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.6
Metatranscriptomes 0
Isolates 6.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.79
Nodule 0.78
Rhizoplane 6.4
Rhizosphere 67.64
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002217 3300002705 Bacteria 7209
2 MRS2a_Contig_18 2124908027 Bacteria 64424
3 MRS2a_Contig_384 2124908027 Bacteria 5127
4 MRS2a_Contig_9254 2124908027 Bacteria 2119
5 JGI24737J22298_10026952 3300001990 Bacteria 1814
6 JGI25155J39150_1000114 3300002704 Bacteria 39873
7 JGI25156J39149_1001581 3300002705 Bacteria 9376
8 JGI25156J39149_1026266 3300002705 Bacteria 925
9 JGI25162J39368_1001227 3300002737 Bacteria 14816
10 JGI25162J39368_1004766 3300002737 Bacteria 2977
11 JGI25154J39366_1000341 3300002738 Bacteria 26907
12 JGI25154J39366_1008652 3300002738 Bacteria 1299
13 JGI25157J39369_1001312 3300002741 Bacteria 9910
14 JGI25164J39214_1000116 3300002772 Bacteria 76944
15 JGI25165J46597_1000382 3300003214 Bacteria 48091
16 Ga0055535_1001179 3300003761 Bacteria 15103
17 Ga0055542_1000959 3300003762 Bacteria 18911
18 Ga0055529_1000366 3300003763 Bacteria 49046
19 Ga0055528_1050452 3300003790 Bacteria 846
20 Ga0065165_1004450 3300005262 Bacteria 8685
21 Ga0065714_10009783 3300005288 Bacteria 3649
22 Ga0065714_10072586 3300005288 Bacteria 3340
23 Ga0065712_10000813 3300005290 Bacteria 10050
24 Ga0065715_10092005 3300005293 Bacteria 5395
25 Ga0070660_100583986 3300005339 Bacteria 933
26 Ga0070660_100695348 3300005339 Bacteria 852
27 Ga0070661_100248111 3300005344 Bacteria 1373
28 Ga0070661_101431375 3300005344 Bacteria 582
29 Ga0070663_100058866 3300005455 Bacteria 2760
30 Ga0070663_100155368 3300005455 Bacteria 1757
31 Ga0070681_10027389 3300005458 Bacteria 5731
32 Ga0068853_100113767 3300005539 Bacteria 2406
33 Ga0068855_100152131 3300005563 Bacteria 2631
34 Ga0068855_100376818 3300005563 Bacteria 1559
35 Ga0068857_100358408 3300005577 Bacteria 1352
36 Ga0068857_100672559 3300005577 Bacteria 982
37 Ga0068854_100161154 3300005578 Bacteria 1737
38 Ga0068856_100405031 3300005614 Bacteria 1384
39 Ga0068852_100041265 3300005616 Bacteria 3899
40 Ga0068852_101019259 3300005616 Bacteria 847
41 Ga0068859_102113382 3300005617 Bacteria 622
42 Ga0068851_10243508 3300005834 Bacteria 1018
43 Ga0068851_10434739 3300005834 Bacteria 777
44 Ga0068858_100671682 3300005842 Bacteria 1007
45 Ga0068858_101096324 3300005842 Bacteria 782
46 Ga0068860_100245836 3300005843 Bacteria 1741
47 Ga0070717_10049683 3300006028 Bacteria 3444
48 Ga0075370_10047050 3300006353 Bacteria 2442
49 Ga0097620_102113274 3300006931 Bacteria 622
50 Ga0105244_10007511 3300009036 Bacteria 6921
51 Ga0105244_10014169 3300009036 Bacteria 4622
52 Ga0105250_10339804 3300009092 Bacteria 656
53 Ga0105240_10005711 3300009093 Bacteria 18459
54 Ga0105241_10364440 3300009174 Bacteria 1258
55 Ga0105237_10161066 3300009545 Bacteria 2242
56 Ga0105238_10102908 3300009551 Bacteria 2837
57 Ga0105246_10034509 3300011119 Bacteria 3372
58 Ga0157373_10002543 3300013100 Bacteria 13895
59 Ga0157373_10021479 3300013100 Bacteria 4688
60 Ga0157371_10043521 3300013102 Bacteria 3198
61 Ga0157370_10335810 3300013104 Bacteria 1393
62 Ga0157369_10253667 3300013105 Bacteria 1836
63 Ga0157369_10553685 3300013105 Bacteria 1189
64 Ga0163162_10057372 3300013306 Bacteria 3922
65 Ga0163162_10802561 3300013306 Bacteria 1059
66 Ga0157372_10034489 3300013307 Bacteria 5563
67 Ga0157372_11373945 3300013307 Bacteria 814
68 Ga0157375_10083679 3300013308 Bacteria 3236
69 Ga0182008_10009222 3300014497 Bacteria 5334
70 Ga0182008_10011158 3300014497 Bacteria 4791
71 Ga0182008_10011498 3300014497 Bacteria 4705
72 Ga0182008_10024539 3300014497 Bacteria 3068
73 Ga0182008_10033222 3300014497 Bacteria 2589
74 Ga0182008_10140375 3300014497 Bacteria 1208
75 Ga0182008_10357611 3300014497 Bacteria 776
76 Ga0157379_10600667 3300014968 Bacteria 1027
77 Ga0182006_1000316 3300015261 Bacteria 42307
78 Ga0182006_1000429 3300015261 Bacteria 33593
79 Ga0182006_1013687 3300015261 Bacteria 3511
80 Ga0182006_1101339 3300015261 Bacteria 1022
81 Ga0182007_10000363 3300015262 Bacteria 28662
82 Ga0182007_10238138 3300015262 Bacteria 649
83 Ga0182005_1000262 3300015265 Bacteria 33349
84 Ga0182005_1235448 3300015265 Bacteria 562
85 Ga0183368_1004 3300015687 Bacteria 1211761
86 Ga0163161_10012991 3300017792 Bacteria 5786
87 Ga0163161_10023633 3300017792 Bacteria 4337
88 Ga0163161_10033923 3300017792 Bacteria 3649
89 Ga0163161_10256567 3300017792 Bacteria 1364
90 Ga0163161_10806951 3300017792 Bacteria 789
91 Ga0163161_11121667 3300017792 Bacteria 677
92 Ga0209435_100077 3300025206 Bacteria 52661
93 Ga0209672_100129 3300025228 Bacteria 76300
