F457964

General Info

Members Datasets Scaffolds Average Seq Length
516 316 1032 162

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100111402|Ga0070714_1001114022
Length 188
Sequence MLSKTCTIEKMSSSFGDPTPITPAPMSTYTLSVNGQSHSVDVTPDTPLLWVLRDSLGLVGTKYGCGIGECGACTVHLDGAAKRACQTAISDVGRAEVTTIEGLDPAGKHPLQQAWCELDVPQCGYCQGGQIMTAAALLKSNPRPTDADIDRTMSGNLCRCASYYRIRAGIKRAAELTAGATPANGGQS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
284 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
294 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
295 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
296 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
297 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
308 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
309 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
310 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 2643221583 Caulobacter sp. Root655 Isolate Unclassified
313 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
314 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
315 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
316 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.97
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 1.36
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100111402 3300005435 Bacteria 2424
2 rootL2_10031117 3300003322 Bacteria 4104
3 rootL2_10033961 3300003322 Bacteria 10305
4 rootL2_10110047 3300003322 Bacteria 1664
5 rootH1_10014934 3300003323 Bacteria 16432
6 JGI25404J52841_10009761 3300003659 Bacteria 2057
7 Ga0058863_10032759 3300004799 Bacteria 3240
8 Ga0058861_10029376 3300004800 Bacteria 1266
9 Ga0058862_12650850 3300004803 Bacteria 1066
10 Ga0058862_12859001 3300004803 Bacteria 3318
11 Ga0070683_100012825 3300005329 Bacteria 7294
12 Ga0070683_100024987 3300005329 Bacteria 5358
13 Ga0070683_100056927 3300005329 Bacteria 3631
14 Ga0070683_100270691 3300005329 Unclassified 1616
15 Ga0070683_100596360 3300005329 Bacteria 1057
16 Ga0070683_100859276 3300005329 Bacteria 870
17 Ga0070690_100149200 3300005330 Bacteria 1594
18 Ga0070690_100251961 3300005330 Bacteria 1249
19 Ga0070670_100008411 3300005331 Bacteria 8796
20 Ga0068869_101024647 3300005334 Bacteria 720
21 Ga0070666_10126744 3300005335 Bacteria 1772
22 Ga0070680_100024507 3300005336 Bacteria 4821
23 Ga0070680_100126717 3300005336 Bacteria 2134
24 Ga0070680_100580343 3300005336 Bacteria 962
25 Ga0070680_101512936 3300005336 Bacteria 581
26 Ga0070682_100010752 3300005337 Bacteria 5205
27 Ga0070660_100020159 3300005339 Bacteria 4896
28 Ga0070689_100127275 3300005340 Bacteria 2039
29 Ga0070689_101849991 3300005340 Bacteria 551
30 Ga0070687_100813852 3300005343 Bacteria 663
31 Ga0070661_100100903 3300005344 Bacteria 2146
32 Ga0070661_100870557 3300005344 Bacteria 742
33 Ga0070668_100944767 3300005347 Bacteria 772
34 Ga0070675_100041543 3300005354 Bacteria 3756
35 Ga0070671_100497776 3300005355 Bacteria 1048
36 Ga0070674_101265397 3300005356 Bacteria 657
37 Ga0070673_100007403 3300005364 Bacteria 7236
38 Ga0070673_100286777 3300005364 Bacteria 1446
39 Ga0070673_100623859 3300005364 Bacteria 985
40 Ga0070688_100009049 3300005365 Bacteria 5430
41 Ga0070667_100206137 3300005367 Bacteria 1746
42 Ga0070667_100227566 3300005367 Bacteria 1662
43 Ga0070709_10010971 3300005434 Bacteria 5032
44 Ga0070705_100402208 3300005440 Bacteria 1014
45 Ga0070708_100000494 3300005445 Bacteria 29731
46 Ga0070708_100664938 3300005445 Bacteria 981
47 Ga0070663_100387145 3300005455 Bacteria 1140
48 Ga0070678_100732665 3300005456 Bacteria 893
49 Ga0070678_101008026 3300005456 Bacteria 766
50 Ga0070662_100019485 3300005457 Bacteria 4606
51 Ga0070681_10004438 3300005458 Bacteria 13364
52 Ga0070681_10029352 3300005458 Bacteria 5523
53 Ga0070681_10061105 3300005458 Bacteria 3744
54 Ga0070685_10621407 3300005466 Bacteria 780
55 Ga0070706_100197676 3300005467 Bacteria 1878
56 Ga0070679_100001857 3300005530 Bacteria 18992
57 Ga0070679_100004565 3300005530 Bacteria 12789
58 Ga0070679_100024072 3300005530 Bacteria 5965
59 Ga0070679_100581990 3300005530 Bacteria 1063
60 Ga0070684_100047868 3300005535 Bacteria 3707
61 Ga0070684_100069700 3300005535 Bacteria 3092
62 Ga0070684_100103639 3300005535 Bacteria 2545
63 Ga0070684_100193321 3300005535 Bacteria 1852
64 Ga0070684_100243311 3300005535 Bacteria 1644
65 Ga0070684_100255050 3300005535 Bacteria 1603
66 Ga0070684_100506800 3300005535 Bacteria 1118
67 Ga0070686_100142072 3300005544 Bacteria 1672
68 Ga0070695_100064459 3300005545 Bacteria 2384
69 Ga0070696_100000289 3300005546 Bacteria 30405
70 Ga0070693_100006910 3300005547 Bacteria 5518
71 Ga0070665_100068008 3300005548 Bacteria 3572
72 Ga0070665_100358276 3300005548 Bacteria 1464
73 Ga0068855_100187902 3300005563 Bacteria 2332
74 Ga0070664_100074197 3300005564 Bacteria 2920
75 Ga0070664_100086790 3300005564 Unclassified 2704
