F457973
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 516 | 292 | 1032 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100254900|Ga0070697_1002549002 |
| Length | 301 |
| Sequence | MPAETLKAEPGRLDAVVAKLTGASRAEVQRAIDDGLVRVDGERKSRSFRLRGGERIESELPTEPAIPAEGPPVPVRFRDDDLAVIAKPAGLPTHPTARRRTGTLVNRLRGMGLPLSAAGGPLRPGIVHRLDVGTSGLMIVALSDEAHRALSAMFRRHEPDRRYLALVRGGVAYDSFDVEAPLGRRGGRVTVSAGGGRHAETAFEVKERFEGATLLEARPRTGRTHQIRVHLSAVEHPVLGDRSYGGGGDIARRLGLTRPFLHSWRLAFDHPFTGVRIRLEEPLPGDLDAALRRAAGEEVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 107 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 108 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 109 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 112 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 113 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 127 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 128 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 132 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 140 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 144 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 146 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 196 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 237 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 238 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 239 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 240 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 241 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 242 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 243 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 244 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 245 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 246 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 247 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 248 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 249 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 254 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 255 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 256 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 257 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 258 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 259 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 260 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 261 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 262 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 263 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 264 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 265 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 266 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 267 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 268 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 269 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 270 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 271 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 272 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 273 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 274 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 275 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 276 