94 Ga0207427_100062 3300025231 Bacteria 178598
95 Ga0209437_100426 3300025233 Bacteria 37186
96 Ga0209437_100456 3300025233 Bacteria 32812
97 Ga0209437_109111 3300025233 Bacteria 1561
98 Ga0209258_100088 3300025242 Bacteria 237738
99 Ga0209646_1000205 3300025246 Bacteria 69450
100 Ga0209646_1004886 3300025246 Bacteria 2400
101 Ga0209026_1000747 3300025250 Bacteria 18529
102 Ga0209026_1006695 3300025250 Bacteria 2765
103 Ga0209148_1000024 3300025254 Bacteria 669890
104 Ga0209759_1000390 3300025256 Bacteria 54521
105 Ga0209759_1001490 3300025256 Bacteria 12998
106 Ga0209759_1002991 3300025256 Bacteria 7011
107 Ga0209233_1000023 3300025261 Bacteria 738870
108 Ga0209565_1048453 3300025263 Bacteria 770
109 Ga0209455_1000025 3300025272 Bacteria 670673
110 Ga0209673_1005597 3300025273 Bacteria 6277
111 Ga0209256_1036657 3300025299 Bacteria 1285
112 Ga0207656_10312055 3300025321 Bacteria 780
113 Ga0207655_1001673 3300025728 Bacteria 19542
114 Ga0207655_1018055 3300025728 Bacteria 3766
115 Ga0207713_1013136 3300025735 Bacteria 4384
116 Ga0207713_1158075 3300025735 Bacteria 725
117 Ga0207705_10001907 3300025909 Bacteria 16298
118 Ga0207705_10523623 3300025909 Bacteria 921
119 Ga0207707_10186730 3300025912 Bacteria 1809
120 Ga0207695_10000369 3300025913 Bacteria 103133
121 Ga0207695_10016890 3300025913 Bacteria 8518
122 Ga0207657_10893705 3300025919 Bacteria 684
123 Ga0207657_10894308 3300025919 Bacteria 684
124 Ga0207652_10904342 3300025921 Bacteria 779
125 Ga0207694_10029557 3300025924 Bacteria 4182
126 Ga0207694_10132311 3300025924 Bacteria 2000
127 Ga0207711_11775619 3300025941 Bacteria 560
128 Ga0207667_10019327 3300025949 Bacteria 7609
129 Ga0207667_10082934 3300025949 Bacteria 3320
130 Ga0207667_10397821 3300025949 Bacteria 1403
131 Ga0207667_10662788 3300025949 Bacteria 1048
132 Ga0207640_10008026 3300025981 Bacteria 5834
133 Ga0207639_11069610 3300026041 Bacteria 756
134 Ga0207678_10004617 3300026067 Bacteria 12376
135 Ga0207702_10085772 3300026078 Bacteria 2745
136 Ga0207674_10093425 3300026116 Bacteria 2996
137 Ga0207674_10514058 3300026116 Bacteria 1157
138 Ga0207698_10012397 3300026142 Bacteria 5576
139 Ga0209984_1019966 3300027424 Bacteria 913
140 Ga0210000_1024618 3300027462 Bacteria 930
141 Ga0209999_1001960 3300027543 Bacteria 3588
142 Ga0209982_1001456 3300027552 Bacteria 3245
143 Ga0209983_1000805 3300027665 Bacteria 6845
144 Ga0209974_10004785 3300027876 Bacteria 4803
145 Ga0207428_10619749 3300027907 Bacteria 778
146 Ga0268264_10120370 3300028381 Bacteria 2313
147 Ga0307517_10126729 3300028786 Bacteria 1859
148 Ga0265327_10383255 3300031251 Bacteria 612
149 Ga0307408_100035626 3300031548 Bacteria 3493
150 Ga0307408_100816683 3300031548 Bacteria 847
151 Ga0307508_10330191 3300031616 Bacteria 1117
152 Ga0307514_10001231 3300031649 Bacteria 33814
153 Ga0307514_10011482 3300031649 Bacteria 7363
154 Ga0307405_10279104 3300031731 Bacteria 1257
155 Ga0307405_10467396 3300031731 Bacteria 1004
156 Ga0307405_11724305 3300031731 Bacteria 555
157 Ga0307406_10346131 3300031901 Bacteria 1160
158 Ga0307412_10012822 3300031911 Bacteria 4895
159 Ga0307412_10036595 3300031911 Bacteria 3146
160 Ga0307412_10070035 3300031911 Bacteria 2389
161 Ga0307412_10808843 3300031911 Bacteria 814
162 Ga0307409_100971734 3300031995 Bacteria 866
163 Ga0307416_101221498 3300032002 Bacteria 857
164 Ga0307414_10279786 3300032004 Bacteria 1401
165 Ga0307414_10439744 3300032004 Bacteria 1141
166 Ga0307414_10786085 3300032004 Bacteria 867
167 Ga0307411_10065963 3300032005 Bacteria 2430
168 Ga0307411_10692956 3300032005 Bacteria 886
169 Ga0307507_10428179 3300033179 Bacteria 740
170 Ga0373923_0293287 3300035111 Bacteria 768
171 Ga0395898_0349950 3300037466 Bacteria 1409
172 Ga0395905_0388547 3300037471 Bacteria 1290
173 Ga0395901_0786612 3300038443 Bacteria 942
174 Ga0439436_0000002 3300041404 Bacteria 248787
175 Ga0439447_001751 3300041407 Bacteria 7964
176 Ga0439465_0005076 3300041413 Bacteria 4223
177 Ga0451789_0052068 3300041443 Bacteria 960
178 Ga0451793_1539591 3300041452 Bacteria 930
179 Ga0451797_0937038 3300041453 Bacteria 641
180 Ga0451795_0079913 3300041456 Bacteria 674
181 Ga0451795_1393273 3300041456 Bacteria 733
182 Ga0451798_0141567 3300041458 Bacteria 1869
183 Ga0451800_0271207 3300041459 Bacteria 639
184 Ga0451804_1116219 3300041463 Bacteria 809
185 Ga0451807_1606725 3300041486 Bacteria 866
186 Ga0451853_1452856 3300041512 Bacteria 1577
187 Ga0451853_2060350 3300041512 Bacteria 845
188 Ga0439445_0070412 3300042004 Bacteria 967
189 Ga0439451_058064 3300042009 Bacteria 774
190 Ga0439456_068522 3300042013 Bacteria 785
191 Ga0450898_000072 3300042134 Bacteria 8921