76 Ga0070664_100654097 3300005564 Bacteria 977
77 Ga0070664_100827237 3300005564 Bacteria 866
78 Ga0068856_100079040 3300005614 Bacteria 3261
79 Ga0068856_100121434 3300005614 Bacteria 2614
80 Ga0068856_101403008 3300005614 Bacteria 713
81 Ga0070702_100008765 3300005615 Bacteria 4917
82 Ga0070702_100541827 3300005615 Bacteria 862
83 Ga0068852_100080241 3300005616 Bacteria 2892
84 Ga0068859_100024088 3300005617 Bacteria 6108
85 Ga0068859_101216077 3300005617 Bacteria 830
86 Ga0068866_10863047 3300005718 Bacteria 634
87 Ga0068860_100020204 3300005843 Bacteria 6455
88 Ga0081540_1005479 3300005983 Bacteria 9470
89 Ga0081540_1031094 3300005983 Bacteria 2944
90 Ga0081540_1053744 3300005983 Bacteria 1973
91 Ga0070717_10334111 3300006028 Bacteria 1352
92 Ga0070716_100097312 3300006173 Bacteria 1796
93 Ga0097621_100762020 3300006237 Bacteria 894
94 Ga0097621_101054144 3300006237 Bacteria 762
95 Ga0068871_100182402 3300006358 Bacteria 1804
96 Ga0075430_100139716 3300006846 Bacteria 2017
97 Ga0075431_100142684 3300006847 Bacteria 2469
98 Ga0075433_10068524 3300006852 Bacteria 3115
99 Ga0068865_100214398 3300006881 Bacteria 1502
100 Ga0097620_100024088 3300006931 Bacteria 6108
101 Ga0097620_101216076 3300006931 Bacteria 830
102 Ga0075435_100506290 3300007076 Bacteria 1044
103 Ga0105245_10014485 3300009098 Bacteria 6868
104 Ga0105245_10306877 3300009098 Bacteria 1559
105 Ga0105243_10286293 3300009148 Bacteria 1487
106 Ga0105243_10761868 3300009148 Bacteria 950
107 Ga0105241_10037359 3300009174 Bacteria 3658
108 Ga0105241_11547553 3300009174 Bacteria 640
109 Ga0105242_10296316 3300009176 Bacteria 1474
110 Ga0105242_10334988 3300009176 Bacteria 1393
111 Ga0105248_10021923 3300009177 Bacteria 7078
112 Ga0105248_10536658 3300009177 Bacteria 1319
113 Ga0105248_10730201 3300009177 Bacteria 1117
114 Ga0105237_10262707 3300009545 Bacteria 1729
115 Ga0105238_12389455 3300009551 Bacteria 564
116 Ga0105249_10926245 3300009553 Bacteria 939
117 Ga0099796_10024787 3300010159 Bacteria 1887
118 Ga0105239_10687755 3300010375 Bacteria 1169
119 Ga0105239_11681939 3300010375 Bacteria 734
120 Ga0105246_10068452 3300011119 Bacteria 2490
121 Ga0105246_10133341 3300011119 Bacteria 1858
122 Ga0157373_10028569 3300013100 Bacteria 4023
123 Ga0157373_10312598 3300013100 Bacteria 1117
124 Ga0157370_10086558 3300013104 Bacteria 2944
125 Ga0157370_10098753 3300013104 Bacteria 2737
126 Ga0157370_10848312 3300013104 Bacteria 830
127 Ga0157369_10234203 3300013105 Bacteria 1919
128 Ga0157369_10598761 3300013105 Bacteria 1138
129 Ga0157369_11605615 3300013105 Bacteria 661
130 Ga0157374_10721824 3300013296 Bacteria 1010
131 Ga0157378_11819558 3300013297 Bacteria 657
132 Ga0157378_12591636 3300013297 Bacteria 559
133 Ga0163162_10539488 3300013306 Bacteria 1295
134 Ga0157372_10003395 3300013307 Bacteria 17187
135 Ga0157372_10022621 3300013307 Bacteria 6804
136 Ga0157372_10342487 3300013307 Bacteria 1741
137 Ga0157372_10481173 3300013307 Bacteria 1447
138 Ga0157372_10865043 3300013307 Bacteria 1049
139 Ga0157372_10922411 3300013307 Bacteria 1013
140 Ga0157375_10066711 3300013308 Bacteria 3594
141 Ga0157375_10173212 3300013308 Bacteria 2306
142 Ga0157375_10544698 3300013308 Bacteria 1322
143 Ga0157375_11159260 3300013308 Bacteria 906
144 Ga0163163_10041187 3300014325 Bacteria 4516
145 Ga0163163_10709289 3300014325 Bacteria 1070
146 Ga0163163_10853720 3300014325 Bacteria 974
147 Ga0157380_10392505 3300014326 Bacteria 1314
148 Ga0157377_10122357 3300014745 Bacteria 1579
149 Ga0157376_10018950 3300014969 Bacteria 5291
150 Ga0157376_10357491 3300014969 Bacteria 1400
151 Ga0157376_10735482 3300014969 Bacteria 994
152 Ga0182007_10162035 3300015262 Bacteria 765
153 Ga0213873_10000314 3300021358 Bacteria 8243
154 Ga0213872_10017536 3300021361 Bacteria 3307
155 Ga0213872_10067832 3300021361 Bacteria 1610
156 Ga0213874_10017392 3300021377 Bacteria 1928
157 Ga0213876_10022155 3300021384 Bacteria 3360
158 Ga0213871_10050474 3300021441 Bacteria 1138
159 Ga0209564_1027065 3300025295 Bacteria 1873
160 Ga0207692_10000427 3300025898 Bacteria 14774
161 Ga0207642_10527748 3300025899 Bacteria 726
162 Ga0207647_10170765 3300025904 Bacteria 1266
163 Ga0207699_10000213 3300025906 Bacteria 34254
164 Ga0207645_10150291 3300025907 Bacteria 1520
165 Ga0207705_10756443 3300025909 Bacteria 755
166 Ga0207707_10009363 3300025912 Bacteria 8496
167 Ga0207707_10025736 3300025912 Bacteria 5147
168 Ga0207707_10061052 3300025912 Bacteria 3280
169 Ga0207707_10697642 3300025912 Bacteria 852
170 Ga0207695_10101967 3300025913 Bacteria 2864
171 Ga0207693_10010945 3300025915 Bacteria 7350
172 Ga0207663_10012297 3300025916 Bacteria 4624
173 Ga0207660_10043349 3300025917 Bacteria 3162
174 Ga0207660_10139369 3300025917 Bacteria 1853
175 Ga0207662_10262666 3300025918 Bacteria 1137
176 Ga0207657_10023463 3300025919 Bacteria 5743
177 Ga0207649_10018032 3300025920 Bacteria 4006
