F457968

General Info

Members Datasets Scaffolds Average Seq Length
516 228 1032 349

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100255318|Ga0070708_1002553181
Length 329
Sequence MTAKIPVGILGATGIVGQRFVQMLEHHPWFEIAWLAASDRSEGRSYAEAARWKLKTPIPSRVAEMRVSPATPEGAPKVIFAALDASIAVEMEPRFAAAGCAVVTNSSALRMQGDVPLVIPEVNHDHIKLIECQAWRKKSGGFVVTNPNCSAIGLVIVSGAGYPGVASLDILGNVIPYIAKEEEKMEEETRKLLGQLKGSGIIMGSFAMSAQCNRVAVEDGHTESVSIKLTKQAEPEEIIKAWNTFRSLPQELRLPSAPEQPVVYVTPSDRPQPRFDADRGNGMTTTVGRLRPCGVLDWKFTVLSHNTIRGAAGAALLNAELLKAQGYLQ

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.81
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 22.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100255318 3300005445 Bacteria 1647
2 MBSR1b_contig_7742423 2162886012 Bacteria 2456
3 JGI24751J29686_10000991 3300002459 Bacteria 6239
4 Ga0065715_10004417 3300005293 Bacteria 6690
5 Ga0070658_10101376 3300005327 Bacteria 2380
6 Ga0070676_10015163 3300005328 Bacteria 4249
7 Ga0070683_100001564 3300005329 Bacteria 17682
8 Ga0070683_100059326 3300005329 Unclassified 3555
9 Ga0070670_100030748 3300005331 Unclassified 4624
10 Ga0068869_100005664 3300005334 Bacteria 7874
11 Ga0068869_100052771 3300005334 Bacteria 2953
12 Ga0068869_100262738 3300005334 Unclassified 1382
13 Ga0070680_100347794 3300005336 Bacteria 1260
14 Ga0070682_100019066 3300005337 Unclassified 4019
15 Ga0068868_100006287 3300005338 Bacteria 8395
16 Ga0068868_100012075 3300005338 Bacteria 6307
17 Ga0068868_100014608 3300005338 Bacteria 5792
18 Ga0068868_100277474 3300005338 Unclassified 1418
19 Ga0070689_100004902 3300005340 Bacteria 9078
20 Ga0070687_100052393 3300005343 Bacteria 2118
21 Ga0070661_100000794 3300005344 Bacteria 22679
22 Ga0070668_100005232 3300005347 Bacteria 9626
23 Ga0070668_100037218 3300005347 Unclassified 3715
24 Ga0070669_100104435 3300005353 Unclassified 2142
25 Ga0070675_100004164 3300005354 Bacteria 10982
26 Ga0070671_100325758 3300005355 Unclassified 1309
27 Ga0070674_100026924 3300005356 Bacteria 3762
28 Ga0070688_100000826 3300005365 Bacteria 15332
29 Ga0070688_100059750 3300005365 Bacteria 2405
30 Ga0070659_100119025 3300005366 Unclassified 2137
31 Ga0070667_100007356 3300005367 Bacteria 9145
32 Ga0070709_10006783 3300005434 Bacteria 6248
33 Ga0070709_10014481 3300005434 Bacteria 4462
34 Ga0070709_10025695 3300005434 Bacteria 3482
35 Ga0070709_10084802 3300005434 Bacteria 2076
36 Ga0070714_100000453 3300005435 Bacteria 29849
37 Ga0070714_100001396 3300005435 Bacteria 17508
38 Ga0070714_100192820 3300005435 Bacteria 1860
39 Ga0070714_100317058 3300005435 Bacteria 1457
40 Ga0070714_100405235 3300005435 Bacteria 1290
41 Ga0070713_100000352 3300005436 Bacteria 29758
42 Ga0070713_100021997 3300005436 Bacteria 4918
43 Ga0070713_100086776 3300005436 Unclassified 2684
44 Ga0070710_10031128 3300005437 Bacteria 2877
45 Ga0070710_10118580 3300005437 Unclassified 1599
46 Ga0070710_10149808 3300005437 Bacteria 1438
47 Ga0070710_10228949 3300005437 Unclassified 1186
48 Ga0070711_100017710 3300005439 Bacteria 4539
49 Ga0070711_100047028 3300005439 Bacteria 2943
50 Ga0070711_100049821 3300005439 Bacteria 2869
51 Ga0070711_100070429 3300005439 Bacteria 2462
52 Ga0070711_100139148 3300005439 Bacteria 1818
53 Ga0070708_100000729 3300005445 Bacteria 24960
54 Ga0070708_100011469 3300005445 Bacteria 7213
55 Ga0070708_100011665 3300005445 Bacteria 7152
56 Ga0070708_100016177 3300005445 Bacteria 6183
57 Ga0070708_100017546 3300005445 Bacteria 5976
58 Ga0070708_100021879 3300005445 Bacteria 5416
59 Ga0070708_100096681 3300005445 Unclassified 2698
60 Ga0070663_100019711 3300005455 Bacteria 4453
61 Ga0070663_100065023 3300005455 Unclassified 2638
62 Ga0070678_100037932 3300005456 Bacteria 3388
63 Ga0070678_100088714 3300005456 Bacteria 2365
64 Ga0070662_100009829 3300005457 Bacteria 6268
65 Ga0070681_10000195 3300005458 Bacteria 47245
66 Ga0070681_10041737 3300005458 Archaea 4599
67 Ga0070681_10063382 3300005458 Bacteria 3668
68 Ga0070681_10067449 3300005458 Bacteria 3546
69 Ga0070681_10169453 3300005458 Unclassified 2105
70 Ga0068867_100030681 3300005459 Bacteria 3877
71 Ga0068867_100033305 3300005459 Bacteria 3730
72 Ga0070706_100000499 3300005467 Bacteria 45986
73 Ga0070706_100005702 3300005467 Bacteria 11841
74 Ga0070706_100224385 3300005467 Bacteria 1754
75 Ga0070706_100300467 3300005467 Bacteria 1498
76 Ga0070707_100002005 3300005468 Bacteria 19504
77 Ga0070707_100023721 3300005468 Bacteria 5803
78 Ga0070698_100000795 3300005471 Bacteria 34332
79 Ga0070698_100001258 3300005471 Bacteria 28295
80 Ga0070698_100167675 3300005471 Bacteria 2138
81 Ga0070699_100000621 3300005518 Bacteria 33511
82 Ga0070699_100001944 3300005518 Bacteria 18671
83 Ga0070699_100140635 3300005518 Unclassified 2131
84 Ga0070679_100006160 3300005530 Bacteria 11162
85 Ga0070679_100032726 3300005530 Bacteria 5145
86 Ga0070684_100000661 3300005535 Bacteria 23781
87 Ga0070697_100000237 3300005536 Bacteria 44549
88 Ga0070697_100000258 3300005536 Bacteria 42993
89 Ga0070697_100000397 3300005536 Bacteria 33764