192 Ga0450899_001694 3300042135 Bacteria 2436
193 Ga0450904_001838 3300042139 Bacteria 2756
194 Ga0439434_0000046 3300042435 Bacteria 29715
195 Ga0495617_000019 3300046452 Bacteria 247938
196 Ga0495617_001119 3300046452 Bacteria 12158
197 Ga0495617_008685 3300046452 Bacteria 3496
198 Ga0495617_010071 3300046452 Bacteria 3240
199 Ga0495617_011531 3300046452 Bacteria 3015
200 Ga0495592_0059591 3300046454 Bacteria 2810
201 Ga0495603_0195828 3300046455 Bacteria 1168
202 Ga0495590_0000011 3300046457 Bacteria 307470
203 Ga0495591_000104 3300046458 Bacteria 98228
204 Ga0495629_0118820 3300046459 Bacteria 1842
205 Ga0495638_0000080 3300046460 Bacteria 155967
206 Ga0495638_0028226 3300046460 Bacteria 3625
207 Ga0495638_0028788 3300046460 Bacteria 3585
208 Ga0495638_0062115 3300046460 Bacteria 2307
209 Ga0495638_0666504 3300046460 Bacteria 504
210 Ga0495653_0021711 3300046463 Bacteria 5199
211 Ga0495653_0080025 3300046463 Bacteria 2418
212 Ga0495650_0000001 3300046471 Bacteria 1085492
213 Ga0495650_0002240 3300046471 Bacteria 16176
214 Ga0495650_0002427 3300046471 Bacteria 15123
215 Ga0495650_0002474 3300046471 Bacteria 14869
216 Ga0495650_0254453 3300046471 Bacteria 596
217 Ga0495605_0002808 3300046474 Bacteria 10587
218 Ga0495605_0006908 3300046474 Bacteria 6482
219 Ga0495605_0015549 3300046474 Bacteria 4135
220 Ga0495605_0018977 3300046474 Bacteria 3680
221 Ga0495639_0000113 3300046475 Bacteria 40404
222 Ga0495639_0062290 3300046475 Bacteria 1711
223 Ga0495584_0000143 3300046491 Bacteria 49741
224 Ga0495584_0003046 3300046491 Bacteria 9303
225 Ga0495584_0190522 3300046491 Bacteria 1042
226 Ga0495584_0516629 3300046491 Bacteria 608
227 Ga0495585_0001279 3300046492 Bacteria 20094
228 Ga0495585_0001851 3300046492 Bacteria 16000
229 Ga0495585_0058100 3300046492 Bacteria 2134
230 Ga0495594_0000455 3300046499 Bacteria 20806
231 Ga0495594_0055609 3300046499 Bacteria 2182
232 Ga0495607_0000027 3300046501 Bacteria 155694
233 Ga0495607_0000134 3300046501 Bacteria 78370
234 Ga0495607_0008316 3300046501 Bacteria 7094
235 Ga0495607_0026127 3300046501 Bacteria 3625
236 Ga0495607_0032283 3300046501 Bacteria 3197
237 Ga0495583_0000076 3300046506 Bacteria 174154
238 Ga0495583_0003473 3300046506 Bacteria 11963
239 Ga0495583_0004255 3300046506 Bacteria 10381
240 Ga0495583_0006824 3300046506 Bacteria 7368
241 Ga0495606_0000905 3300046507 Bacteria 44064
242 Ga0495606_0053314 3300046507 Bacteria 2624
243 Ga0495606_0089730 3300046507 Bacteria 1893
244 Ga0495606_0441809 3300046507 Bacteria 668
245 Ga0495610_0000997 3300046512 Bacteria 26110
246 Ga0495610_0017361 3300046512 Bacteria 4106
247 Ga0495610_0047581 3300046512 Bacteria 2109
248 Ga0495616_0002007 3300046513 Bacteria 13696
249 Ga0495616_0003233 3300046513 Bacteria 10486
250 Ga0495616_0006874 3300046513 Bacteria 6852
251 Ga0495620_0001004 3300046515 Bacteria 17443
252 Ga0495628_0779046 3300046516 Bacteria 670
253 Ga0495630_0035317 3300046517 Bacteria 3736
254 Ga0495631_0002090 3300046518 Bacteria 11598
255 Ga0495631_0022441 3300046518 Bacteria 2935
256 Ga0495632_0000003 3300046519 Bacteria 396071
257 Ga0495632_0000037 3300046519 Bacteria 158699
258 Ga0495632_0087580 3300046519 Bacteria 1480
259 Ga0495632_0109435 3300046519 Bacteria 1298
260 Ga0495632_0163584 3300046519 Bacteria 1024
261 Ga0495637_0001330 3300046520 Bacteria 14810
262 Ga0495637_0002529 3300046520 Bacteria 10081
263 Ga0495648_0000010 3300046524 Bacteria 307259
264 Ga0495648_0003560 3300046524 Bacteria 13627
265 Ga0495648_0019181 3300046524 Bacteria 4819
266 Ga0495666_0051728 3300046526 Bacteria 1972
267 Ga0495642_0007987 3300046528 Bacteria 4049
268 Ga0495642_0146952 3300046528 Bacteria 1019
269 Ga0495654_0000345 3300046530 Bacteria 40180
270 Ga0495640_0851650 3300046533 Bacteria 542
271 Ga0495586_0176745 3300046535 Bacteria 1207
272 Ga0495609_0001550 3300046538 Bacteria 15049
273 Ga0495609_0008637 3300046538 Bacteria 4972
274 Ga0495609_0038986 3300046538 Bacteria 2140
275 Ga0495597_0001006 3300046542 Bacteria 21607
276 Ga0495622_0000174 3300046557 Bacteria 52629
277 Ga0495622_0000617 3300046557 Bacteria 20634
278 Ga0495622_0000621 3300046557 Bacteria 20566
279 Ga0495633_0000076 3300046558 Bacteria 129915
280 Ga0495633_0002548 3300046558 Bacteria 12790
281 Ga0495633_0154833 3300046558 Bacteria 1058
282 Ga0495668_0000045 3300046616 Bacteria 225145
283 Ga0495668_0334998 3300046616 Bacteria 830
284 Ga0495611_0001675 3300046648 Bacteria 10737
285 Ga0495611_0003884 3300046648 Bacteria 6511
286 Ga0495611_0007517 3300046648 Bacteria 4625
287 Ga0495625_0000056 3300046660 Bacteria 186024
288 Ga0495625_0000365 3300046660 Bacteria 69161