178 Ga0207652_10005321 3300025921 Bacteria 10442
179 Ga0207652_10006050 3300025921 Bacteria 9795
180 Ga0207652_10049728 3300025921 Bacteria 3590
181 Ga0207652_10232723 3300025921 Bacteria 1661
182 Ga0207652_10321451 3300025921 Bacteria 1397
183 Ga0207646_11666326 3300025922 Bacteria 549
184 Ga0207694_10036296 3300025924 Bacteria 3782
185 Ga0207650_10674122 3300025925 Bacteria 872
186 Ga0207659_10302257 3300025926 Unclassified 1314
187 Ga0207687_10017035 3300025927 Bacteria 4777
188 Ga0207700_10099356 3300025928 Bacteria 2317
189 Ga0207664_10003422 3300025929 Bacteria 10577
190 Ga0207644_10745297 3300025931 Bacteria 818
191 Ga0207644_11637912 3300025931 Bacteria 540
192 Ga0207690_10973395 3300025932 Bacteria 705
193 Ga0207706_10071082 3300025933 Bacteria 3060
194 Ga0207706_10075649 3300025933 Bacteria 2961
195 Ga0207686_10102656 3300025934 Bacteria 1912
196 Ga0207686_10116904 3300025934 Bacteria 1808
197 Ga0207670_10100351 3300025936 Bacteria 2066
198 Ga0207665_10010201 3300025939 Bacteria 6168
199 Ga0207665_10242088 3300025939 Archaea 1329
200 Ga0207711_10207961 3300025941 Bacteria 1787
201 Ga0207689_10045647 3300025942 Bacteria 3622
202 Ga0207689_10216700 3300025942 Bacteria 1582
203 Ga0207661_10005343 3300025944 Bacteria 9043
204 Ga0207661_10014967 3300025944 Bacteria 5696
205 Ga0207661_10122822 3300025944 Bacteria 2213
206 Ga0207661_10249360 3300025944 Bacteria 1577
207 Ga0207661_10328323 3300025944 Bacteria 1376
208 Ga0207661_10379229 3300025944 Bacteria 1280
209 Ga0207661_10515401 3300025944 Bacteria 1093
210 Ga0207679_10059934 3300025945 Bacteria 2826
211 Ga0207679_10818004 3300025945 Bacteria 850
212 Ga0207667_10080584 3300025949 Bacteria 3373
213 Ga0207651_10170950 3300025960 Bacteria 1714
214 Ga0207668_10331808 3300025972 Bacteria 1266
215 Ga0207668_11299626 3300025972 Bacteria 655
216 Ga0207678_10251262 3300026067 Bacteria 1514
217 Ga0207702_10077274 3300026078 Bacteria 2879
218 Ga0207702_10410800 3300026078 Unclassified 1307
219 Ga0207648_10082795 3300026089 Bacteria 2798
220 Ga0207676_10123894 3300026095 Bacteria 2184
221 Ga0207676_10369896 3300026095 Bacteria 1331
222 Ga0207674_10001931 3300026116 Bacteria 26314
223 Ga0207674_10161318 3300026116 Bacteria 2196
224 Ga0207683_10292987 3300026121 Bacteria 1488
225 Ga0207683_10419960 3300026121 Bacteria 1232
226 Ga0207698_10542118 3300026142 Bacteria 1139
227 Ga0207428_10141857 3300027907 Bacteria 1833
228 Ga0268266_10047169 3300028379 Bacteria 3690
229 Ga0268266_10266276 3300028379 Bacteria 1590
230 Ga0268265_11410548 3300028380 Bacteria 699
231 Ga0268264_10377173 3300028381 Bacteria 1357
232 Ga0265337_1030410 3300028556 Bacteria 1608
233 Ga0265326_10015744 3300028558 Bacteria 2191
234 Ga0265319_1001014 3300028563 Bacteria 17548
235 Ga0265319_1001685 3300028563 Bacteria 12765
236 Ga0265319_1002881 3300028563 Bacteria 9188
237 Ga0265319_1011749 3300028563 Bacteria 3566
238 Ga0265319_1049898 3300028563 Bacteria 1384
239 Ga0265334_10005729 3300028573 Bacteria 5415
240 Ga0265334_10010638 3300028573 Bacteria 3884
241 Ga0265318_10001158 3300028577 Bacteria 16360
242 Ga0265318_10002409 3300028577 Bacteria 10004
243 Ga0265318_10005763 3300028577 Bacteria 5788
244 Ga0265318_10038052 3300028577 Bacteria 1841
245 Ga0265322_10031570 3300028654 Bacteria 1512
246 Ga0265336_10088368 3300028666 Bacteria 924
247 Ga0265338_10007620 3300028800 Bacteria 13362
248 Ga0265338_10082599 3300028800 Bacteria 2689
249 Ga0265338_10086852 3300028800 Bacteria 2601
250 Ga0265330_10003624 3300031235 Bacteria 8037
251 Ga0265332_10036124 3300031238 Bacteria 2145
252 Ga0265332_10216163 3300031238 Bacteria 795
253 Ga0265328_10006874 3300031239 Bacteria 4779
254 Ga0265328_10031108 3300031239 Bacteria 1985
255 Ga0265328_10078547 3300031239 Bacteria 1216
256 Ga0265320_10000575 3300031240 Bacteria 28210
257 Ga0265320_10007360 3300031240 Bacteria 6834
258 Ga0265320_10011301 3300031240 Bacteria 5260
259 Ga0265320_10014274 3300031240 Bacteria 4528
260 Ga0265320_10024753 3300031240 Bacteria 3168
261 Ga0265320_10096682 3300031240 Bacteria 1363
262 Ga0265325_10004359 3300031241 Bacteria 8957
263 Ga0265329_10001559 3300031242 Bacteria 10975
264 Ga0265340_10007496 3300031247 Bacteria 5923
265 Ga0265340_10035080 3300031247 Bacteria 2492
266 Ga0265339_10068859 3300031249 Bacteria 1890
267 Ga0265331_10004592 3300031250 Bacteria 8586
268 Ga0265331_10008083 3300031250 Bacteria 6009
269 Ga0265331_10096038 3300031250 Bacteria 1367
270 Ga0265316_10006913 3300031344 Bacteria 10763
271 Ga0265316_10060798 3300031344 Bacteria 2936
272 Ga0265316_10098940 3300031344 Bacteria 2219
273 Ga0265316_10186991 3300031344 Bacteria 1540
274 Ga0265316_10527086 3300031344 Unclassified 842
275 Ga0265313_10001119 3300031595 Bacteria 25614
276 Ga0265313_10003063 3300031595 Bacteria 13875
277 Ga0265313_10004776 3300031595 Bacteria 10210
278 Ga0265313_10006776 3300031595 Bacteria 8011