90 Ga0070697_100010876 3300005536 Bacteria 7106
91 Ga0070697_100015413 3300005536 Bacteria 6001
92 Ga0070697_100027550 3300005536 Bacteria 4547
93 Ga0068853_100002656 3300005539 Bacteria 13478
94 Ga0070672_100006357 3300005543 Bacteria 7934
95 Ga0070686_100006812 3300005544 Bacteria 6362
96 Ga0070686_100037669 3300005544 Bacteria 3001
97 Ga0070686_100181326 3300005544 Bacteria 1496
98 Ga0070695_100014489 3300005545 Bacteria 4752
99 Ga0070695_100240045 3300005545 Bacteria 1314
100 Ga0070696_100020933 3300005546 Bacteria 4433
101 Ga0070693_100025954 3300005547 Bacteria 3157
102 Ga0070693_100036019 3300005547 Bacteria 2748
103 Ga0070665_100014107 3300005548 Bacteria 8032
104 Ga0070704_100194792 3300005549 Bacteria 1632
105 Ga0068855_100000978 3300005563 Bacteria 35574
106 Ga0068855_100005912 3300005563 Bacteria 14919
107 Ga0068855_100040133 3300005563 Bacteria 5556
108 Ga0070664_100001252 3300005564 Bacteria 20328
109 Ga0070664_100075947 3300005564 Unclassified 2886
110 Ga0068857_100000437 3300005577 Bacteria 29548
111 Ga0068857_100007487 3300005577 Bacteria 9399
112 Ga0068857_100115261 3300005577 Bacteria 2417
113 Ga0068857_100214565 3300005577 Unclassified 1756
114 Ga0068857_100218555 3300005577 Unclassified 1740
115 Ga0068854_100045460 3300005578 Unclassified 3122
116 Ga0068854_100076611 3300005578 Unclassified 2458
117 Ga0068856_100000107 3300005614 Bacteria 81707
118 Ga0068856_100000483 3300005614 Bacteria 44122
119 Ga0068856_100047585 3300005614 Bacteria 4225
120 Ga0068856_100153073 3300005614 Bacteria 2315
121 Ga0068852_100003925 3300005616 Bacteria 10448
122 Ga0068852_100078917 3300005616 Unclassified 2914
123 Ga0068859_100000951 3300005617 Bacteria 29624
124 Ga0068859_100060988 3300005617 Bacteria 3800
125 Ga0068864_100007554 3300005618 Bacteria 8957
126 Ga0068864_100011018 3300005618 Bacteria 7474
127 Ga0068866_10001489 3300005718 Bacteria 9977
128 Ga0068866_10005505 3300005718 Bacteria 5230
129 Ga0068861_100080384 3300005719 Bacteria 2550
130 Ga0068851_10009992 3300005834 Bacteria 4419
131 Ga0068870_10000594 3300005840 Bacteria 13777
132 Ga0068870_10197117 3300005840 Unclassified 1219
133 Ga0068863_100012494 3300005841 Bacteria 8196
134 Ga0068858_100002793 3300005842 Bacteria 17549
135 Ga0068858_100004335 3300005842 Bacteria 13924
136 Ga0068858_100059631 3300005842 Archaea 3527
137 Ga0068860_100004530 3300005843 Bacteria 14182
138 Ga0068862_100010269 3300005844 Bacteria 7725
139 Ga0068862_100245999 3300005844 Unclassified 1628
140 Ga0070717_10000911 3300006028 Bacteria 19630
141 Ga0070717_10022523 3300006028 Unclassified 4979
142 Ga0070717_10028000 3300006028 Bacteria 4507
143 Ga0070717_10048406 3300006028 Unclassified 3486
144 Ga0070717_10063933 3300006028 Bacteria 3055
145 Ga0070717_10076472 3300006028 Bacteria 2802
146 Ga0070717_10079817 3300006028 Bacteria 2744
147 Ga0070717_10444992 3300006028 Bacteria 1167
148 Ga0070716_100000557 3300006173 Bacteria 15604
149 Ga0070716_100003557 3300006173 Bacteria 7353
150 Ga0070716_100017624 3300006173 Bacteria 3706
151 Ga0070716_100088181 3300006173 Bacteria 1871
152 Ga0070712_100000193 3300006175 Bacteria 33852
153 Ga0070712_100000658 3300006175 Bacteria 20372
154 Ga0070712_100002784 3300006175 Bacteria 10800
155 Ga0097621_100002728 3300006237 Bacteria 12086
156 Ga0097621_100006566 3300006237 Bacteria 8261
157 Ga0097621_100023835 3300006237 Unclassified 4770
158 Ga0097621_100305750 3300006237 Unclassified 1406
159 Ga0068871_100000410 3300006358 Bacteria 29656
160 Ga0068871_100004799 3300006358 Bacteria 9452
161 Ga0068871_100023809 3300006358 Unclassified 4742
162 Ga0075428_100266677 3300006844 Bacteria 1843
163 Ga0075431_100022588 3300006847 Bacteria 6431
164 Ga0075433_10000909 3300006852 Bacteria 20857
165 Ga0075433_10063246 3300006852 Bacteria 3242
166 Ga0075434_100000080 3300006871 Bacteria 52022
167 Ga0075434_100000885 3300006871 Bacteria 23969
168 Ga0075434_100037043 3300006871 Unclassified 4827
169 Ga0068865_100019589 3300006881 Unclassified 4380
170 Ga0075436_100000709 3300006914 Bacteria 22091
171 Ga0075436_100039028 3300006914 Bacteria 3276
172 Ga0097620_100000951 3300006931 Bacteria 29624
173 Ga0097620_100060991 3300006931 Bacteria 3800
174 Ga0075435_100000142 3300007076 Bacteria 40637
175 Ga0075435_100000841 3300007076 Bacteria 19159
176 Ga0075435_100033516 3300007076 Bacteria 4062
177 Ga0105240_10002618 3300009093 Bacteria 28698
178 Ga0105240_10018860 3300009093 Bacteria 9237
179 Ga0105240_10159996 3300009093 Bacteria 2676
180 Ga0105240_10188847 3300009093 Unclassified 2424
181 Ga0105240_10298293 3300009093 Bacteria 1844
182 Ga0105240_10465273 3300009093 Unclassified 1412
183 Ga0111539_10375631 3300009094 Unclassified 1655
184 Ga0105245_10002658 3300009098 Bacteria 16090
185 Ga0105245_10004111 3300009098 Bacteria 12920
186 Ga0105245_10078506 3300009098 Unclassified 3012
187 Ga0105245_10101125 3300009098 Bacteria 2668
188 Ga0105247_10017515 3300009101 Unclassified 4297
189 Ga0105247_10020936 3300009101 Unclassified 3935