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 277 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 278 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 279 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 280 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 281 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 282 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 283 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 284 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 285 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 286 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 287 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 288 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 289 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 290 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 291 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 292 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.47 |
| Metatranscriptomes | 0.78 |
| Isolates | 7.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.88 |
| Nodule | 0 |
| Rhizoplane | 6.98 |
| Rhizosphere | 75.58 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070697_100254900 | 3300005536 | Bacteria | 1501 |
| 2 | JGI25406J46586_10002503 | 3300003203 | Bacteria | 8693 |
| 3 | Ga0007423J48922_100139 | 3300003285 | Bacteria | 33024 |
| 4 | Ga0006562J51391_1013228 | 3300003578 | Bacteria | 9500 |
| 5 | Ga0070658_10037035 | 3300005327 | Bacteria | 3931 |
| 6 | Ga0070658_10038778 | 3300005327 | Bacteria | 3842 |
| 7 | Ga0070658_10206129 | 3300005327 | Bacteria | 1660 |
| 8 | Ga0070683_100000788 | 3300005329 | Bacteria | 23382 |
| 9 | Ga0070683_100011229 | 3300005329 | Bacteria | 7728 |
| 10 | Ga0070683_100275177 | 3300005329 | Bacteria | 1602 |
| 11 | Ga0070680_100089920 | 3300005336 | Bacteria | 2541 |
| 12 | Ga0070680_100219528 | 3300005336 | Bacteria | 1604 |
| 13 | Ga0070682_100053199 | 3300005337 | Bacteria | 2536 |
| 14 | Ga0070682_100204111 | 3300005337 | Bacteria | 1396 |
| 15 | Ga0068868_100020276 | 3300005338 | Bacteria | 4990 |
| 16 | Ga0068868_100297987 | 3300005338 | Bacteria | 1369 |
| 17 | Ga0070661_100018602 | 3300005344 | Bacteria | 4941 |
| 18 | Ga0070668_100002892 | 3300005347 | Bacteria | 12673 |
| 19 | Ga0070659_100000366 | 3300005366 | Bacteria | 34220 |
| 20 | Ga0070667_100266000 | 3300005367 | Bacteria | 1536 |
| 21 | Ga0070713_100063291 | 3300005436 | Bacteria | 3101 |
| 22 | Ga0070681_10072056 | 3300005458 | Bacteria | 3418 |
| 23 | Ga0070681_10184109 | 3300005458 | Bacteria | 2009 |
| 24 | Ga0070685_10038518 | 3300005466 | Bacteria | 2711 |
| 25 | Ga0070679_100057416 | 3300005530 | Bacteria | 3880 |
| 26 | Ga0070679_100102334 | 3300005530 | Bacteria | 2850 |
| 27 | Ga0070684_100005779 | 3300005535 | Bacteria | 9514 |
| 28 | Ga0070684_100034787 | 3300005535 | Bacteria | 4309 |
| 29 | Ga0070684_100128556 | 3300005535 | Bacteria | 2284 |
| 30 | Ga0068853_100121712 | 3300005539 | Bacteria | 2328 |
| 31 | Ga0070665_100014281 | 3300005548 | Bacteria | 7974 |
| 32 | Ga0068855_100003828 | 3300005563 | Bacteria | 18395 |
| 33 | Ga0068855_100012277 | 3300005563 | Bacteria | 10351 |
| 34 | Ga0068855_100093255 | 3300005563 | Bacteria | 3472 |
| 35 | Ga0068855_100119913 | 3300005563 | Bacteria | 3011 |
| 36 | Ga0068855_100264911 | 3300005563 | Bacteria | 1913 |