279 Ga0265313_10021622 3300031595 Bacteria 3514
280 Ga0265314_10010603 3300031711 Bacteria 7669
281 Ga0265314_10521630 3300031711 Bacteria 622
282 Ga0265342_10003518 3300031712 Bacteria 12809
283 Ga0265342_10014230 3300031712 Bacteria 5289
284 Ga0265342_10086331 3300031712 Bacteria 1804
285 Ga0265342_10088050 3300031712 Bacteria 1783
286 Ga0307409_100656861 3300031995 Bacteria 1043
287 Ga0307416_101194964 3300032002 Bacteria 866
288 Ga0307411_10789687 3300032005 Bacteria 835
289 Ga0373926_0124741 3300035083 Bacteria 972
290 Ga0373934_0044387 3300035086 Bacteria 1757
291 Ga0373923_0003560 3300035111 Bacteria 5013
292 Ga0373923_0184696 3300035111 Bacteria 959
293 Ga0373945_0500040 3300035116 Unclassified 542
294 Ga0373954_0061835 3300035118 Bacteria 1768
295 Ga0373954_0107020 3300035118 Bacteria 1351
296 Ga0373956_0004997 3300035119 Bacteria 5312
297 Ga0373956_0022145 3300035119 Bacteria 2716
298 Ga0373957_0135320 3300035120 Bacteria 1005
299 Ga0373955_0001186 3300035172 Bacteria 11101
300 Ga0373955_0007825 3300035172 Bacteria 4929
301 Ga0373955_0033854 3300035172 Bacteria 2693
302 Ga0373962_0193779 3300035242 Bacteria 685
303 Ga0373924_0000442 3300035410 Bacteria 12714
304 Ga0373924_0089787 3300035410 Bacteria 1314
305 Ga0373931_0029518 3300035691 Bacteria 2816
306 Ga0373935_0058419 3300035692 Bacteria 2464
307 Ga0373935_1117030 3300035692 Bacteria 587
308 Ga0373927_0215547 3300035695 Bacteria 1261
309 Ga0373933_0000501 3300035724 Bacteria 24379
310 Ga0373933_0027715 3300035724 Bacteria 3265
311 Ga0373947_0096074 3300035725 Bacteria 1855
312 Ga0373947_0565618 3300035725 Bacteria 774
313 Ga0373937_0000649 3300036401 Bacteria 30519
314 Ga0373937_0006774 3300036401 Bacteria 9891
315 Ga0373937_0428729 3300036401 Bacteria 1255
316 Ga0373925_0121458 3300037068 Bacteria 2028
317 Ga0436364_1347693 3300037853 Bacteria 1106
318 Ga0436365_0003491 3300039437 Bacteria 5126
319 Ga0436365_1926543 3300039437 Bacteria 3906
320 Ga0436360_0192702 3300039438 Bacteria 9450
321 Ga0436360_1059052 3300039438 Bacteria 964
322 Ga0436360_1344670 3300039438 Bacteria 2360
323 Ga0436361_0090190 3300039447 Bacteria 1714
324 Ga0436361_0900803 3300039447 Bacteria 1295
325 Ga0436361_0900950 3300039447 Bacteria 2346
326 Ga0436361_1179158 3300039447 Bacteria 4064
327 Ga0436363_1318239 3300039450 Bacteria 3403
328 Ga0436362_0105480 3300039453 Bacteria 14435
329 Ga0436362_1208409 3300039453 Bacteria 750
330 Ga0451807_1825705 3300041486 Bacteria 561
331 Ga0450898_038793 3300042134 Bacteria 895
332 Ga0439434_0171290 3300042435 Bacteria 724
333 Ga0450916_038562 3300042530 Bacteria 720
334 Ga0451577_0002349 3300042876 Bacteria 22746
335 Ga0453684_0000534 3300044712 Bacteria 144649
336 Ga0453684_0397407 3300044712 Bacteria 1544
337 Ga0466957_0383343 3300044842 Bacteria 959
338 Ga0451576_0000087 3300045051 Bacteria 234554
339 Ga0451576_0006613 3300045051 Bacteria 14171
340 Ga0451576_0096701 3300045051 Bacteria 3071
341 Ga0466967_0892437 3300045976 Bacteria 884
342 Ga0495629_0039594 3300046459 Bacteria 3317
343 Ga0495629_0176785 3300046459 Bacteria 1480
344 Ga0495629_0437856 3300046459 Unclassified 886
345 Ga0495629_0495676 3300046459 Bacteria 824
346 Ga0495651_0000045 3300046462 Bacteria 90367
347 Ga0495651_0116316 3300046462 Bacteria 1970
348 Ga0495653_0000093 3300046463 Bacteria 74824
349 Ga0495580_0156548 3300046472 Bacteria 1577
350 Ga0495582_0019325 3300046473 Bacteria 3725
351 Ga0495639_0027462 3300046475 Bacteria 2520
352 Ga0495639_0100441 3300046475 Bacteria 1365
353 Ga0495662_0117476 3300046476 Bacteria 1305
354 Ga0495664_0063602 3300046477 Bacteria 2199
355 Ga0495594_0063626 3300046499 Unclassified 2044
356 Ga0495594_0296993 3300046499 Bacteria 920
357 Ga0495594_0382315 3300046499 Bacteria 801
358 Ga0495608_0009509 3300046511 Bacteria 6791
359 Ga0495608_0224645 3300046511 Bacteria 1177
360 Ga0495618_0034143 3300046514 Bacteria 3189
361 Ga0495618_0156092 3300046514 Bacteria 1456
362 Ga0495620_0027451 3300046515 Bacteria 2663
363 Ga0495628_0000568 3300046516 Bacteria 33938
364 Ga0495628_0302667 3300046516 Bacteria 1183
365 Ga0495630_0005102 3300046517 Bacteria 9234
366 Ga0495630_0067126 3300046517 Bacteria 2696
367 Ga0495630_0485383 3300046517 Bacteria 947
368 Ga0495643_0006921 3300046522 Bacteria 7378
369 Ga0495648_0131506 3300046524 Bacteria 1330
370 Ga0495648_0414226 3300046524 Bacteria 599
371 Ga0495666_0026970 3300046526 Bacteria 2828
372 Ga0495642_0271760 3300046528 Bacteria 742
373 Ga0495652_0000166 3300046529 Bacteria 75721
374 Ga0495652_0085729 3300046529 Bacteria 2588
375 Ga0495654_0070660 3300046530 Bacteria 1655
376 Ga0495665_0018414 3300046531 Bacteria 3753
377 Ga0495665_0100274 3300046531 Bacteria 1520
378 Ga0495665_0654722 3300046531 Bacteria 523
379 Ga0495586_0034625 3300046535 Bacteria 2713
380 Ga0495586_0041267 3300046535 Bacteria 2485
381 Ga0495586_0071502 3300046535 Bacteria 1896