190 Ga0105243_10243996 3300009148 Bacteria 1600
191 Ga0105241_10003005 3300009174 Bacteria 12604
192 Ga0105241_10137141 3300009174 Bacteria 1988
193 Ga0105241_10203402 3300009174 Unclassified 1655
194 Ga0105248_10034297 3300009177 Bacteria 5673
195 Ga0105248_10054223 3300009177 Unclassified 4496
196 Ga0105248_10131010 3300009177 Bacteria 2829
197 Ga0105237_10019545 3300009545 Bacteria 6997
198 Ga0105237_10021096 3300009545 Bacteria 6701
199 Ga0105238_10000090 3300009551 Bacteria 102374
200 Ga0105238_10017430 3300009551 Bacteria 7299
201 Ga0105238_10040280 3300009551 Bacteria 4735
202 Ga0105249_10015904 3300009553 Bacteria 6668
203 Ga0105249_10160587 3300009553 Unclassified 2171
204 Ga0105239_10025239 3300010375 Bacteria 6545
205 Ga0105239_10036107 3300010375 Bacteria 5427
206 Ga0105246_10000592 3300011119 Bacteria 20112
207 Ga0157373_10005921 3300013100 Bacteria 9148
208 Ga0157373_10268405 3300013100 Bacteria 1208
209 Ga0157371_10017563 3300013102 Bacteria 5312
210 Ga0157371_10053241 3300013102 Bacteria 2874
211 Ga0157369_10005632 3300013105 Bacteria 14551
212 Ga0157369_10013615 3300013105 Bacteria 9201
213 Ga0157369_10060435 3300013105 Unclassified 4086
214 Ga0157374_10000097 3300013296 Bacteria 81947
215 Ga0157374_10000305 3300013296 Bacteria 45523
216 Ga0157374_10000997 3300013296 Bacteria 24569
217 Ga0157374_10014051 3300013296 Bacteria 7000
218 Ga0157374_10055917 3300013296 Bacteria 3684
219 Ga0157374_10323148 3300013296 Bacteria 1529
220 Ga0157378_10000265 3300013297 Bacteria 50886
221 Ga0157378_10000686 3300013297 Bacteria 31832
222 Ga0157378_10010398 3300013297 Bacteria 8126
223 Ga0157378_10045833 3300013297 Bacteria 3886
224 Ga0157378_10135153 3300013297 Unclassified 2286
225 Ga0157378_10174458 3300013297 Unclassified 2018
226 Ga0157378_10177161 3300013297 Unclassified 2003
227 Ga0163162_10004114 3300013306 Bacteria 13960
228 Ga0163162_10006230 3300013306 Bacteria 11564
229 Ga0163162_10091176 3300013306 Bacteria 3130
230 Ga0157372_10000766 3300013307 Bacteria 34848
231 Ga0157372_10001033 3300013307 Bacteria 30439
232 Ga0157372_10001319 3300013307 Bacteria 26869
233 Ga0157372_10007745 3300013307 Bacteria 11410
234 Ga0157372_10008029 3300013307 Bacteria 11224
235 Ga0157372_10039918 3300013307 Bacteria 5183
236 Ga0157372_10042592 3300013307 Archaea 5023
237 Ga0157372_10070516 3300013307 Bacteria 3932
238 Ga0157372_10187922 3300013307 Unclassified 2392
239 Ga0157372_10500522 3300013307 Bacteria 1417
240 Ga0157372_10621804 3300013307 Unclassified 1259
241 Ga0157375_10027623 3300013308 Bacteria 5307
242 Ga0157375_10219771 3300013308 Unclassified 2058
243 Ga0163163_10001245 3300014325 Bacteria 21449
244 Ga0163163_10077075 3300014325 Unclassified 3329
245 Ga0182008_10001046 3300014497 Bacteria 19199
246 Ga0182008_10012962 3300014497 Unclassified 4388
247 Ga0157377_10000498 3300014745 Bacteria 16694
248 Ga0157379_10005139 3300014968 Bacteria 11230
249 Ga0157379_10011871 3300014968 Bacteria 7611
250 Ga0157379_10039232 3300014968 Unclassified 4225
251 Ga0157376_10025960 3300014969 Bacteria 4622
252 Ga0157376_10117280 3300014969 Unclassified 2353
253 Ga0157376_10161096 3300014969 Unclassified 2034
254 Ga0182007_10012157 3300015262 Bacteria 3323
255 Ga0182007_10033018 3300015262 Unclassified 1756
256 Ga0182005_1017196 3300015265 Unclassified 2002
257 Ga0163161_10012772 3300017792 Bacteria 5833
258 Ga0207692_10014652 3300025898 Bacteria 3430
259 Ga0207692_10015012 3300025898 Unclassified 3398
260 Ga0207692_10083390 3300025898 Bacteria 1715
261 Ga0207642_10004132 3300025899 Bacteria 4657
262 Ga0207710_10015754 3300025900 Bacteria 3196
263 Ga0207710_10016177 3300025900 Bacteria 3155
264 Ga0207647_10000432 3300025904 Bacteria 34328
265 Ga0207699_10001214 3300025906 Bacteria 12229
266 Ga0207699_10004634 3300025906 Archaea 6575
267 Ga0207699_10010913 3300025906 Bacteria 4575
268 Ga0207699_10035512 3300025906 Bacteria 2837
269 Ga0207699_10052663 3300025906 Unclassified 2410
270 Ga0207699_10066461 3300025906 Bacteria 2189
271 Ga0207645_10001148 3300025907 Bacteria 21863
272 Ga0207645_10045014 3300025907 Unclassified 2822
273 Ga0207643_10000501 3300025908 Bacteria 25007
274 Ga0207684_10000132 3300025910 Bacteria 134931
275 Ga0207684_10001821 3300025910 Bacteria 22266
276 Ga0207684_10004860 3300025910 Bacteria 12570
277 Ga0207654_10004523 3300025911 Bacteria 7024
278 Ga0207654_10026179 3300025911 Unclassified 3156
279 Ga0207707_10001239 3300025912 Bacteria 23957
280 Ga0207707_10005687 3300025912 Bacteria 10909
281 Ga0207707_10037377 3300025912 Archaea 4243
282 Ga0207707_10362358 3300025912 Viruses 1248
283 Ga0207695_10003763 3300025913 Bacteria 21055
284 Ga0207695_10013360 3300025913 Bacteria 9798
285 Ga0207695_10021666 3300025913 Bacteria 7326
286 Ga0207695_10028837 3300025913 Bacteria 6144
287 Ga0207695_10271105 3300025913 Unclassified 1593
288 Ga0207671_10020714 3300025914 Bacteria 5002
289 Ga0207671_10199922 3300025914 Unclassified 1561
290 Ga0207693_10000350 3300025915 Bacteria 42606
291 Ga0207693_10002744 3300025915 Bacteria 15250