| 37 | Ga0068855_100340944 | 3300005563 | Bacteria | 1652 |
| 38 | Ga0068855_100372887 | 3300005563 | Bacteria | 1568 |
| 39 | Ga0070664_100343867 | 3300005564 | Bacteria | 1356 |
| 40 | Ga0068857_100032767 | 3300005577 | Bacteria | 4593 |
| 41 | Ga0068857_100107945 | 3300005577 | Bacteria | 2500 |
| 42 | Ga0068857_100142277 | 3300005577 | Bacteria | 2169 |
| 43 | Ga0068854_100183454 | 3300005578 | Bacteria | 1636 |
| 44 | Ga0068856_100027143 | 3300005614 | Bacteria | 5586 |
| 45 | Ga0070702_100006280 | 3300005615 | Bacteria | 5613 |
| 46 | Ga0068852_100004834 | 3300005616 | Bacteria | 9572 |
| 47 | Ga0068852_100210694 | 3300005616 | Bacteria | 1843 |
| 48 | Ga0068859_100291783 | 3300005617 | Bacteria | 1724 |
| 49 | Ga0068864_100025648 | 3300005618 | Bacteria | 4966 |
| 50 | Ga0068866_10078640 | 3300005718 | Bacteria | 1765 |
| 51 | Ga0068851_10000020 | 3300005834 | Bacteria | 133551 |
| 52 | Ga0068858_100000233 | 3300005842 | Bacteria | 60097 |
| 53 | Ga0068858_100000389 | 3300005842 | Bacteria | 46073 |
| 54 | Ga0068858_100054250 | 3300005842 | Bacteria | 3707 |
| 55 | Ga0068858_100058959 | 3300005842 | Bacteria | 3548 |
| 56 | Ga0081455_10000025 | 3300005937 | Bacteria | 157583 |
| 57 | Ga0081455_10000216 | 3300005937 | Bacteria | 73781 |
| 58 | Ga0081538_10004745 | 3300005981 | Bacteria | 12440 |
| 59 | Ga0081540_1002284 | 3300005983 | Bacteria | 15742 |
| 60 | Ga0081540_1007058 | 3300005983 | Bacteria | 8073 |
| 61 | Ga0081540_1028837 | 3300005983 | Bacteria | 3105 |
| 62 | Ga0081539_10000406 | 3300005985 | Bacteria | 91786 |
| 63 | Ga0081539_10001654 | 3300005985 | Bacteria | 36124 |
| 64 | Ga0081539_10003071 | 3300005985 | Bacteria | 21521 |
| 65 | Ga0081539_10004512 | 3300005985 | Bacteria | 15299 |
| 66 | Ga0081539_10015562 | 3300005985 | Bacteria | 5518 |
| 67 | Ga0081539_10016547 | 3300005985 | Bacteria | 5253 |
| 68 | Ga0075364_10093212 | 3300006051 | Bacteria | 2000 |
| 69 | Ga0070716_100114300 | 3300006173 | Bacteria | 1678 |
| 70 | Ga0070712_100135730 | 3300006175 | Bacteria | 1870 |
| 71 | Ga0075367_10013697 | 3300006178 | Bacteria | 4369 |
| 72 | Ga0097621_100440201 | 3300006237 | Bacteria | 1173 |
| 73 | Ga0075370_10019082 | 3300006353 | Bacteria | 3728 |
| 74 | Ga0075430_100002938 | 3300006846 | Bacteria | 14258 |
| 75 | Ga0075430_100004419 | 3300006846 | Bacteria | 11862 |
| 76 | Ga0075431_100003270 | 3300006847 | Bacteria | 15678 |
| 77 | Ga0075431_100010252 | 3300006847 | Bacteria | 9420 |
| 78 | Ga0075429_100002781 | 3300006880 | Bacteria | 14795 |
| 79 | Ga0075429_100023558 | 3300006880 | Bacteria | 5343 |
| 80 | Ga0075429_100025151 | 3300006880 | Bacteria | 5168 |
| 81 | Ga0097620_100291806 | 3300006931 | Bacteria | 1724 |
| 82 | Ga0105240_10002356 | 3300009093 | Bacteria | 30453 |
| 83 | Ga0105240_10036680 | 3300009093 | Bacteria | 6305 |
| 84 | Ga0105240_10087693 | 3300009093 | Bacteria | 3810 |
| 85 | Ga0105245_10038697 | 3300009098 | Bacteria | 4244 |
| 86 | Ga0105245_10143603 | 3300009098 | Bacteria | 2250 |
| 87 | Ga0105245_10292174 | 3300009098 | Bacteria | 1597 |
| 88 | Ga0105247_10160870 | 3300009101 | Bacteria | 1486 |
| 89 | Ga0114129_10004719 | 3300009147 | Bacteria | 19248 |
| 90 | Ga0114129_10027492 | 3300009147 | Bacteria | 8053 |
| 91 | Ga0114129_10032726 | 3300009147 | Bacteria | 7346 |