382 Ga0495587_0003696 3300046536 Bacteria 10179
383 Ga0495609_0019944 3300046538 Bacteria 3100
384 Ga0495609_0039159 3300046538 Bacteria 2135
385 Ga0495597_0011191 3300046542 Bacteria 4353
386 Ga0495597_0015635 3300046542 Bacteria 3591
387 Ga0495645_0000218 3300046543 Bacteria 41357
388 Ga0495645_0000833 3300046543 Bacteria 20988
389 Ga0495622_0000742 3300046557 Bacteria 18318
390 Ga0495667_0000788 3300046559 Bacteria 20352
391 Ga0495667_0031759 3300046559 Bacteria 3541
392 Ga0495634_0126343 3300046642 Bacteria 1634
393 Ga0495634_0147095 3300046642 Bacteria 1492
394 Ga0495611_0260891 3300046648 Bacteria 802
395 Ga0495611_0353789 3300046648 Bacteria 674
396 Ga0495625_0032162 3300046660 Bacteria 3895
397 Ga0495625_0101921 3300046660 Bacteria 1971
398 Ga0495635_0000043 3300046663 Bacteria 84495
399 Ga0495657_0000172 3300046675 Bacteria 58377
400 Ga0495599_0002832 3300046678 Bacteria 10102
401 Ga0495599_0028469 3300046678 Bacteria 3502
402 Ga0495623_0000120 3300046679 Bacteria 48263
403 Ga0495623_0017600 3300046679 Bacteria 4614
404 Ga0495646_0000732 3300046680 Bacteria 18243
405 Ga0495647_0398115 3300046681 Bacteria 632
406 Ga0495658_0278172 3300046683 Unclassified 1056
407 Ga0495613_0012865 3300046689 Bacteria 6220
408 Ga0495613_0388303 3300046689 Bacteria 954
409 Ga0495600_0000093 3300046809 Bacteria 48851
410 Ga0495600_0046252 3300046809 Bacteria 2840
411 Ga0495581_0015761 3300047315 Bacteria 4389
412 Ga0495581_0138697 3300047315 Bacteria 1418
413 Ga0495581_0216599 3300047315 Bacteria 1119
414 Ga0495581_0469207 3300047315 Bacteria 732
415 Ga0495604_0000166 3300047317 Bacteria 57892
416 Ga0495674_0000520 3300047319 Bacteria 35433
417 Ga0495674_0005433 3300047319 Bacteria 12239
418 Ga0495674_1076488 3300047319 Bacteria 613
419 Ga0495672_0000630 3300047320 Bacteria 39369
420 Ga0495672_0005815 3300047320 Bacteria 9682
421 Ga0495672_0136607 3300047320 Bacteria 1285
422 Ga0495680_0005857 3300047322 Bacteria 11504
423 Ga0495687_069531 3300047443 Bacteria 1417
424 Ga0495675_0003188 3300047444 Bacteria 9859
425 Ga0495675_0007016 3300047444 Bacteria 6925
426 Ga0495677_0225374 3300047445 Bacteria 731
427 Ga0495679_009921 3300047446 Bacteria 3776
428 Ga0495681_0063444 3300047470 Bacteria 1695
429 Ga0495684_0000034 3300047471 Bacteria 111355
430 Ga0495684_0067224 3300047471 Bacteria 2726
431 Ga0495684_0166140 3300047471 Unclassified 1644
432 Ga0495593_0127547 3300047673 Bacteria 1293
433 Ga0495602_0000684 3300048088 Bacteria 31846
434 Ga0495602_0834068 3300048088 Bacteria 617
435 Ga0495614_0336647 3300048089 Bacteria 702
436 Ga0495626_0016415 3300048091 Bacteria 3759
437 Ga0496108_0450249 3300048911 Bacteria 1125
438 Ga0496109_0111163 3300048912 Bacteria 2548
439 Ga0496111_1009034 3300048914 Bacteria 596
440 Ga0496112_0005535 3300048915 Bacteria 10944
441 Ga0496113_0050543 3300048916 Bacteria 3100
442 Ga0496115_1106998 3300048918 Bacteria 600
443 Ga0496119_0004112 3300048922 Bacteria 14658
444 Ga0496120_0243442 3300048923 Bacteria 848
445 Ga0496125_0025606 3300048928 Bacteria 5399
446 Ga0501308_033133 3300049128 Bacteria 701
447 Ga0495682_0124141 3300049460 Bacteria 924
448 Ga0501291_029558 3300049514 Bacteria 918
449 Ga0501032_0001213 3300049569 Bacteria 20627
450 Ga0501032_0013091 3300049569 Bacteria 5908
451 Ga0501033_0003055 3300049570 Bacteria 13918
452 Ga0501036_0791629 3300049572 Bacteria 781
453 Ga0501036_1179783 3300049572 Bacteria 624
454 Ga0501037_0021558 3300049573 Bacteria 4763
455 Ga0501037_0030523 3300049573 Bacteria 3983
456 Ga0501043_0105330 3300049579 Bacteria 2216
457 Ga0501043_0245453 3300049579 Bacteria 1380
458 Ga0501046_0004848 3300049580 Bacteria 12122
459 Ga0501067_0000546 3300049583 Bacteria 20441
460 Ga0501070_1052507 3300049586 Bacteria 629
461 Ga0501072_0153559 3300049588 Bacteria 1836
462 Ga0501073_0000004 3300049589 Bacteria 261794
463 Ga0501077_0000008 3300049593 Bacteria 106496
464 Ga0501230_057797 3300049667 Bacteria 781
465 Ga0501080_0065118 3300049742 Bacteria 3391
466 Ga0501083_0286745 3300049744 Bacteria 1071
467 Ga0501035_1091396 3300049822 Bacteria 624
468 Ga0501044_0007493 3300049823 Bacteria 12004
469 Ga0501044_0050528 3300049823 Bacteria 4289
470 Ga0501044_0773155 3300049823 Bacteria 841
471 nmdc:mga05p37_98070_c1 3300050507 Bacteria 3610
472 nmdc:mga09592_166276_c1 3300050508 Bacteria 1907
473 nmdc:mga0qj67_118310_c1 3300050509 Bacteria 2142
474 nmdc:mga0qj67_166645_c1 3300050509 Bacteria 1789
475 nmdc:mga06r32_156416_c1 3300050510 Bacteria 2261
476 nmdc:mga06r32_43798_c1 3300050510 Bacteria 4259
477 nmdc:mga0a205_201001_c1 3300050515 Bacteria 1883
478 Ga0495601_0043447 3300053077 Bacteria 2822
479 Ga0495612_0000690 3300053078 Bacteria 13635
480 Ga0500635_0000080 3300053080 Bacteria 63214
481 Ga0500578_0155143 3300053086 Bacteria 1424
482 Ga0500643_000276 3300053087 Bacteria 44463
483 Ga0500647_0229388 3300053091 Bacteria 827