292 Ga0207693_10040090 3300025915 Unclassified 3688
293 Ga0207693_10065874 3300025915 Bacteria 2836
294 Ga0207663_10006194 3300025916 Bacteria 6097
295 Ga0207663_10012676 3300025916 Bacteria 4565
296 Ga0207663_10053130 3300025916 Bacteria 2530
297 Ga0207663_10132841 3300025916 Bacteria 1722
298 Ga0207663_10176780 3300025916 Bacteria 1521
299 Ga0207663_10211656 3300025916 Bacteria 1405
300 Ga0207662_10003990 3300025918 Bacteria 7693
301 Ga0207657_10001169 3300025919 Bacteria 27831
302 Ga0207657_10001964 3300025919 Bacteria 22198
303 Ga0207657_10002323 3300025919 Bacteria 20608
304 Ga0207649_10000374 3300025920 Bacteria 33445
305 Ga0207646_10000301 3300025922 Bacteria 67088
306 Ga0207646_10001216 3300025922 Bacteria 32388
307 Ga0207646_10128785 3300025922 Bacteria 2277
308 Ga0207694_10035217 3300025924 Unclassified 3840
309 Ga0207694_10057257 3300025924 Unclassified 3030
310 Ga0207694_10239054 3300025924 Bacteria 1484
311 Ga0207650_10000045 3300025925 Bacteria 181507
312 Ga0207687_10005572 3300025927 Bacteria 8318
313 Ga0207687_10005776 3300025927 Bacteria 8188
314 Ga0207687_10032039 3300025927 Bacteria 3557
315 Ga0207687_10202591 3300025927 Unclassified 1552
316 Ga0207687_10212881 3300025927 Bacteria 1517
317 Ga0207700_10004605 3300025928 Bacteria 8163
318 Ga0207700_10015826 3300025928 Unclassified 4990
319 Ga0207700_10127711 3300025928 Bacteria 2071
320 Ga0207700_10341540 3300025928 Bacteria 1302
321 Ga0207664_10000037 3300025929 Bacteria 171467
322 Ga0207664_10110605 3300025929 Bacteria 2284
323 Ga0207664_10358110 3300025929 Bacteria 1292
324 Ga0207706_10000414 3300025933 Bacteria 45687
325 Ga0207706_10000432 3300025933 Bacteria 44915
326 Ga0207706_10014037 3300025933 Bacteria 7264
327 Ga0207669_10019116 3300025937 Bacteria 3559
328 Ga0207704_10077939 3300025938 Bacteria 2130
329 Ga0207665_10003706 3300025939 Bacteria 10203
330 Ga0207665_10013388 3300025939 Bacteria 5393
331 Ga0207665_10137558 3300025939 Archaea 1739
332 Ga0207665_10152383 3300025939 Bacteria 1657
333 Ga0207665_10163364 3300025939 Unclassified 1603
334 Ga0207691_10000151 3300025940 Bacteria 64391
335 Ga0207711_10000650 3300025941 Bacteria 34674
336 Ga0207711_10013585 3300025941 Bacteria 6763
337 Ga0207689_10000129 3300025942 Bacteria 63859
338 Ga0207689_10011670 3300025942 Bacteria 7531
339 Ga0207661_10000099 3300025944 Bacteria 54986
340 Ga0207661_10157779 3300025944 Bacteria 1967
341 Ga0207661_10250010 3300025944 Unclassified 1575
342 Ga0207679_10000096 3300025945 Bacteria 76971
343 Ga0207679_10030308 3300025945 Bacteria 3776
344 Ga0207679_10122796 3300025945 Unclassified 2070
345 Ga0207667_10007050 3300025949 Bacteria 13581
346 Ga0207667_10008001 3300025949 Bacteria 12613
347 Ga0207667_10025672 3300025949 Bacteria 6447
348 Ga0207667_10064454 3300025949 Bacteria 3826
349 Ga0207651_10022946 3300025960 Bacteria 3828
350 Ga0207668_10025114 3300025972 Unclassified 3852
351 Ga0207640_10146588 3300025981 Bacteria 1728
352 Ga0207640_10180641 3300025981 Unclassified 1581
353 Ga0207658_10009251 3300025986 Bacteria 6682
354 Ga0207677_10007414 3300026023 Bacteria 6065
355 Ga0207677_10025023 3300026023 Unclassified 3718
356 Ga0207703_10011851 3300026035 Bacteria 6789
357 Ga0207703_10321798 3300026035 Unclassified 1416
358 Ga0207639_10010305 3300026041 Bacteria 6469
359 Ga0207639_10133215 3300026041 Bacteria 2060
360 Ga0207678_10000026 3300026067 Bacteria 116850
361 Ga0207678_10000722 3300026067 Bacteria 30161
362 Ga0207702_10000103 3300026078 Bacteria 99037
363 Ga0207702_10043743 3300026078 Bacteria 3762
364 Ga0207702_10140781 3300026078 Unclassified 2182
365 Ga0207702_10534440 3300026078 Unclassified 1145
366 Ga0207641_10000075 3300026088 Bacteria 145149
367 Ga0207641_10011551 3300026088 Bacteria 7248
368 Ga0207641_10034491 3300026088 Bacteria 4210
369 Ga0207648_10002645 3300026089 Bacteria 19126
370 Ga0207648_10013458 3300026089 Bacteria 7611
371 Ga0207648_10059219 3300026089 Unclassified 3340
372 Ga0207676_10000096 3300026095 Bacteria 80353
373 Ga0207676_10001149 3300026095 Bacteria 19942
374 Ga0207674_10000246 3300026116 Bacteria 67486
375 Ga0207674_10092020 3300026116 Bacteria 3022
376 Ga0207674_10321439 3300026116 Unclassified 1497
377 Ga0207675_100009570 3300026118 Bacteria 9064
378 Ga0207683_10000259 3300026121 Bacteria 47186
379 Ga0207683_10127513 3300026121 Bacteria 2288
380 Ga0207683_10161104 3300026121 Bacteria 2028
381 Ga0207698_10039929 3300026142 Bacteria 3481
382 Ga0207698_10070329 3300026142 Bacteria 2772
383 Ga0268266_10001241 3300028379 Bacteria 31189
384 Ga0268266_10043250 3300028379 Unclassified 3849
385 Ga0268265_10008564 3300028380 Bacteria 6915
386 Ga0268264_10010842 3300028381 Bacteria 7531
387 Ga0268264_10013181 3300028381 Bacteria 6801
388 Ga0265338_10008367 3300028800 Bacteria 12569
389 Ga0265338_10060100 3300028800 Unclassified 3342
390 Ga0265762_1000418 3300030760 Bacteria 7364
391 Ga0265762_1005623 3300030760 Bacteria 2250
392 Ga0265330_10006625 3300031235 Bacteria 5714
393 Ga0265325_10028955 3300031241 Unclassified 2980