289 Ga0495625_0003058 3300046660 Bacteria 17143
290 Ga0495625_0014499 3300046660 Bacteria 6284
291 Ga0495625_0014669 3300046660 Bacteria 6241
292 Ga0495625_0020547 3300046660 Bacteria 5096
293 Ga0495625_0023852 3300046660 Bacteria 4667
294 Ga0495625_0026733 3300046660 Bacteria 4353
295 Ga0495625_0062465 3300046660 Bacteria 2632
296 Ga0495625_0353394 3300046660 Bacteria 928
297 Ga0495635_0558296 3300046663 Bacteria 750
298 Ga0495659_0000022 3300046664 Bacteria 72378
299 Ga0495659_0000483 3300046664 Bacteria 14770
300 Ga0495659_0008109 3300046664 Bacteria 3338
301 Ga0495661_0011366 3300046665 Bacteria 6042
302 Ga0495661_0018959 3300046665 Bacteria 4514
303 Ga0495588_0009484 3300046674 Bacteria 4499
304 Ga0495623_0007309 3300046679 Bacteria 7167
305 Ga0495646_0018679 3300046680 Bacteria 4390
306 Ga0495646_0020173 3300046680 Bacteria 4214
307 Ga0495658_0041444 3300046683 Bacteria 2565
308 Ga0495613_0132120 3300046689 Bacteria 1787
309 Ga0495624_0261387 3300046690 Bacteria 1046
310 Ga0495670_0000770 3300046691 Bacteria 15357
311 Ga0495670_0001673 3300046691 Bacteria 10884
312 Ga0495670_0002958 3300046691 Bacteria 8384
313 Ga0495670_0144488 3300046691 Bacteria 1246
314 Ga0495671_0011654 3300046692 Bacteria 4824
315 Ga0495671_0020111 3300046692 Bacteria 3521
316 Ga0495649_0000202 3300046694 Bacteria 52910
317 Ga0495649_0034133 3300046694 Bacteria 2800
318 Ga0495649_0067517 3300046694 Bacteria 1918
319 Ga0495589_0002484 3300046794 Bacteria 10327
320 Ga0495589_0024713 3300046794 Bacteria 3052
321 Ga0495589_0101052 3300046794 Bacteria 1395
322 Ga0495600_0157657 3300046809 Bacteria 1468
323 Ga0495600_0249245 3300046809 Bacteria 1130
324 Ga0495660_0001774 3300046810 Bacteria 14278
325 Ga0495660_0030894 3300046810 Bacteria 3015
326 Ga0495660_0033499 3300046810 Bacteria 2880
327 Ga0495660_0046978 3300046810 Bacteria 2366
328 Ga0495660_0100651 3300046810 Bacteria 1488
329 Ga0495581_0000342 3300047315 Bacteria 23273
330 Ga0495604_0203583 3300047317 Bacteria 1371
331 Ga0495636_0025978 3300047318 Bacteria 2380
332 Ga0495636_0200289 3300047318 Bacteria 911
333 Ga0495674_0056716 3300047319 Bacteria 3429
334 Ga0495672_0009715 3300047320 Bacteria 6935
335 Ga0495672_0017734 3300047320 Bacteria 4751
336 Ga0495672_0193315 3300047320 Bacteria 1022
337 Ga0495672_0198590 3300047320 Bacteria 1004
338 Ga0495680_0007407 3300047322 Bacteria 10065
339 Ga0495680_0008626 3300047322 Bacteria 9254
340 Ga0495683_0001533 3300047323 Bacteria 14980
341 Ga0495683_0002730 3300047323 Bacteria 10522
342 Ga0495683_0005743 3300047323 Bacteria 6838
343 Ga0495683_0015518 3300047323 Bacteria 3961
344 Ga0495687_001132 3300047443 Bacteria 25838
345 Ga0495687_004326 3300047443 Bacteria 9668
346 Ga0495687_004745 3300047443 Bacteria 8994
347 Ga0495675_0307800 3300047444 Bacteria 939
348 Ga0495677_0066209 3300047445 Bacteria 1343
349 Ga0495677_0282450 3300047445 Bacteria 651
350 Ga0495679_003134 3300047446 Bacteria 8088
351 Ga0495685_000410 3300047447 Bacteria 13598
352 Ga0495673_0000096 3300047469 Bacteria 182792
353 Ga0495673_0003848 3300047469 Bacteria 9682
354 Ga0495673_0006179 3300047469 Bacteria 7094
355 Ga0495673_0087626 3300047469 Bacteria 1277
356 Ga0495673_0234637 3300047469 Bacteria 674
357 Ga0495681_0034195 3300047470 Bacteria 2535
358 Ga0495686_0001166 3300047472 Bacteria 30748
359 Ga0495686_0002143 3300047472 Bacteria 19294
360 Ga0495686_0043995 3300047472 Bacteria 2827
361 Ga0495686_0071878 3300047472 Bacteria 2128
362 Ga0495686_0659166 3300047472 Bacteria 537
363 Ga0495593_0005716 3300047673 Bacteria 7341
364 Ga0495593_0097699 3300047673 Bacteria 1508
365 Ga0495602_0019932 3300048088 Bacteria 6640
366 Ga0495614_0039128 3300048089 Bacteria 2035
367 Ga0495614_0145394 3300048089 Bacteria 1055
368 Ga0495626_0000408 3300048091 Bacteria 44088
369 Ga0495626_0041236 3300048091 Bacteria 2175
370 Ga0495626_0052632 3300048091 Bacteria 1876
371 Ga0496100_0022459 3300048903 Bacteria 3818
372 Ga0496100_0030135 3300048903 Bacteria 3363
373 Ga0496101_0149705 3300048904 Bacteria 1784
374 Ga0496101_0556174 3300048904 Bacteria 907
375 Ga0496102_0080893 3300048905 Bacteria 2994
376 Ga0496104_0003065 3300048907 Bacteria 14406
377 Ga0496104_0288889 3300048907 Bacteria 1552
378 Ga0496104_0310533 3300048907 Bacteria 1490
379 Ga0496105_0004898 3300048908 Bacteria 10121
380 Ga0496105_0110272 3300048908 Bacteria 2271
381 Ga0496105_0323374 3300048908 Bacteria 1236
382 Ga0496106_0105917 3300048909 Bacteria 2185
383 Ga0496107_0530709 3300048910 Bacteria 872
384 Ga0496107_0553027 3300048910 Bacteria 852
385 Ga0496112_0222188 3300048915 Bacteria 1844
386 Ga0496112_0703532 3300048915 Bacteria 938
387 Ga0496113_0169722 3300048916 Bacteria 1727