484 Ga0500583_0051768 3300053092 Bacteria 1909
485 Ga0500566_0095711 3300053094 Bacteria 1635
486 Ga0500555_001650 3300053103 Bacteria 6740
487 Ga0500556_0001835 3300053104 Bacteria 7755
488 Ga0500569_002128 3300053109 Bacteria 3854
489 Ga0500595_006120 3300053119 Bacteria 5157
490 Ga0500597_184228 3300053120 Bacteria 884
491 Ga0500607_198653 3300053121 Bacteria 865
492 Ga0500608_060472 3300053122 Bacteria 1811
493 Ga0500614_002135 3300053123 Bacteria 4509
494 Ga0500618_000024 3300053125 Bacteria 152149
495 Ga0500642_0042020 3300053130 Bacteria 1980
496 Ga0500559_0003697 3300053136 Bacteria 7459
497 Ga0500559_0013894 3300053136 Bacteria 3405
498 Ga0500559_0155332 3300053136 Bacteria 1074
499 Ga0500568_0006998 3300053139 Bacteria 5583
500 Ga0500577_0325912 3300053142 Bacteria 671
501 Ga0500590_011497 3300053148 Bacteria 4485
502 Ga0500619_109727 3300053154 Bacteria 939
503 Ga0500638_205536 3300053162 Bacteria 829
504 Ga0500636_0005352 3300053177 Bacteria 7318
505 Ga0500636_0093513 3300053177 Bacteria 1719
506 Ga0500637_0032253 3300053178 Bacteria 2920
507 Ga0500625_072625 3300053729 Bacteria 1526
508 Ga0500596_000241 3300053735 Bacteria 9458
509 Ga0500601_015292 3300053737 Bacteria 872
510 Ga0500661_000098 3300055283 Bacteria 14033
511 Ga0501082_0102568 3300060353 Bacteria 2475
512 2643923250 2643221583 Bacteria 5218014
513 2788434762 2786546940 Bacteria 6396474
514 2884962571 2884960567 Bacteria 5437054
515 2894513719 2894510363 Bacteria 5121143
516 2919455402 2919450847 Bacteria 5631160
517 Ga0070714_100111402
518 rootL2_10031117
519 rootL2_10033961
520 rootL2_10110047
521 rootH1_10014934
522 JGI25404J52841_10009761
523 Ga0058863_10032759
524 Ga0058861_10029376
525 Ga0058862_12650850
526 Ga0058862_12859001
527 Ga0070683_100012825
528 Ga0070683_100024987
529 Ga0070683_100056927
530 Ga0070683_100270691
531 Ga0070683_100596360
532 Ga0070683_100859276
533 Ga0070690_100149200
534 Ga0070690_100251961
535 Ga0070670_100008411
536 Ga0068869_101024647
537 Ga0070666_10126744
538 Ga0070680_100024507
539 Ga0070680_100126717
540 Ga0070680_100580343
541 Ga0070680_101512936
542 Ga0070682_100010752
543 Ga0070660_100020159
544 Ga0070689_100127275
545 Ga0070689_101849991
546 Ga0070687_100813852
547 Ga0070661_100100903
548 Ga0070661_100870557
549 Ga0070668_100944767
550 Ga0070675_100041543
551 Ga0070671_100497776
552 Ga0070674_101265397
553 Ga0070673_100007403
554 Ga0070673_100286777
555 Ga0070673_100623859
556 Ga0070688_100009049
557 Ga0070667_100206137
558 Ga0070667_100227566
559 Ga0070709_10010971
560 Ga0070705_100402208
561 Ga0070708_100000494
562 Ga0070708_100664938
563 Ga0070663_100387145
564 Ga0070678_100732665
565 Ga0070678_101008026
566 Ga0070662_100019485
567 Ga0070681_10004438
568 Ga0070681_10029352
569 Ga0070681_10061105
570 Ga0070685_10621407
571 Ga0070706_100197676
572 Ga0070679_100001857
573 Ga0070679_100004565
574 Ga0070679_100024072
575 Ga0070679_100581990
576 Ga0070684_100047868
577 Ga0070684_100069700
578 Ga0070684_100103639
579 Ga0070684_100193321
580 Ga0070684_100243311
581 Ga0070684_100255050
582 Ga0070684_100506800
583 Ga0070686_100142072
584 Ga0070695_100064459
585 Ga0070696_100000289
586 Ga0070693_100006910
587 Ga0070665_100068008
588 Ga0070665_100358276
589 Ga0068855_100187902
590 Ga0070664_100074197
591 Ga0070664_100086790
592 Ga0070664_100654097
593 Ga0070664_100827237
594 Ga0068856_100079040
595 Ga0068856_100121434
596 Ga0068856_101403008
597 Ga0070702_100008765
598 Ga0070702_100541827
599 Ga0068852_100080241
600 Ga0068859_100024088
601 Ga0068859_101216077
602 Ga0068866_10863047
603 Ga0068860_100020204
604 Ga0081540_1005479
605 Ga0081540_1031094
606 Ga0081540_1053744
607 Ga0070717_10334111
608 Ga0070716_100097312
609 Ga0097621_100762020
610 Ga0097621_101054144
611 Ga0068871_100182402
612 Ga0075430_100139716
613 Ga0075431_100142684
614 Ga0075433_10068524
615 Ga0068865_100214398
616 Ga0097620_100024088
617 Ga0097620_101216076
618 Ga0075435_100506290
619 Ga0105245_10014485
620 Ga0105245_10306877
621 Ga0105243_10286293
622 Ga0105243_10761868
623 Ga0105241_10037359
624 Ga0105241_11547553
625 Ga0105242_10296316
626 Ga0105242_10334988
627 Ga0105248_10021923
628 Ga0105248_10536658
629 Ga0105248_10730201
630 Ga0105237_10262707
631 Ga0105238_12389455
632 Ga0105249_10926245
633 Ga0099796_10024787
634 Ga0105239_10687755
635 Ga0105239_11681939
636 Ga0105246_10068452
637 Ga0105246_10133341
638 Ga0157373_10028569
639 Ga0157373_10312598
640 Ga0157370_10086558
641 Ga0157370_10098753
642 Ga0157370_10848312
643 Ga0157369_10234203
644 Ga0157369_10598761
645 Ga0157369_11605615
646 Ga0157374_10721824
647 Ga0157378_11819558
648 Ga0157378_12591636
649 Ga0163162_10539488
650 Ga0157372_10003395
651 Ga0157372_10022621
652 Ga0157372_10342487
653 Ga0157372_10481173
654 Ga0157372_10865043
655 Ga0157372_10922411
656 Ga0157375_10066711
657 Ga0157375_10173212
658 Ga0157375_10544698
659 Ga0157375_11159260