| 92 | Ga0105241_10000260 | 3300009174 | Bacteria | 39516 |
| 93 | Ga0105242_10006821 | 3300009176 | Bacteria | 8806 |
| 94 | Ga0105242_10297029 | 3300009176 | Bacteria | 1473 |
| 95 | Ga0105248_10000882 | 3300009177 | Bacteria | 33632 |
| 96 | Ga0105248_10093803 | 3300009177 | Bacteria | 3381 |
| 97 | Ga0105237_10002645 | 3300009545 | Bacteria | 22052 |
| 98 | Ga0105237_10390869 | 3300009545 | Bacteria | 1396 |
| 99 | Ga0105238_10002073 | 3300009551 | Bacteria | 20252 |
| 100 | Ga0105238_10106378 | 3300009551 | Bacteria | 2787 |
| 101 | Ga0105238_10198817 | 3300009551 | Bacteria | 1980 |
| 102 | Ga0105239_10108514 | 3300010375 | Bacteria | 3075 |
| 103 | Ga0105239_10904018 | 3300010375 | Bacteria | 1013 |
| 104 | Ga0157370_10011259 | 3300013104 | Bacteria | 9378 |
| 105 | Ga0157370_10126242 | 3300013104 | Bacteria | 2388 |
| 106 | Ga0157369_10193367 | 3300013105 | Bacteria | 2137 |
| 107 | Ga0157369_10273992 | 3300013105 | Bacteria | 1758 |
| 108 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 109 | Ga0157374_10429586 | 3300013296 | Bacteria | 1320 |
| 110 | Ga0157378_10150915 | 3300013297 | Bacteria | 2165 |
| 111 | Ga0163162_10039386 | 3300013306 | Bacteria | 4722 |
| 112 | Ga0163162_10853336 | 3300013306 | Bacteria | 1026 |
| 113 | Ga0157372_10515884 | 3300013307 | Bacteria | 1393 |
| 114 | Ga0163163_10003315 | 3300014325 | Bacteria | 13656 |
| 115 | Ga0163163_10121008 | 3300014325 | Bacteria | 2652 |
| 116 | Ga0163163_10399109 | 3300014325 | Bacteria | 1433 |
| 117 | Ga0163163_10717727 | 3300014325 | Bacteria | 1063 |
| 118 | Ga0157379_10000039 | 3300014968 | Bacteria | 79484 |
| 119 | Ga0157379_10042168 | 3300014968 | Bacteria | 4074 |
| 120 | Ga0157379_10045499 | 3300014968 | Bacteria | 3917 |
| 121 | Ga0157379_10060966 | 3300014968 | Bacteria | 3373 |
| 122 | Ga0157379_10127646 | 3300014968 | Bacteria | 2288 |
| 123 | Ga0163161_10156672 | 3300017792 | Bacteria | 1734 |
| 124 | Ga0206356_10827201 | 3300020070 | Bacteria | 2491 |
| 125 | Ga0206353_10050241 | 3300020082 | Bacteria | 2614 |
| 126 | Ga0213873_10000109 | 3300021358 | Bacteria | 16093 |
| 127 | Ga0213876_10098035 | 3300021384 | Bacteria | 1553 |
| 128 | Ga0213876_10175744 | 3300021384 | Bacteria | 1139 |
| 129 | Ga0213875_10000035 | 3300021388 | Bacteria | 167011 |
| 130 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 131 | Ga0207642_10050794 | 3300025899 | Bacteria | 1872 |
| 132 | Ga0207705_10009536 | 3300025909 | Bacteria | 7063 |
| 133 | Ga0207705_10026536 | 3300025909 | Bacteria | 4131 |
| 134 | Ga0207705_10027763 | 3300025909 | Bacteria | 4036 |
| 135 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 136 | Ga0207707_10046834 | 3300025912 | Bacteria | 3766 |
| 137 | Ga0207695_10030700 | 3300025913 | Bacteria | 5913 |
| 138 | Ga0207695_10113716 | 3300025913 | Bacteria | 2683 |
| 139 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 140 | Ga0207671_10175153 | 3300025914 | Bacteria | 1667 |
| 141 | Ga0207660_10050301 | 3300025917 | Bacteria | 2958 |
| 142 | Ga0207660_10067964 | 3300025917 | Bacteria | 2583 |
| 143 | Ga0207657_10010292 | 3300025919 | Bacteria | 9338 |
| 144 | Ga0207649_10151547 | 3300025920 | Bacteria | 1597 |
| 145 | Ga0207652_10403049 | 3300025921 | Bacteria | 1234 |
| 146 | Ga0207694_10000073 | 3300025924 | Bacteria | 118507 |