388 Ga0496114_0268584 3300048917 Bacteria 1503
389 Ga0496116_0001588 3300048919 Bacteria 25003
390 Ga0496116_0004586 3300048919 Bacteria 13100
391 Ga0496117_0004175 3300048920 Bacteria 16157
392 Ga0496117_0134193 3300048920 Bacteria 1494
393 Ga0496117_0164202 3300048920 Bacteria 1297
394 Ga0496118_0001868 3300048921 Bacteria 30137
395 Ga0496118_0003510 3300048921 Bacteria 19666
396 Ga0496118_0008782 3300048921 Bacteria 10362
397 Ga0496118_0013638 3300048921 Bacteria 7671
398 Ga0496121_0025389 3300048924 Bacteria 5623
399 Ga0496121_0079367 3300048924 Bacteria 2606
400 Ga0496121_0176076 3300048924 Bacteria 1548
401 Ga0496121_0267129 3300048924 Bacteria 1178
402 Ga0496121_0604082 3300048924 Bacteria 676
403 Ga0496122_0000261 3300048925 Bacteria 118793
404 Ga0496122_0001098 3300048925 Bacteria 46802
405 Ga0496122_0012598 3300048925 Bacteria 8393
406 Ga0496122_0034521 3300048925 Bacteria 4138
407 Ga0496123_0000218 3300048926 Bacteria 116615
408 Ga0496123_0034611 3300048926 Bacteria 3614
409 Ga0496123_0100767 3300048926 Bacteria 1681
410 Ga0496124_0155499 3300048927 Bacteria 1789
411 Ga0496125_0046876 3300048928 Bacteria 3621
412 Ga0496125_0069816 3300048928 Bacteria 2753
413 Ga0496125_0624624 3300048928 Bacteria 584
414 Ga0496126_0000216 3300048929 Bacteria 126985
415 Ga0496126_0442817 3300048929 Bacteria 1047
416 Ga0496126_0965639 3300048929 Bacteria 642
417 Ga0495678_001436 3300049459 Bacteria 18742
418 Ga0495678_002653 3300049459 Bacteria 11877
419 Ga0495678_003545 3300049459 Bacteria 9572
420 Ga0495678_007027 3300049459 Bacteria 5900
421 Ga0495678_168653 3300049459 Bacteria 694
422 Ga0495682_0001062 3300049460 Bacteria 16167
423 Ga0495682_0075287 3300049460 Bacteria 1214
424 Ga0495682_0100979 3300049460 Bacteria 1034
425 Ga0495682_0292717 3300049460 Bacteria 574
426 Ga0501043_0095927 3300049579 Bacteria 2331
427 Ga0501046_0545205 3300049580 Unclassified 827
428 Ga0501070_0151548 3300049586 Bacteria 1913
429 Ga0501073_0059537 3300049589 Bacteria 2667
430 Ga0501208_149529 3300049655 Bacteria 529
431 Ga0501209_170802 3300049656 Bacteria 661
432 Ga0501223_078954 3300049663 Bacteria 657
433 Ga0501227_185545 3300049665 Bacteria 586
434 Ga0501257_179818 3300049686 Bacteria 598
435 Ga0501262_000418 3300049759 Bacteria 5128
436 Ga0501269_000816 3300049766 Bacteria 4795
437 Ga0501035_0028025 3300049822 Bacteria 5144
438 Ga0501044_0056504 3300049823 Bacteria 4030
439 Ga0501044_0656010 3300049823 Bacteria 938
440 nmdc:mga03n38_332968_c1 3300050490 Bacteria 822
441 nmdc:mga07m45_49381_c1 3300050496 Bacteria 2368
442 Ga0500578_0000282 3300053086 Bacteria 62821
443 Ga0500578_0140851 3300053086 Bacteria 1508
444 Ga0500643_001483 3300053087 Bacteria 13455
445 Ga0500643_080019 3300053087 Bacteria 898
446 Ga0500644_0430572 3300053088 Bacteria 577
447 Ga0500646_0025569 3300053090 Bacteria 1595
448 Ga0500651_0041149 3300053093 Bacteria 2912
449 Ga0500650_0137916 3300053098 Bacteria 1131
450 Ga0500557_063724 3300053105 Bacteria 1201
451 Ga0500562_008139 3300053108 Bacteria 2644
452 Ga0500569_046999 3300053109 Bacteria 1288
453 Ga0500594_0072841 3300053118 Bacteria 1013
454 Ga0500594_0137856 3300053118 Bacteria 777
455 Ga0500595_051240 3300053119 Bacteria 1279
456 Ga0500597_000296 3300053120 Bacteria 10120
457 Ga0500608_001747 3300053122 Bacteria 7762
458 Ga0500608_079086 3300053122 Bacteria 1554
459 Ga0500614_160794 3300053123 Bacteria 680
460 Ga0500623_091829 3300053127 Bacteria 1413
461 Ga0500628_006525 3300053129 Bacteria 1975
462 Ga0500628_033757 3300053129 Bacteria 1127
463 Ga0500642_0003697 3300053130 Bacteria 4670
464 Ga0500652_000348 3300053131 Bacteria 16668
465 Ga0500655_005448 3300053133 Bacteria 2296
466 Ga0500658_0000600 3300053134 Bacteria 14953
467 Ga0500658_0096622 3300053134 Bacteria 1284
468 Ga0500559_0016648 3300053136 Bacteria 3105
469 Ga0500561_0114098 3300053137 Bacteria 820
470 Ga0500568_0016826 3300053139 Bacteria 3239
471 Ga0500568_0251362 3300053139 Bacteria 644
472 Ga0500577_0135465 3300053142 Bacteria 1035
473 Ga0500604_0009612 3300053151 Bacteria 2578
474 Ga0500604_0014924 3300053151 Bacteria 2120
475 Ga0500604_0065444 3300053151 Bacteria 1150
476 Ga0500604_0298823 3300053151 Bacteria 558
477 Ga0500622_0002537 3300053156 Bacteria 13113
478 Ga0500622_0030976 3300053156 Bacteria 2806
479 Ga0500627_0311623 3300053158 Bacteria 685
480 Ga0500570_053445 3300053724 Bacteria 2012
481 Ga0500584_041143 3300053726 Bacteria 2119
482 Ga0500645_006195 3300053730 Bacteria 4294
483 Ga0500661_006013 3300055283 Bacteria 2262
484 2599947361 2599185303 Bacteria 6512725
485 2600022892 2599185316 Bacteria 6320029
486 2600028967 2599185317 Bacteria 6435722