660 Ga0163163_10041187
661 Ga0163163_10709289
662 Ga0163163_10853720
663 Ga0157380_10392505
664 Ga0157377_10122357
665 Ga0157376_10018950
666 Ga0157376_10357491
667 Ga0157376_10735482
668 Ga0182007_10162035
669 Ga0213873_10000314
670 Ga0213872_10017536
671 Ga0213872_10067832
672 Ga0213874_10017392
673 Ga0213876_10022155
674 Ga0213871_10050474
675 Ga0209564_1027065
676 Ga0207692_10000427
677 Ga0207642_10527748
678 Ga0207647_10170765
679 Ga0207699_10000213
680 Ga0207645_10150291
681 Ga0207705_10756443
682 Ga0207707_10009363
683 Ga0207707_10025736
684 Ga0207707_10061052
685 Ga0207707_10697642
686 Ga0207695_10101967
687 Ga0207693_10010945
688 Ga0207663_10012297
689 Ga0207660_10043349
690 Ga0207660_10139369
691 Ga0207662_10262666
692 Ga0207657_10023463
693 Ga0207649_10018032
694 Ga0207652_10005321
695 Ga0207652_10006050
696 Ga0207652_10049728
697 Ga0207652_10232723
698 Ga0207652_10321451
699 Ga0207646_11666326
700 Ga0207694_10036296
701 Ga0207650_10674122
702 Ga0207659_10302257
703 Ga0207687_10017035
704 Ga0207700_10099356
705 Ga0207664_10003422
706 Ga0207644_10745297
707 Ga0207644_11637912
708 Ga0207690_10973395
709 Ga0207706_10071082
710 Ga0207706_10075649
711 Ga0207686_10102656
712 Ga0207686_10116904
713 Ga0207670_10100351
714 Ga0207665_10010201
715 Ga0207665_10242088
716 Ga0207711_10207961
717 Ga0207689_10045647
718 Ga0207689_10216700
719 Ga0207661_10005343
720 Ga0207661_10014967
721 Ga0207661_10122822
722 Ga0207661_10249360
723 Ga0207661_10328323
724 Ga0207661_10379229
725 Ga0207661_10515401
726 Ga0207679_10059934
727 Ga0207679_10818004
728 Ga0207667_10080584
729 Ga0207651_10170950
730 Ga0207668_10331808
731 Ga0207668_11299626
732 Ga0207678_10251262
733 Ga0207702_10077274
734 Ga0207702_10410800
735 Ga0207648_10082795
736 Ga0207676_10123894
737 Ga0207676_10369896
738 Ga0207674_10001931
739 Ga0207674_10161318
740 Ga0207683_10292987
741 Ga0207683_10419960
742 Ga0207698_10542118
743 Ga0207428_10141857
744 Ga0268266_10047169
745 Ga0268266_10266276
746 Ga0268265_11410548
747 Ga0268264_10377173
748 Ga0265337_1030410
749 Ga0265326_10015744
750 Ga0265319_1001014
751 Ga0265319_1001685
752 Ga0265319_1002881
753 Ga0265319_1011749
754 Ga0265319_1049898
755 Ga0265334_10005729
756 Ga0265334_10010638
757 Ga0265318_10001158
758 Ga0265318_10002409
759 Ga0265318_10005763
760 Ga0265318_10038052
761 Ga0265322_10031570
762 Ga0265336_10088368
763 Ga0265338_10007620
764 Ga0265338_10082599
765 Ga0265338_10086852
766 Ga0265330_10003624
767 Ga0265332_10036124
768 Ga0265332_10216163
769 Ga0265328_10006874
770 Ga0265328_10031108
771 Ga0265328_10078547
772 Ga0265320_10000575
773 Ga0265320_10007360
774 Ga0265320_10011301
775 Ga0265320_10014274
776 Ga0265320_10024753
777 Ga0265320_10096682
778 Ga0265325_10004359
779 Ga0265329_10001559
780 Ga0265340_10007496
781 Ga0265340_10035080
782 Ga0265339_10068859
783 Ga0265331_10004592
784 Ga0265331_10008083
785 Ga0265331_10096038
786 Ga0265316_10006913
787 Ga0265316_10060798
788 Ga0265316_10098940
789 Ga0265316_10186991
790 Ga0265316_10527086
791 Ga0265313_10001119
792 Ga0265313_10003063
793 Ga0265313_10004776
794 Ga0265313_10006776
795 Ga0265313_10021622
796 Ga0265314_10010603
797 Ga0265314_10521630
798 Ga0265342_10003518
799 Ga0265342_10014230
800 Ga0265342_10086331
801 Ga0265342_10088050
802 Ga0307409_100656861
803 Ga0307416_101194964
804 Ga0307411_10789687
805 Ga0373926_0124741
806 Ga0373934_0044387
807 Ga0373923_0003560
808 Ga0373923_0184696
809 Ga0373945_0500040
810 Ga0373954_0061835
811 Ga0373954_0107020
812 Ga0373956_0004997
813 Ga0373956_0022145
814 Ga0373957_0135320
815 Ga0373955_0001186
816 Ga0373955_0007825
817 Ga0373955_0033854
818 Ga0373962_0193779
819 Ga0373924_0000442
820 Ga0373924_0089787
821 Ga0373931_0029518
822 Ga0373935_0058419
823 Ga0373935_1117030
824 Ga0373927_0215547
825 Ga0373933_0000501
826 Ga0373933_0027715
827 Ga0373947_0096074
828 Ga0373947_0565618
829 Ga0373937_0000649
830 Ga0373937_0006774
831 Ga0373937_0428729
832 Ga0373925_0121458
833 Ga0436364_1347693
834 Ga0436365_0003491
835 Ga0436365_1926543
836 Ga0436360_0192702
837 Ga0436360_1059052
838 Ga0436360_1344670
839 Ga0436361_0090190
840 Ga0436361_0900803
841 Ga0436361_0900950
842 Ga0436361_1179158
843 Ga0436363_1318239
844 Ga0436362_0105480
845 Ga0436362_1208409
846 Ga0451807_1825705
847 Ga0450898_038793
848 Ga0439434_0171290
849 Ga0450916_038562
850 Ga0451577_0002349
851 Ga0453684_0000534
852 Ga0453684_0397407
853 Ga0466957_0383343
854 Ga0451576_0000087
855 Ga0451576_0006613
856 Ga0451576_0096701
857 Ga0466967_0892437
858 Ga0495629_0039594
859 Ga0495629_0176785
860 Ga0495629_0437856
861 Ga0495629_0495676
862 Ga0495651_0000045
863 Ga0495651_0116316
864 Ga0495653_0000093
865 Ga0495580_0156548
866 Ga0495582_0019325
867 Ga0495639_0027462
868 Ga0495639_0100441
869 Ga0495662_0117476
870 Ga0495664_0063602
871 Ga0495594_0063626
872 Ga0495594_0296993
873 Ga0495594_0382315
874 Ga0495608_0009509