394 Ga0265339_10006959 3300031249 Bacteria 7356
395 Ga0265339_10022771 3300031249 Bacteria 3625
396 Ga0265316_10012016 3300031344 Bacteria 7782
397 Ga0265316_10018493 3300031344 Bacteria 5986
398 Ga0265316_10185329 3300031344 Bacteria 1548
399 Ga0307408_100010950 3300031548 Bacteria 5985
400 Ga0265314_10021165 3300031711 Bacteria 5008
401 Ga0265314_10032533 3300031711 Unclassified 3835
402 Ga0265314_10071417 3300031711 Unclassified 2323
403 Ga0307405_10167631 3300031731 Bacteria 1563
404 Ga0307410_10002454 3300031852 Bacteria 8953
405 Ga0307410_10058659 3300031852 Bacteria 2625
406 Ga0307406_10018383 3300031901 Bacteria 4084
407 Ga0307406_10134288 3300031901 Bacteria 1742
408 Ga0307407_10027815 3300031903 Bacteria 3015
409 Ga0307409_100018926 3300031995 Bacteria 4647
410 Ga0307411_10009595 3300032005 Bacteria 5103
411 Ga0307411_10016342 3300032005 Bacteria 4198
412 Ga0373949_0024687 3300035090 Bacteria 1399
413 Ga0373923_0001957 3300035111 Bacteria 6177
414 Ga0373936_0002705 3300035113 Bacteria 6616
415 Ga0373945_0003294 3300035116 Bacteria 5067
416 Ga0373943_0000148 3300035170 Bacteria 27189
417 Ga0373943_0005898 3300035170 Bacteria 5500
418 Ga0373943_0182149 3300035170 Unclassified 1155
419 Ga0373955_0263971 3300035172 Bacteria 1034
420 Ga0373962_0031724 3300035242 Bacteria 1451
421 Ga0373924_0008567 3300035410 Bacteria 3722
422 Ga0373931_0054038 3300035691 Unclassified 2145
423 Ga0373935_0013255 3300035692 Bacteria 4972
424 Ga0373927_0001079 3300035695 Bacteria 20827
425 Ga0373927_0010643 3300035695 Bacteria 6128
426 Ga0373947_0001340 3300035725 Bacteria 15143
427 Ga0373947_0075549 3300035725 Bacteria 2075
428 Ga0373937_0005591 3300036401 Bacteria 10785
429 Ga0373937_0104456 3300036401 Unclassified 2632
430 Ga0373925_0003241 3300037068 Bacteria 12703
431 Ga0373925_0035010 3300037068 Bacteria 3703
432 Ga0373925_0068345 3300037068 Unclassified 2682
433 Ga0373925_0095214 3300037068 Unclassified 2280
434 Ga0373925_0281856 3300037068 Bacteria 1339
435 Ga0395905_0459431 3300037471 Unclassified 1172
436 Ga0436364_1358914 3300037853 Bacteria 3510
437 Ga0436364_1422686 3300037853 Bacteria 1881
438 Ga0436365_1742197 3300039437 Bacteria 1572
439 Ga0436360_0963381 3300039438 Unclassified 2157
440 Ga0436363_0344425 3300039450 Bacteria 3076
441 Ga0436363_0671593 3300039450 Bacteria 2072
442 Ga0436363_1412803 3300039450 Bacteria 3616
443 Ga0436362_0466832 3300039453 Bacteria 4358
444 Ga0451577_0002003 3300042876 Bacteria 25351
445 Ga0451577_0078853 3300042876 Bacteria 2936
446 Ga0451577_0329150 3300042876 Bacteria 1386
447 Ga0453684_0000801 3300044712 Bacteria 107237
448 Ga0466957_0153110 3300044842 Bacteria 1493
449 Ga0466959_0054744 3300045049 Bacteria 2914
450 Ga0451576_0017986 3300045051 Bacteria 7756
451 Ga0466967_0000748 3300045976 Bacteria 16718
452 Ga0466967_0012847 3300045976 Bacteria 6436
453 Ga0495580_0004680 3300046472 Bacteria 11475
454 Ga0495580_0007428 3300046472 Bacteria 8810
455 Ga0495580_0010409 3300046472 Bacteria 7248
456 Ga0495580_0010830 3300046472 Bacteria 7077
457 Ga0495580_0025265 3300046472 Bacteria 4343
458 Ga0495580_0028865 3300046472 Unclassified 4031
459 Ga0495580_0053703 3300046472 Unclassified 2843
460 Ga0495580_0197975 3300046472 Bacteria 1385
461 Ga0495628_0064367 3300046516 Bacteria 2871
462 Ga0495656_0008810 3300046615 Unclassified 3616
463 Ga0495659_0026664 3300046664 Unclassified 1988
464 Ga0495659_0041545 3300046664 Unclassified 1643
465 Ga0495599_0154534 3300046678 Bacteria 1420
466 Ga0495623_0071914 3300046679 Unclassified 2151
467 Ga0495669_0004215 3300046684 Bacteria 5920
468 Ga0495669_0040707 3300046684 Unclassified 2062
469 Ga0495624_0039899 3300046690 Bacteria 3009
470 Ga0495674_0012788 3300047319 Bacteria 7903
471 Ga0495602_0060025 3300048088 Bacteria 3317
472 Ga0496100_0113760 3300048903 Unclassified 1884
473 Ga0496101_0287063 3300048904 Unclassified 1287
474 Ga0496102_0043716 3300048905 Unclassified 4063
475 Ga0496102_0064963 3300048905 Unclassified 3344
476 Ga0496102_0109263 3300048905 Unclassified 2577
477 Ga0496102_0167335 3300048905 Unclassified 2069
478 Ga0496102_0506566 3300048905 Unclassified 1129
479 Ga0496104_0067798 3300048907 Bacteria 3390
480 Ga0496104_0115822 3300048907 Unclassified 2572
481 Ga0496104_0178946 3300048907 Bacteria 2031
482 Ga0496104_0209313 3300048907 Unclassified 1862
483 Ga0496105_0133854 3300048908 Unclassified 2042
484 Ga0496105_0245958 3300048908 Bacteria 1450
485 Ga0496106_0045751 3300048909 Unclassified 3288
486 Ga0496106_0196435 3300048909 Bacteria 1605
487 Ga0496107_0072793 3300048910 Unclassified 2499
488 Ga0496107_0179500 3300048910 Unclassified 1572
489 Ga0496108_0000943 3300048911 Bacteria 22691
490 Ga0496108_0040400 3300048911 Unclassified 3889
491 Ga0496108_0062727 3300048911 Unclassified 3129
492 Ga0496109_0000132 3300048912 Bacteria 76436
493 Ga0496110_0031229 3300048913 Bacteria 4595
494 Ga0496111_0016861 3300048914 Bacteria 5041
495 Ga0496112_0000448 3300048915 Bacteria 27454
496 Ga0496112_0031902 3300048915 Bacteria 5113