487 2600076260 2599185325 Bacteria 6324919
488 2600358134 2600254930 Bacteria 6431253
489 2643971059 2643221592 Bacteria 6608788
490 2644144222 2643221625 Bacteria 6512927
491 2644188968 2643221633 Bacteria 6733554
492 2644275244 2643221648 Bacteria 6521465
493 2671130255 2667528176 Bacteria 6724917
494 2677899213 2675903420 Bacteria 6247433
495 2721027467 2718218334 Bacteria 4765486
496 2735836397 2734482264 Unclassified 5014763
497 2739227511 2738543009 Bacteria 4944499
498 2809215264 2808606445 Bacteria 6057339
499 2819618914 2818991450 Bacteria 6962147
500 2842326451 2842324504 Bacteria 9364110
501 2842351031 2842348783 Bacteria 9002918
502 2842455764 2842454564 Bacteria 8730687
503 2842715318 2842711865 Bacteria 7155354
504 2842782874 2842780639 Bacteria 4337790
505 2842921378 2842918807 Bacteria 4289178
506 2884415807 2884411467 Bacteria 5246714
507 2919483347 2919481497 Bacteria 6907839
508 2919703818 2919697872 Bacteria 6553725
509 2928113951 2928108538 Bacteria 7360024
510 2928141327 2928135762 Bacteria 7259641
511 2928509437 2928503688 Bacteria 7268108
512 2945949701 2945945610 Bacteria 5951079
513 2945972250 2945972063 Bacteria 6086495
514 2953996605 2953994433 Bacteria 4303959
515 8019782011 8019775933 Bacteria 6858656
516 8055306309 8055301274 Bacteria 8587385
517 JGI25156J39149_1002217
518 MRS2a_Contig_18
519 MRS2a_Contig_384
520 MRS2a_Contig_9254
521 JGI24737J22298_10026952
522 JGI25155J39150_1000114
523 JGI25156J39149_1001581
524 JGI25156J39149_1026266
525 JGI25162J39368_1001227
526 JGI25162J39368_1004766
527 JGI25154J39366_1000341
528 JGI25154J39366_1008652
529 JGI25157J39369_1001312
530 JGI25164J39214_1000116
531 JGI25165J46597_1000382
532 Ga0055535_1001179
533 Ga0055542_1000959
534 Ga0055529_1000366
535 Ga0055528_1050452
536 Ga0065165_1004450
537 Ga0065714_10009783
538 Ga0065714_10072586
539 Ga0065712_10000813
540 Ga0065715_10092005
541 Ga0070660_100583986
542 Ga0070660_100695348
543 Ga0070661_100248111
544 Ga0070661_101431375
545 Ga0070663_100058866
546 Ga0070663_100155368
547 Ga0070681_10027389
548 Ga0068853_100113767
549 Ga0068855_100152131
550 Ga0068855_100376818
551 Ga0068857_100358408
552 Ga0068857_100672559
553 Ga0068854_100161154
554 Ga0068856_100405031
555 Ga0068852_100041265
556 Ga0068852_101019259
557 Ga0068859_102113382
558 Ga0068851_10243508
559 Ga0068851_10434739
560 Ga0068858_100671682
561 Ga0068858_101096324
562 Ga0068860_100245836
563 Ga0070717_10049683
564 Ga0075370_10047050
565 Ga0097620_102113274
566 Ga0105244_10007511
567 Ga0105244_10014169
568 Ga0105250_10339804
569 Ga0105240_10005711
570 Ga0105241_10364440
571 Ga0105237_10161066
572 Ga0105238_10102908
573 Ga0105246_10034509
574 Ga0157373_10002543
575 Ga0157373_10021479
576 Ga0157371_10043521
577 Ga0157370_10335810
578 Ga0157369_10253667
579 Ga0157369_10553685
580 Ga0163162_10057372
581 Ga0163162_10802561
582 Ga0157372_10034489
583 Ga0157372_11373945
584 Ga0157375_10083679
585 Ga0182008_10009222
586 Ga0182008_10011158
587 Ga0182008_10011498
588 Ga0182008_10024539
589 Ga0182008_10033222
590 Ga0182008_10140375
591 Ga0182008_10357611
592 Ga0157379_10600667
593 Ga0182006_1000316
594 Ga0182006_1000429
595 Ga0182006_1013687
596 Ga0182006_1101339
597 Ga0182007_10000363
598 Ga0182007_10238138
599 Ga0182005_1000262
600 Ga0182005_1235448
601 Ga0183368_1004
602 Ga0163161_10012991
603 Ga0163161_10023633
604 Ga0163161_10033923
605 Ga0163161_10256567
606 Ga0163161_10806951
607 Ga0163161_11121667
608 Ga0209435_100077
609 Ga0209672_100129
610 Ga0207427_100062
611 Ga0209437_100426
612 Ga0209437_100456
613 Ga0209437_109111
614 Ga0209258_100088
615 Ga0209646_1000205
616 Ga0209646_1004886
617 Ga0209026_1000747
618 Ga0209026_1006695
619 Ga0209148_1000024
620 Ga0209759_1000390
621 Ga0209759_1001490
622 Ga0209759_1002991
623 Ga0209233_1000023
624 Ga0209565_1048453
625 Ga0209455_1000025
626 Ga0209673_1005597
627 Ga0209256_1036657
628 Ga0207656_10312055
629 Ga0207655_1001673
630 Ga0207655_1018055
631 Ga0207713_1013136
632 Ga0207713_1158075
633 Ga0207705_10001907
634 Ga0207705_10523623
635 Ga0207707_10186730
636 Ga0207695_10000369
637 Ga0207695_10016890
638 Ga0207657_10893705
639 Ga0207657_10894308
640 Ga0207652_10904342
641 Ga0207694_10029557
642 Ga0207694_10132311
643 Ga0207711_11775619
644 Ga0207667_10019327
645 Ga0207667_10082934
646 Ga0207667_10397821
647 Ga0207667_10662788
648 Ga0207640_10008026
649 Ga0207639_11069610
650 Ga0207678_10004617
651 Ga0207702_10085772
652 Ga0207674_10093425
653 Ga0207674_10514058
654 Ga0207698_10012397
655 Ga0209984_1019966
656 Ga0210000_1024618
657 Ga0209999_1001960
658 Ga0209982_1001456
659 Ga0209983_1000805
660 Ga0209974_10004785
661 Ga0207428_10619749