| 147 | Ga0207694_10217896 | 3300025924 | Bacteria | 1556 |
| 148 | Ga0207687_10060122 | 3300025927 | Bacteria | 2679 |
| 149 | Ga0207687_10156907 | 3300025927 | Bacteria | 1742 |
| 150 | Ga0207687_10238377 | 3300025927 | Bacteria | 1440 |
| 151 | Ga0207700_10029732 | 3300025928 | Bacteria | 3860 |
| 152 | Ga0207690_10007665 | 3300025932 | Bacteria | 6403 |
| 153 | Ga0207686_10228551 | 3300025934 | Bacteria | 1347 |
| 154 | Ga0207704_10022384 | 3300025938 | Bacteria | 3385 |
| 155 | Ga0207665_10263561 | 3300025939 | Bacteria | 1277 |
| 156 | Ga0207711_10001209 | 3300025941 | Bacteria | 24455 |
| 157 | Ga0207711_10054994 | 3300025941 | Bacteria | 3417 |
| 158 | Ga0207711_10083018 | 3300025941 | Bacteria | 2802 |
| 159 | Ga0207661_10005928 | 3300025944 | Bacteria | 8625 |
| 160 | Ga0207661_10014739 | 3300025944 | Bacteria | 5734 |
| 161 | Ga0207661_10197932 | 3300025944 | Bacteria | 1765 |
| 162 | Ga0207667_10011531 | 3300025949 | Bacteria | 10270 |
| 163 | Ga0207667_10024891 | 3300025949 | Bacteria | 6564 |
| 164 | Ga0207667_10032079 | 3300025949 | Bacteria | 5663 |
| 165 | Ga0207667_10084466 | 3300025949 | Bacteria | 3287 |
| 166 | Ga0207667_10218437 | 3300025949 | Bacteria | 1953 |
| 167 | Ga0207667_10258277 | 3300025949 | Bacteria | 1782 |
| 168 | Ga0207712_10176177 | 3300025961 | Bacteria | 1676 |
| 169 | Ga0207668_10307718 | 3300025972 | Bacteria | 1310 |
| 170 | Ga0207640_10169204 | 3300025981 | Bacteria | 1626 |
| 171 | Ga0207658_10133601 | 3300025986 | Bacteria | 1997 |
| 172 | Ga0207703_10000001 | 3300026035 | Bacteria | 822925 |
| 173 | Ga0207703_10000044 | 3300026035 | Bacteria | 158471 |
| 174 | Ga0207703_10124859 | 3300026035 | Bacteria | 2214 |
| 175 | Ga0207639_10005967 | 3300026041 | Bacteria | 8264 |
| 176 | Ga0207639_10190975 | 3300026041 | Bacteria | 1749 |
| 177 | Ga0207702_10033872 | 3300026078 | Bacteria | 4269 |
| 178 | Ga0207641_10146983 | 3300026088 | Bacteria | 2132 |
| 179 | Ga0207641_10290803 | 3300026088 | Bacteria | 1540 |
| 180 | Ga0207676_10128648 | 3300026095 | Bacteria | 2149 |
| 181 | Ga0207674_10042050 | 3300026116 | Bacteria | 4723 |
| 182 | Ga0207674_10075281 | 3300026116 | Bacteria | 3386 |
| 183 | Ga0207674_10288687 | 3300026116 | Bacteria | 1589 |
| 184 | Ga0207674_10383477 | 3300026116 | Bacteria | 1359 |
| 185 | Ga0207698_10001186 | 3300026142 | Bacteria | 15193 |
| 186 | Ga0207698_10012641 | 3300026142 | Bacteria | 5533 |
| 187 | Ga0207698_10120695 | 3300026142 | Bacteria | 2218 |
| 188 | Ga0268266_10028939 | 3300028379 | Bacteria | 4708 |
| 189 | Ga0307515_10002200 | 3300028794 | Bacteria | 42791 |
| 190 | Ga0307515_10010401 | 3300028794 | Bacteria | 17825 |
| 191 | Ga0307515_10060794 | 3300028794 | Bacteria | 5378 |
| 192 | Ga0307515_10063082 | 3300028794 | Bacteria | 5216 |
| 193 | Ga0307512_10005296 | 3300030522 | Bacteria | 13532 |
| 194 | Ga0307512_10006381 | 3300030522 | Bacteria | 11952 |
| 195 | Ga0307512_10018977 | 3300030522 | Bacteria | 6273 |
| 196 | Ga0307512_10072384 | 3300030522 | Bacteria | 2550 |
| 197 | Ga0307512_10101169 | 3300030522 | Bacteria | 1951 |
| 198 | Ga0314311_1025891 | 3300030733 | Bacteria | 1917 |
| 199 | Ga0307513_10013396 | 3300031456 | Bacteria | 10063 |
| 200 | Ga0307513_10086337 | 3300031456 | Bacteria | 3217 |
| 201 | Ga0307513_10132594 | 3300031456 | Bacteria | 2434 |