497 Ga0496112_0140525 3300048915 Bacteria 2384
498 Ga0496112_0508624 3300048915 Unclassified 1139
499 Ga0496113_0004662 3300048916 Bacteria 8456
500 Ga0496114_0026418 3300048917 Unclassified 4753
501 Ga0496115_0128705 3300048918 Bacteria 2086
502 Ga0501083_0036899 3300049744 Unclassified 3331
503 nmdc:mga06r32_372230_c1 3300050510 Unclassified 1412
504 nmdc:mga0n895_125_c1 3300050512 Bacteria 45661
505 nmdc:mga0n895_20822_c1 3300050512 Bacteria 6125
506 nmdc:mga0n895_34924_c1 3300050512 Unclassified 4843
507 nmdc:mga0rr50_1437_c1 3300050513 Bacteria 13098
508 nmdc:mga0rr50_30681_c1 3300050513 Bacteria 3809
509 nmdc:mga0rr50_7279_c1 3300050513 Bacteria 6809
510 nmdc:mga0rr50_80814_c1 3300050513 Bacteria 2507
511 nmdc:mga08x19_127451_c1 3300050514 Bacteria 1710
512 nmdc:mga08x19_1649_c1 3300050514 Bacteria 13778
513 nmdc:mga08x19_165396_c1 3300050514 Bacteria 1504
514 nmdc:mga08x19_29571_c1 3300050514 Bacteria 3437
515 nmdc:mga0a205_86680_c1 3300050515 Bacteria 3024
516 nmdc:mga0a205_9752_c1 3300050515 Bacteria 8797
517 Ga0070708_100255318
518 MBSR1b_contig_7742423
519 JGI24751J29686_10000991
520 Ga0065715_10004417
521 Ga0070658_10101376
522 Ga0070676_10015163
523 Ga0070683_100001564
524 Ga0070683_100059326
525 Ga0070670_100030748
526 Ga0068869_100005664
527 Ga0068869_100052771
528 Ga0068869_100262738
529 Ga0070680_100347794
530 Ga0070682_100019066
531 Ga0068868_100006287
532 Ga0068868_100012075
533 Ga0068868_100014608
534 Ga0068868_100277474
535 Ga0070689_100004902
536 Ga0070687_100052393
537 Ga0070661_100000794
538 Ga0070668_100005232
539 Ga0070668_100037218
540 Ga0070669_100104435
541 Ga0070675_100004164
542 Ga0070671_100325758
543 Ga0070674_100026924
544 Ga0070688_100000826
545 Ga0070688_100059750
546 Ga0070659_100119025
547 Ga0070667_100007356
548 Ga0070709_10006783
549 Ga0070709_10014481
550 Ga0070709_10025695
551 Ga0070709_10084802
552 Ga0070714_100000453
553 Ga0070714_100001396
554 Ga0070714_100192820
555 Ga0070714_100317058
556 Ga0070714_100405235
557 Ga0070713_100000352
558 Ga0070713_100021997
559 Ga0070713_100086776
560 Ga0070710_10031128
561 Ga0070710_10118580
562 Ga0070710_10149808
563 Ga0070710_10228949
564 Ga0070711_100017710
565 Ga0070711_100047028
566 Ga0070711_100049821
567 Ga0070711_100070429
568 Ga0070711_100139148
569 Ga0070708_100000729
570 Ga0070708_100011469
571 Ga0070708_100011665
572 Ga0070708_100016177
573 Ga0070708_100017546
574 Ga0070708_100021879
575 Ga0070708_100096681
576 Ga0070663_100019711
577 Ga0070663_100065023
578 Ga0070678_100037932
579 Ga0070678_100088714
580 Ga0070662_100009829
581 Ga0070681_10000195
582 Ga0070681_10041737
583 Ga0070681_10063382
584 Ga0070681_10067449
585 Ga0070681_10169453
586 Ga0068867_100030681
587 Ga0068867_100033305
588 Ga0070706_100000499
589 Ga0070706_100005702
590 Ga0070706_100224385
591 Ga0070706_100300467
592 Ga0070707_100002005
593 Ga0070707_100023721
594 Ga0070698_100000795
595 Ga0070698_100001258
596 Ga0070698_100167675
597 Ga0070699_100000621
598 Ga0070699_100001944
599 Ga0070699_100140635
600 Ga0070679_100006160
601 Ga0070679_100032726
602 Ga0070684_100000661
603 Ga0070697_100000237
604 Ga0070697_100000258
605 Ga0070697_100000397
606 Ga0070697_100010876
607 Ga0070697_100015413
608 Ga0070697_100027550
609 Ga0068853_100002656
610 Ga0070672_100006357
611 Ga0070686_100006812
612 Ga0070686_100037669
613 Ga0070686_100181326
614 Ga0070695_100014489
615 Ga0070695_100240045
616 Ga0070696_100020933
617 Ga0070693_100025954
618 Ga0070693_100036019
619 Ga0070665_100014107
620 Ga0070704_100194792
621 Ga0068855_100000978
622 Ga0068855_100005912
623 Ga0068855_100040133
624 Ga0070664_100001252
625 Ga0070664_100075947
626 Ga0068857_100000437
627 Ga0068857_100007487
628 Ga0068857_100115261
629 Ga0068857_100214565
630 Ga0068857_100218555
631 Ga0068854_100045460
632 Ga0068854_100076611
633 Ga0068856_100000107
634 Ga0068856_100000483
635 Ga0068856_100047585
636 Ga0068856_100153073
637 Ga0068852_100003925
638 Ga0068852_100078917
639 Ga0068859_100000951
640 Ga0068859_100060988
641 Ga0068864_100007554
642 Ga0068864_100011018
643 Ga0068866_10001489
644 Ga0068866_10005505
645 Ga0068861_100080384
646 Ga0068851_10009992
647 Ga0068870_10000594
648 Ga0068870_10197117
649 Ga0068863_100012494
650 Ga0068858_100002793
651 Ga0068858_100004335
652 Ga0068858_100059631
653 Ga0068860_100004530
654 Ga0068862_100010269
655 Ga0068862_100245999
656 Ga0070717_10000911
657 Ga0070717_10022523
658 Ga0070717_10028000
659 Ga0070717_10048406
660 Ga0070717_10063933
661 Ga0070717_10076472
662 Ga0070717_10079817
663 Ga0070717_10444992
664 Ga0070716_100000557
665 Ga0070716_100003557
666 Ga0070716_100017624
667 Ga0070716_100088181
668 Ga0070712_100000193
669 Ga0070712_100000658
670 Ga0070712_100002784
671 Ga0097621_100002728
672 Ga0097621_100006566
673 Ga0097621_100023835
674 Ga0097621_100305750
675 Ga0068871_100000410
676 Ga0068871_100004799
677 Ga0068871_100023809
678 Ga0075428_100266677
679 Ga0075431_100022588
680 Ga0075433_10000909
681 Ga0075433_10063246
682 Ga0075434_100000080