662 Ga0268264_10120370
663 Ga0307517_10126729
664 Ga0265327_10383255
665 Ga0307408_100035626
666 Ga0307408_100816683
667 Ga0307508_10330191
668 Ga0307514_10001231
669 Ga0307514_10011482
670 Ga0307405_10279104
671 Ga0307405_10467396
672 Ga0307405_11724305
673 Ga0307406_10346131
674 Ga0307412_10012822
675 Ga0307412_10036595
676 Ga0307412_10070035
677 Ga0307412_10808843
678 Ga0307409_100971734
679 Ga0307416_101221498
680 Ga0307414_10279786
681 Ga0307414_10439744
682 Ga0307414_10786085
683 Ga0307411_10065963
684 Ga0307411_10692956
685 Ga0307507_10428179
686 Ga0373923_0293287
687 Ga0395898_0349950
688 Ga0395905_0388547
689 Ga0395901_0786612
690 Ga0439436_0000002
691 Ga0439447_001751
692 Ga0439465_0005076
693 Ga0451789_0052068
694 Ga0451793_1539591
695 Ga0451797_0937038
696 Ga0451795_0079913
697 Ga0451795_1393273
698 Ga0451798_0141567
699 Ga0451800_0271207
700 Ga0451804_1116219
701 Ga0451807_1606725
702 Ga0451853_1452856
703 Ga0451853_2060350
704 Ga0439445_0070412
705 Ga0439451_058064
706 Ga0439456_068522
707 Ga0450898_000072
708 Ga0450899_001694
709 Ga0450904_001838
710 Ga0439434_0000046
711 Ga0495617_000019
712 Ga0495617_001119
713 Ga0495617_008685
714 Ga0495617_010071
715 Ga0495617_011531
716 Ga0495592_0059591
717 Ga0495603_0195828
718 Ga0495590_0000011
719 Ga0495591_000104
720 Ga0495629_0118820
721 Ga0495638_0000080
722 Ga0495638_0028226
723 Ga0495638_0028788
724 Ga0495638_0062115
725 Ga0495638_0666504
726 Ga0495653_0021711
727 Ga0495653_0080025
728 Ga0495650_0000001
729 Ga0495650_0002240
730 Ga0495650_0002427
731 Ga0495650_0002474
732 Ga0495650_0254453
733 Ga0495605_0002808
734 Ga0495605_0006908
735 Ga0495605_0015549
736 Ga0495605_0018977
737 Ga0495639_0000113
738 Ga0495639_0062290
739 Ga0495584_0000143
740 Ga0495584_0003046
741 Ga0495584_0190522
742 Ga0495584_0516629
743 Ga0495585_0001279
744 Ga0495585_0001851
745 Ga0495585_0058100
746 Ga0495594_0000455
747 Ga0495594_0055609
748 Ga0495607_0000027
749 Ga0495607_0000134
750 Ga0495607_0008316
751 Ga0495607_0026127
752 Ga0495607_0032283
753 Ga0495583_0000076
754 Ga0495583_0003473
755 Ga0495583_0004255
756 Ga0495583_0006824
757 Ga0495606_0000905
758 Ga0495606_0053314
759 Ga0495606_0089730
760 Ga0495606_0441809
761 Ga0495610_0000997
762 Ga0495610_0017361
763 Ga0495610_0047581
764 Ga0495616_0002007
765 Ga0495616_0003233
766 Ga0495616_0006874
767 Ga0495620_0001004
768 Ga0495628_0779046
769 Ga0495630_0035317
770 Ga0495631_0002090
771 Ga0495631_0022441
772 Ga0495632_0000003
773 Ga0495632_0000037
774 Ga0495632_0087580
775 Ga0495632_0109435
776 Ga0495632_0163584
777 Ga0495637_0001330
778 Ga0495637_0002529
779 Ga0495648_0000010
780 Ga0495648_0003560
781 Ga0495648_0019181
782 Ga0495666_0051728
783 Ga0495642_0007987
784 Ga0495642_0146952
785 Ga0495654_0000345
786 Ga0495640_0851650
787 Ga0495586_0176745
788 Ga0495609_0001550
789 Ga0495609_0008637
790 Ga0495609_0038986
791 Ga0495597_0001006
792 Ga0495622_0000174
793 Ga0495622_0000617
794 Ga0495622_0000621
795 Ga0495633_0000076
796 Ga0495633_0002548
797 Ga0495633_0154833
798 Ga0495668_0000045
799 Ga0495668_0334998
800 Ga0495611_0001675
801 Ga0495611_0003884
802 Ga0495611_0007517
803 Ga0495625_0000056
804 Ga0495625_0000365
805 Ga0495625_0003058
806 Ga0495625_0014499
807 Ga0495625_0014669
808 Ga0495625_0020547
809 Ga0495625_0023852
810 Ga0495625_0026733
811 Ga0495625_0062465
812 Ga0495625_0353394
813 Ga0495635_0558296
814 Ga0495659_0000022
815 Ga0495659_0000483
816 Ga0495659_0008109
817 Ga0495661_0011366
818 Ga0495661_0018959
819 Ga0495588_0009484
820 Ga0495623_0007309
821 Ga0495646_0018679
822 Ga0495646_0020173
823 Ga0495658_0041444
824 Ga0495613_0132120
825 Ga0495624_0261387
826 Ga0495670_0000770
827 Ga0495670_0001673
828 Ga0495670_0002958
829 Ga0495670_0144488
830 Ga0495671_0011654
831 Ga0495671_0020111
832 Ga0495649_0000202
833 Ga0495649_0034133
834 Ga0495649_0067517
835 Ga0495589_0002484
836 Ga0495589_0024713
837 Ga0495589_0101052
838 Ga0495600_0157657
839 Ga0495600_0249245
840 Ga0495660_0001774
841 Ga0495660_0030894
842 Ga0495660_0033499
843 Ga0495660_0046978
844 Ga0495660_0100651
845 Ga0495581_0000342
846 Ga0495604_0203583
847 Ga0495636_0025978
848 Ga0495636_0200289
849 Ga0495674_0056716
850 Ga0495672_0009715
851 Ga0495672_0017734
852 Ga0495672_0193315
853 Ga0495672_0198590
854 Ga0495680_0007407
855 Ga0495680_0008626
856 Ga0495683_0001533
857 Ga0495683_0002730
858 Ga0495683_0005743
859 Ga0495683_0015518
860 Ga0495687_001132
861 Ga0495687_004326
862 Ga0495687_004745
863 Ga0495675_0307800
864 Ga0495677_0066209
865 Ga0495677_0282450
866 Ga0495679_003134
867 Ga0495685_000410
868 Ga0495673_0000096
869 Ga0495673_0003848
870 Ga0495673_0006179
871 Ga0495673_0087626