| 202 | Ga0307513_10208479 | 3300031456 | Bacteria | 1788 |
| 203 | Ga0307509_10029064 | 3300031507 | Bacteria | 6139 |
| 204 | Ga0307509_10057480 | 3300031507 | Bacteria | 4124 |
| 205 | Ga0307408_100198532 | 3300031548 | Bacteria | 1622 |
| 206 | Ga0307508_10001138 | 3300031616 | Bacteria | 30634 |
| 207 | Ga0307508_10043515 | 3300031616 | Bacteria | 4023 |
| 208 | Ga0316575_10000002 | 3300031665 | Bacteria | 148142 |
| 209 | Ga0316575_10019866 | 3300031665 | Bacteria | 2572 |
| 210 | Ga0316576_10002842 | 3300031727 | Bacteria | 9976 |
| 211 | Ga0316576_10030920 | 3300031727 | Bacteria | 3795 |
| 212 | Ga0316576_10114487 | 3300031727 | Bacteria | 2023 |
| 213 | Ga0307516_10010554 | 3300031730 | Bacteria | 10141 |
| 214 | Ga0307516_10018270 | 3300031730 | Bacteria | 7291 |
| 215 | Ga0307516_10161031 | 3300031730 | Bacteria | 1994 |
| 216 | Ga0307405_10010744 | 3300031731 | Bacteria | 4760 |
| 217 | Ga0307405_10140209 | 3300031731 | Bacteria | 1684 |
| 218 | Ga0307413_10034372 | 3300031824 | Bacteria | 2897 |
| 219 | Ga0307413_10070349 | 3300031824 | Bacteria | 2200 |
| 220 | Ga0307413_10077040 | 3300031824 | Bacteria | 2122 |
| 221 | Ga0307413_10095114 | 3300031824 | Bacteria | 1952 |
| 222 | Ga0307413_10149642 | 3300031824 | Bacteria | 1625 |
| 223 | Ga0307518_10110957 | 3300031838 | Bacteria | 1954 |
| 224 | Ga0307518_10145135 | 3300031838 | Bacteria | 1649 |
| 225 | Ga0307410_10051419 | 3300031852 | Bacteria | 2777 |
| 226 | Ga0326468_10000389 | 3300031889 | Bacteria | 4643 |
| 227 | Ga0307406_10009793 | 3300031901 | Bacteria | 5391 |
| 228 | Ga0307406_10070403 | 3300031901 | Bacteria | 2290 |
| 229 | Ga0307412_10048649 | 3300031911 | Bacteria | 2790 |
| 230 | Ga0307412_10189445 | 3300031911 | Bacteria | 1554 |
| 231 | Ga0307409_100043084 | 3300031995 | Bacteria | 3385 |
| 232 | Ga0307409_100228013 | 3300031995 | Bacteria | 1686 |
| 233 | Ga0307409_100235348 | 3300031995 | Bacteria | 1663 |
| 234 | Ga0307416_100096298 | 3300032002 | Bacteria | 2559 |
| 235 | Ga0307416_100359259 | 3300032002 | Bacteria | 1478 |
| 236 | Ga0307416_100509616 | 3300032002 | Bacteria | 1269 |
| 237 | Ga0307414_10037247 | 3300032004 | Bacteria | 3255 |
| 238 | Ga0307415_100012326 | 3300032126 | Bacteria | 4939 |
| 239 | Ga0307415_100234531 | 3300032126 | Bacteria | 1480 |
| 240 | Ga0307415_100417053 | 3300032126 | Bacteria | 1151 |
| 241 | Ga0316580_10002677 | 3300032139 | Bacteria | 4951 |
| 242 | Ga0307507_10025962 | 3300033179 | Bacteria | 6331 |
| 243 | Ga0307507_10254214 | 3300033179 | Bacteria | 1131 |
| 244 | Ga0373951_0001630 | 3300035091 | Bacteria | 5885 |
| 245 | Ga0373946_0043876 | 3300035171 | Unclassified | 1844 |
| 246 | Ga0373942_0000022 | 3300035207 | Bacteria | 30229 |
| 247 | Ga0373962_0005028 | 3300035242 | Bacteria | 3196 |
| 248 | Ga0316574_0073281 | 3300035398 | Bacteria | 2165 |
| 249 | Ga0316574_0102244 | 3300035398 | Bacteria | 1834 |
| 250 | Ga0373935_0024936 | 3300035692 | Bacteria | 3684 |
| 251 | Ga0373935_0039005 | 3300035692 | Bacteria | 2976 |
| 252 | Ga0373925_0011518 | 3300037068 | Bacteria | 6399 |
| 253 | Ga0395899_0005111 | 3300037312 | Bacteria | 10209 |
| 254 | Ga0395900_0441829 | 3300037418 | Bacteria | 1258 |
| 255 | Ga0395900_0637440 | 3300037418 | Bacteria | 1003 |
| 256 | Ga0395898_0036168 | 3300037466 | Bacteria | 4904 |