683 Ga0075434_100000885
684 Ga0075434_100037043
685 Ga0068865_100019589
686 Ga0075436_100000709
687 Ga0075436_100039028
688 Ga0097620_100000951
689 Ga0097620_100060991
690 Ga0075435_100000142
691 Ga0075435_100000841
692 Ga0075435_100033516
693 Ga0105240_10002618
694 Ga0105240_10018860
695 Ga0105240_10159996
696 Ga0105240_10188847
697 Ga0105240_10298293
698 Ga0105240_10465273
699 Ga0111539_10375631
700 Ga0105245_10002658
701 Ga0105245_10004111
702 Ga0105245_10078506
703 Ga0105245_10101125
704 Ga0105247_10017515
705 Ga0105247_10020936
706 Ga0105243_10243996
707 Ga0105241_10003005
708 Ga0105241_10137141
709 Ga0105241_10203402
710 Ga0105248_10034297
711 Ga0105248_10054223
712 Ga0105248_10131010
713 Ga0105237_10019545
714 Ga0105237_10021096
715 Ga0105238_10000090
716 Ga0105238_10017430
717 Ga0105238_10040280
718 Ga0105249_10015904
719 Ga0105249_10160587
720 Ga0105239_10025239
721 Ga0105239_10036107
722 Ga0105246_10000592
723 Ga0157373_10005921
724 Ga0157373_10268405
725 Ga0157371_10017563
726 Ga0157371_10053241
727 Ga0157369_10005632
728 Ga0157369_10013615
729 Ga0157369_10060435
730 Ga0157374_10000097
731 Ga0157374_10000305
732 Ga0157374_10000997
733 Ga0157374_10014051
734 Ga0157374_10055917
735 Ga0157374_10323148
736 Ga0157378_10000265
737 Ga0157378_10000686
738 Ga0157378_10010398
739 Ga0157378_10045833
740 Ga0157378_10135153
741 Ga0157378_10174458
742 Ga0157378_10177161
743 Ga0163162_10004114
744 Ga0163162_10006230
745 Ga0163162_10091176
746 Ga0157372_10000766
747 Ga0157372_10001033
748 Ga0157372_10001319
749 Ga0157372_10007745
750 Ga0157372_10008029
751 Ga0157372_10039918
752 Ga0157372_10042592
753 Ga0157372_10070516
754 Ga0157372_10187922
755 Ga0157372_10500522
756 Ga0157372_10621804
757 Ga0157375_10027623
758 Ga0157375_10219771
759 Ga0163163_10001245
760 Ga0163163_10077075
761 Ga0182008_10001046
762 Ga0182008_10012962
763 Ga0157377_10000498
764 Ga0157379_10005139
765 Ga0157379_10011871
766 Ga0157379_10039232
767 Ga0157376_10025960
768 Ga0157376_10117280
769 Ga0157376_10161096
770 Ga0182007_10012157
771 Ga0182007_10033018
772 Ga0182005_1017196
773 Ga0163161_10012772
774 Ga0207692_10014652
775 Ga0207692_10015012
776 Ga0207692_10083390
777 Ga0207642_10004132
778 Ga0207710_10015754
779 Ga0207710_10016177
780 Ga0207647_10000432
781 Ga0207699_10001214
782 Ga0207699_10004634
783 Ga0207699_10010913
784 Ga0207699_10035512
785 Ga0207699_10052663
786 Ga0207699_10066461
787 Ga0207645_10001148
788 Ga0207645_10045014
789 Ga0207643_10000501
790 Ga0207684_10000132
791 Ga0207684_10001821
792 Ga0207684_10004860
793 Ga0207654_10004523
794 Ga0207654_10026179
795 Ga0207707_10001239
796 Ga0207707_10005687
797 Ga0207707_10037377
798 Ga0207707_10362358
799 Ga0207695_10003763
800 Ga0207695_10013360
801 Ga0207695_10021666
802 Ga0207695_10028837
803 Ga0207695_10271105
804 Ga0207671_10020714
805 Ga0207671_10199922
806 Ga0207693_10000350
807 Ga0207693_10002744
808 Ga0207693_10040090
809 Ga0207693_10065874
810 Ga0207663_10006194
811 Ga0207663_10012676
812 Ga0207663_10053130
813 Ga0207663_10132841
814 Ga0207663_10176780
815 Ga0207663_10211656
816 Ga0207662_10003990
817 Ga0207657_10001169
818 Ga0207657_10001964
819 Ga0207657_10002323
820 Ga0207649_10000374
821 Ga0207646_10000301
822 Ga0207646_10001216
823 Ga0207646_10128785
824 Ga0207694_10035217
825 Ga0207694_10057257
826 Ga0207694_10239054
827 Ga0207650_10000045
828 Ga0207687_10005572
829 Ga0207687_10005776
830 Ga0207687_10032039
831 Ga0207687_10202591
832 Ga0207687_10212881
833 Ga0207700_10004605
834 Ga0207700_10015826
835 Ga0207700_10127711
836 Ga0207700_10341540
837 Ga0207664_10000037
838 Ga0207664_10110605
839 Ga0207664_10358110
840 Ga0207706_10000414
841 Ga0207706_10000432
842 Ga0207706_10014037
843 Ga0207669_10019116
844 Ga0207704_10077939
845 Ga0207665_10003706
846 Ga0207665_10013388
847 Ga0207665_10137558
848 Ga0207665_10152383
849 Ga0207665_10163364
850 Ga0207691_10000151
851 Ga0207711_10000650
852 Ga0207711_10013585
853 Ga0207689_10000129
854 Ga0207689_10011670
855 Ga0207661_10000099
856 Ga0207661_10157779
857 Ga0207661_10250010
858 Ga0207679_10000096
859 Ga0207679_10030308
860 Ga0207679_10122796
861 Ga0207667_10007050
862 Ga0207667_10008001
863 Ga0207667_10025672
864 Ga0207667_10064454
865 Ga0207651_10022946
866 Ga0207668_10025114
867 Ga0207640_10146588
868 Ga0207640_10180641
869 Ga0207658_10009251
870 Ga0207677_10007414
871 Ga0207677_10025023
872 Ga0207703_10011851
873 Ga0207703_10321798
874 Ga0207639_10010305
875 Ga0207639_10133215
876 Ga0207678_10000026
877 Ga0207678_10000722
878 Ga0207702_10000103
879 Ga0207702_10043743
880 Ga0207702_10140781
881 Ga0207702_10534440
882 Ga0207641_10000075
883 Ga0207641_10011551
884 Ga0207641_10034491
885 Ga0207648_10002645
886 Ga0207648_10013458
887 Ga0207648_10059219
888 Ga0207676_10000096
889 Ga0207676_10001149
890 Ga0207674_10000246
891 Ga0207674_10092020
892 Ga0207674_10321439
893 Ga0207675_100009570
894 Ga0207683_10000259
895 Ga0207683_10127513
896 Ga0207683_10161104
897 Ga0207698_10039929
898 Ga0207698_10070329
899 Ga0268266_10001241