872 Ga0495673_0234637
873 Ga0495681_0034195
874 Ga0495686_0001166
875 Ga0495686_0002143
876 Ga0495686_0043995
877 Ga0495686_0071878
878 Ga0495686_0659166
879 Ga0495593_0005716
880 Ga0495593_0097699
881 Ga0495602_0019932
882 Ga0495614_0039128
883 Ga0495614_0145394
884 Ga0495626_0000408
885 Ga0495626_0041236
886 Ga0495626_0052632
887 Ga0496100_0022459
888 Ga0496100_0030135
889 Ga0496101_0149705
890 Ga0496101_0556174
891 Ga0496102_0080893
892 Ga0496104_0003065
893 Ga0496104_0288889
894 Ga0496104_0310533
895 Ga0496105_0004898
896 Ga0496105_0110272
897 Ga0496105_0323374
898 Ga0496106_0105917
899 Ga0496107_0530709
900 Ga0496107_0553027
901 Ga0496112_0222188
902 Ga0496112_0703532
903 Ga0496113_0169722
904 Ga0496114_0268584
905 Ga0496116_0001588
906 Ga0496116_0004586
907 Ga0496117_0004175
908 Ga0496117_0134193
909 Ga0496117_0164202
910 Ga0496118_0001868
911 Ga0496118_0003510
912 Ga0496118_0008782
913 Ga0496118_0013638
914 Ga0496121_0025389
915 Ga0496121_0079367
916 Ga0496121_0176076
917 Ga0496121_0267129
918 Ga0496121_0604082
919 Ga0496122_0000261
920 Ga0496122_0001098
921 Ga0496122_0012598
922 Ga0496122_0034521
923 Ga0496123_0000218
924 Ga0496123_0034611
925 Ga0496123_0100767
926 Ga0496124_0155499
927 Ga0496125_0046876
928 Ga0496125_0069816
929 Ga0496125_0624624
930 Ga0496126_0000216
931 Ga0496126_0442817
932 Ga0496126_0965639
933 Ga0495678_001436
934 Ga0495678_002653
935 Ga0495678_003545
936 Ga0495678_007027
937 Ga0495678_168653
938 Ga0495682_0001062
939 Ga0495682_0075287
940 Ga0495682_0100979
941 Ga0495682_0292717
942 Ga0501043_0095927
943 Ga0501046_0545205
944 Ga0501070_0151548
945 Ga0501073_0059537
946 Ga0501208_149529
947 Ga0501209_170802
948 Ga0501223_078954
949 Ga0501227_185545
950 Ga0501257_179818
951 Ga0501262_000418
952 Ga0501269_000816
953 Ga0501035_0028025
954 Ga0501044_0056504
955 Ga0501044_0656010
956 nmdc:mga03n38_332968_c1
957 nmdc:mga07m45_49381_c1
958 Ga0500578_0000282
959 Ga0500578_0140851
960 Ga0500643_001483
961 Ga0500643_080019
962 Ga0500644_0430572
963 Ga0500646_0025569
964 Ga0500651_0041149
965 Ga0500650_0137916
966 Ga0500557_063724
967 Ga0500562_008139
968 Ga0500569_046999
969 Ga0500594_0072841
970 Ga0500594_0137856
971 Ga0500595_051240
972 Ga0500597_000296
973 Ga0500608_001747
974 Ga0500608_079086
975 Ga0500614_160794
976 Ga0500623_091829
977 Ga0500628_006525
978 Ga0500628_033757
979 Ga0500642_0003697
980 Ga0500652_000348
981 Ga0500655_005448
982 Ga0500658_0000600
983 Ga0500658_0096622
984 Ga0500559_0016648
985 Ga0500561_0114098
986 Ga0500568_0016826
987 Ga0500568_0251362
988 Ga0500577_0135465
989 Ga0500604_0009612
990 Ga0500604_0014924
991 Ga0500604_0065444
992 Ga0500604_0298823
993 Ga0500622_0002537
994 Ga0500622_0030976
995 Ga0500627_0311623
996 Ga0500570_053445
997 Ga0500584_041143
998 Ga0500645_006195
999 Ga0500661_006013
1000 2599947361
1001 2600022892
1002 2600028967
1003 2600076260
1004 2600358134
1005 2643971059
1006 2644144222
1007 2644188968
1008 2644275244
1009 2671130255
1010 2677899213
1011 2721027467
1012 2735836397
1013 2739227511
1014 2809215264
1015 2819618914
1016 2842326451
1017 2842351031
1018 2842455764
1019 2842715318
1020 2842782874
1021 2842921378
1022 2884415807
1023 2919483347
1024 2919703818
1025 2928113951
1026 2928141327
1027 2928509437
1028 2945949701
1029 2945972250
1030 2953996605
1031 8019782011
1032 8055306309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

20

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.9165 13 111
7kd3-assembly1.cif.gz_B structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9008 12 108
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.8916 9 105
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.8907 13 111
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.889 12 105
ID Description Score Start End Superfamily
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8842 13 104 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8831 11 104 1.10.10.10
2fswA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8827 9 103 1.10.10.10
af_P0ACN2_1_125_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8582 15 116 1.10.10.10
2hztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.858 15 107 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y0E1U4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9336 12 119 GO:0003677
AF-A0A1J6IAT3-F1-model_v4 Transcriptional regulator 0.9304 12 118 GO:0003677
AF-A0A1B3Z728-F1-model_v4 Transcriptional regulator 0.9303 12 118 GO:0003677
GO:0003700
AF-A0A5P2D8A5-F1-model_v4 Transcriptional regulator 0.9298 12 104 GO:0003677
AF-A0A4Q8LDV4-F1-model_v4 Transcriptional regulator 0.9202 12 118 GO:0003677

Map