875 Ga0495608_0224645
876 Ga0495618_0034143
877 Ga0495618_0156092
878 Ga0495620_0027451
879 Ga0495628_0000568
880 Ga0495628_0302667
881 Ga0495630_0005102
882 Ga0495630_0067126
883 Ga0495630_0485383
884 Ga0495643_0006921
885 Ga0495648_0131506
886 Ga0495648_0414226
887 Ga0495666_0026970
888 Ga0495642_0271760
889 Ga0495652_0000166
890 Ga0495652_0085729
891 Ga0495654_0070660
892 Ga0495665_0018414
893 Ga0495665_0100274
894 Ga0495665_0654722
895 Ga0495586_0034625
896 Ga0495586_0041267
897 Ga0495586_0071502
898 Ga0495587_0003696
899 Ga0495609_0019944
900 Ga0495609_0039159
901 Ga0495597_0011191
902 Ga0495597_0015635
903 Ga0495645_0000218
904 Ga0495645_0000833
905 Ga0495622_0000742
906 Ga0495667_0000788
907 Ga0495667_0031759
908 Ga0495634_0126343
909 Ga0495634_0147095
910 Ga0495611_0260891
911 Ga0495611_0353789
912 Ga0495625_0032162
913 Ga0495625_0101921
914 Ga0495635_0000043
915 Ga0495657_0000172
916 Ga0495599_0002832
917 Ga0495599_0028469
918 Ga0495623_0000120
919 Ga0495623_0017600
920 Ga0495646_0000732
921 Ga0495647_0398115
922 Ga0495658_0278172
923 Ga0495613_0012865
924 Ga0495613_0388303
925 Ga0495600_0000093
926 Ga0495600_0046252
927 Ga0495581_0015761
928 Ga0495581_0138697
929 Ga0495581_0216599
930 Ga0495581_0469207
931 Ga0495604_0000166
932 Ga0495674_0000520
933 Ga0495674_0005433
934 Ga0495674_1076488
935 Ga0495672_0000630
936 Ga0495672_0005815
937 Ga0495672_0136607
938 Ga0495680_0005857
939 Ga0495687_069531
940 Ga0495675_0003188
941 Ga0495675_0007016
942 Ga0495677_0225374
943 Ga0495679_009921
944 Ga0495681_0063444
945 Ga0495684_0000034
946 Ga0495684_0067224
947 Ga0495684_0166140
948 Ga0495593_0127547
949 Ga0495602_0000684
950 Ga0495602_0834068
951 Ga0495614_0336647
952 Ga0495626_0016415
953 Ga0496108_0450249
954 Ga0496109_0111163
955 Ga0496111_1009034
956 Ga0496112_0005535
957 Ga0496113_0050543
958 Ga0496115_1106998
959 Ga0496119_0004112
960 Ga0496120_0243442
961 Ga0496125_0025606
962 Ga0501308_033133
963 Ga0495682_0124141
964 Ga0501291_029558
965 Ga0501032_0001213
966 Ga0501032_0013091
967 Ga0501033_0003055
968 Ga0501036_0791629
969 Ga0501036_1179783
970 Ga0501037_0021558
971 Ga0501037_0030523
972 Ga0501043_0105330
973 Ga0501043_0245453
974 Ga0501046_0004848
975 Ga0501067_0000546
976 Ga0501070_1052507
977 Ga0501072_0153559
978 Ga0501073_0000004
979 Ga0501077_0000008
980 Ga0501230_057797
981 Ga0501080_0065118
982 Ga0501083_0286745
983 Ga0501035_1091396
984 Ga0501044_0007493
985 Ga0501044_0050528
986 Ga0501044_0773155
987 nmdc:mga05p37_98070_c1
988 nmdc:mga09592_166276_c1
989 nmdc:mga0qj67_118310_c1
990 nmdc:mga0qj67_166645_c1
991 nmdc:mga06r32_156416_c1
992 nmdc:mga06r32_43798_c1
993 nmdc:mga0a205_201001_c1
994 Ga0495601_0043447
995 Ga0495612_0000690
996 Ga0500635_0000080
997 Ga0500578_0155143
998 Ga0500643_000276
999 Ga0500647_0229388
1000 Ga0500583_0051768
1001 Ga0500566_0095711
1002 Ga0500555_001650
1003 Ga0500556_0001835
1004 Ga0500569_002128
1005 Ga0500595_006120
1006 Ga0500597_184228
1007 Ga0500607_198653
1008 Ga0500608_060472
1009 Ga0500614_002135
1010 Ga0500618_000024
1011 Ga0500642_0042020
1012 Ga0500559_0003697
1013 Ga0500559_0013894
1014 Ga0500559_0155332
1015 Ga0500568_0006998
1016 Ga0500577_0325912
1017 Ga0500590_011497
1018 Ga0500619_109727
1019 Ga0500638_205536
1020 Ga0500636_0005352
1021 Ga0500636_0093513
1022 Ga0500637_0032253
1023 Ga0500625_072625
1024 Ga0500596_000241
1025 Ga0500601_015292
1026 Ga0500661_000098
1027 Ga0501082_0102568
1028 2643923250
1029 2788434762
1030 2884962571
1031 2894513719
1032 2919455402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

99

171

0.94

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

26

113

0.83

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

31

98

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9851 1 149
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9646 1 149
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9576 1 149
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.956 1 149
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9542 2 149
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.971 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9709 1 75 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9684 83 149 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9636 1 75 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9617 84 149 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7Y5QJI1-F1-model_v4 (2Fe-2S)-binding protein 0.9965 1 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9BKS3-F1-model_v4 (2Fe-2S)-binding protein 0.9961 1 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A2G5QP78-F1-model_v4 (2Fe-2S)-binding protein 0.9952 3 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A349TGJ4-F1-model_v4 (2Fe-2S)-binding protein 0.9952 1 141 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9949 1 149 GO:0046872
GO:0047121
GO:0051537

Map