900 Ga0268266_10043250
901 Ga0268265_10008564
902 Ga0268264_10010842
903 Ga0268264_10013181
904 Ga0265338_10008367
905 Ga0265338_10060100
906 Ga0265762_1000418
907 Ga0265762_1005623
908 Ga0265330_10006625
909 Ga0265325_10028955
910 Ga0265339_10006959
911 Ga0265339_10022771
912 Ga0265316_10012016
913 Ga0265316_10018493
914 Ga0265316_10185329
915 Ga0307408_100010950
916 Ga0265314_10021165
917 Ga0265314_10032533
918 Ga0265314_10071417
919 Ga0307405_10167631
920 Ga0307410_10002454
921 Ga0307410_10058659
922 Ga0307406_10018383
923 Ga0307406_10134288
924 Ga0307407_10027815
925 Ga0307409_100018926
926 Ga0307411_10009595
927 Ga0307411_10016342
928 Ga0373949_0024687
929 Ga0373923_0001957
930 Ga0373936_0002705
931 Ga0373945_0003294
932 Ga0373943_0000148
933 Ga0373943_0005898
934 Ga0373943_0182149
935 Ga0373955_0263971
936 Ga0373962_0031724
937 Ga0373924_0008567
938 Ga0373931_0054038
939 Ga0373935_0013255
940 Ga0373927_0001079
941 Ga0373927_0010643
942 Ga0373947_0001340
943 Ga0373947_0075549
944 Ga0373937_0005591
945 Ga0373937_0104456
946 Ga0373925_0003241
947 Ga0373925_0035010
948 Ga0373925_0068345
949 Ga0373925_0095214
950 Ga0373925_0281856
951 Ga0395905_0459431
952 Ga0436364_1358914
953 Ga0436364_1422686
954 Ga0436365_1742197
955 Ga0436360_0963381
956 Ga0436363_0344425
957 Ga0436363_0671593
958 Ga0436363_1412803
959 Ga0436362_0466832
960 Ga0451577_0002003
961 Ga0451577_0078853
962 Ga0451577_0329150
963 Ga0453684_0000801
964 Ga0466957_0153110
965 Ga0466959_0054744
966 Ga0451576_0017986
967 Ga0466967_0000748
968 Ga0466967_0012847
969 Ga0495580_0004680
970 Ga0495580_0007428
971 Ga0495580_0010409
972 Ga0495580_0010830
973 Ga0495580_0025265
974 Ga0495580_0028865
975 Ga0495580_0053703
976 Ga0495580_0197975
977 Ga0495628_0064367
978 Ga0495656_0008810
979 Ga0495659_0026664
980 Ga0495659_0041545
981 Ga0495599_0154534
982 Ga0495623_0071914
983 Ga0495669_0004215
984 Ga0495669_0040707
985 Ga0495624_0039899
986 Ga0495674_0012788
987 Ga0495602_0060025
988 Ga0496100_0113760
989 Ga0496101_0287063
990 Ga0496102_0043716
991 Ga0496102_0064963
992 Ga0496102_0109263
993 Ga0496102_0167335
994 Ga0496102_0506566
995 Ga0496104_0067798
996 Ga0496104_0115822
997 Ga0496104_0178946
998 Ga0496104_0209313
999 Ga0496105_0133854
1000 Ga0496105_0245958
1001 Ga0496106_0045751
1002 Ga0496106_0196435
1003 Ga0496107_0072793
1004 Ga0496107_0179500
1005 Ga0496108_0000943
1006 Ga0496108_0040400
1007 Ga0496108_0062727
1008 Ga0496109_0000132
1009 Ga0496110_0031229
1010 Ga0496111_0016861
1011 Ga0496112_0000448
1012 Ga0496112_0031902
1013 Ga0496112_0140525
1014 Ga0496112_0508624
1015 Ga0496113_0004662
1016 Ga0496114_0026418
1017 Ga0496115_0128705
1018 Ga0501083_0036899
1019 nmdc:mga06r32_372230_c1
1020 nmdc:mga0n895_125_c1
1021 nmdc:mga0n895_20822_c1
1022 nmdc:mga0n895_34924_c1
1023 nmdc:mga0rr50_1437_c1
1024 nmdc:mga0rr50_30681_c1
1025 nmdc:mga0rr50_7279_c1
1026 nmdc:mga0rr50_80814_c1
1027 nmdc:mga08x19_127451_c1
1028 nmdc:mga08x19_1649_c1
1029 nmdc:mga08x19_165396_c1
1030 nmdc:mga08x19_29571_c1
1031 nmdc:mga0a205_86680_c1
1032 nmdc:mga0a205_9752_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

6

130

0.95

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

152

309

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c8w-assembly1.cif.gz_A crystal structure of aspartate semialdehyde dehydrogenase with nadp from blastomyces dermatitidis 0.9262 3 348
5jw6-assembly1.cif.gz_A cystal structure of aspartate semialdehyde dehydrogenase from aspergillus fumigatus 0.9262 4 348
5cef-assembly1.cif.gz_D cystal structure of aspartate semialdehyde dehydrogenase from cryptococcus neoformans 0.9248 4 348
4zhs-assembly1.cif.gz_D crystal structure of aspartate semialdehyde dehydrogenase from trichophyton rubrum 0.9227 4 348
4zic-assembly2.cif.gz_E crystal structure of aspartate semialdehyde dehydrogenase with nadp from trichophyton rubrum 0.9225 4 348
ID Description Score Start End Superfamily
af_P78780_5_150_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9527 7 148 3.30.360.10
4dpkC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9383 3 147 3.40.50.720
af_Q5ALM0_7_192_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 8 166 3.40.50.720
af_Q57658_3_151_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9326 3 144 3.40.50.720
2ep5C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9285 3 148 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A523HK59-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9882 1 67 GO:0004073
GO:0009086
GO:0009088
GO:0051287
AF-A0A7C3QME3-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9847 1 118 GO:0004073
GO:0009086
GO:0009088
GO:0051287
AF-A0A838QLI1-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9804 1 133 GO:0004073
GO:0009086
GO:0009088
GO:0051287
AF-A0A2V7GTZ4-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9804 5 107 GO:0004073
GO:0009086
GO:0009088
GO:0051287
AF-A0A359ICG9-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9786 3 88 GO:0004073
GO:0009086
GO:0009088
GO:0051287

Map