| 257 | Ga0395905_0020584 | 3300037471 | Bacteria | 6246 |
| 258 | Ga0316581_0004174 | 3300037588 | Bacteria | 3660 |
| 259 | Ga0436364_0245806 | 3300037853 | Bacteria | 18262 |
| 260 | Ga0436364_0623424 | 3300037853 | Bacteria | 43926 |
| 261 | Ga0395901_0038614 | 3300038443 | Bacteria | 4938 |
| 262 | Ga0395901_0052057 | 3300038443 | Bacteria | 4256 |
| 263 | Ga0395901_0052636 | 3300038443 | Bacteria | 4231 |
| 264 | Ga0436365_0713928 | 3300039437 | Bacteria | 1166 |
| 265 | Ga0436365_0788692 | 3300039437 | Bacteria | 10905 |
| 266 | Ga0436362_0069678 | 3300039453 | Bacteria | 57350 |
| 267 | Ga0451789_1030601 | 3300041443 | Bacteria | 3201 |
| 268 | Ga0451837_0448576 | 3300041494 | Bacteria | 1533 |
| 269 | Ga0451843_0244027 | 3300041509 | Bacteria | 1536 |
| 270 | Ga0451853_0390984 | 3300041512 | Bacteria | 4288 |
| 271 | Ga0466972_0013789 | 3300044658 | Bacteria | 4057 |
| 272 | Ga0466966_0002287 | 3300044684 | Bacteria | 12487 |
| 273 | Ga0466966_0011502 | 3300044684 | Bacteria | 5871 |
| 274 | Ga0466961_0150698 | 3300044693 | Bacteria | 1452 |
| 275 | Ga0466963_0000838 | 3300044694 | Bacteria | 15433 |
| 276 | Ga0466963_0010371 | 3300044694 | Bacteria | 5639 |
| 277 | Ga0466963_0084603 | 3300044694 | Bacteria | 2152 |
| 278 | Ga0466963_0092761 | 3300044694 | Bacteria | 2058 |
| 279 | Ga0466963_0160948 | 3300044694 | Bacteria | 1562 |
| 280 | Ga0466963_0254849 | 3300044694 | Bacteria | 1232 |
| 281 | Ga0466971_0004341 | 3300044719 | Bacteria | 6111 |
| 282 | Ga0466968_0000580 | 3300044735 | Bacteria | 12453 |
| 283 | Ga0466968_0010222 | 3300044735 | Bacteria | 3633 |
| 284 | Ga0466970_0000004 | 3300044765 | Bacteria | 108620 |
| 285 | Ga0466957_0015705 | 3300044842 | Bacteria | 4423 |
| 286 | Ga0466957_0055027 | 3300044842 | Bacteria | 2431 |
| 287 | Ga0466960_0022138 | 3300044901 | Bacteria | 2838 |
| 288 | Ga0466959_0032652 | 3300045049 | Bacteria | 3853 |
| 289 | Ga0466959_0222040 | 3300045049 | Bacteria | 1310 |
| 290 | Ga0466958_0000033 | 3300045836 | Bacteria | 38883 |
| 291 | Ga0466958_0015612 | 3300045836 | Bacteria | 4355 |
| 292 | Ga0466967_0113408 | 3300045976 | Bacteria | 2494 |
| 293 | Ga0466967_0255686 | 3300045976 | Bacteria | 1675 |
| 294 | Ga0495627_019693 | 3300046453 | Bacteria | 2258 |
| 295 | Ga0495641_0012860 | 3300046461 | Bacteria | 4644 |
| 296 | Ga0495582_0001779 | 3300046473 | Bacteria | 12166 |
| 297 | Ga0495606_0004232 | 3300046507 | Bacteria | 14511 |
| 298 | Ga0495630_0113032 | 3300046517 | Unclassified | 2057 |
| 299 | Ga0495665_0011525 | 3300046531 | Bacteria | 4785 |
| 300 | Ga0495640_0068745 | 3300046533 | Bacteria | 2383 |
| 301 | Ga0495668_0000464 | 3300046616 | Bacteria | 51784 |
| 302 | Ga0495625_0000677 | 3300046660 | Bacteria | 48654 |
| 303 | Ga0495647_0039825 | 3300046681 | Unclassified | 1783 |
| 304 | Ga0495658_0000114 | 3300046683 | Bacteria | 42960 |
| 305 | Ga0495613_0000739 | 3300046689 | Bacteria | 25623 |
| 306 | Ga0495581_0000832 | 3300047315 | Bacteria | 16421 |
| 307 | Ga0495581_0035242 | 3300047315 | Bacteria | 2896 |
| 308 | Ga0495676_0017933 | 3300047321 | Bacteria | 6248 |
| 309 | Ga0495593_0017299 | 3300047673 | Bacteria | 4058 |
| 310 | Ga0495614_0066504 | 3300048089 | Unclassified | 1550 |
| 311 | Ga0495626_0000184 | 3300048091 | Bacteria | 76088 |
| 312 | Ga0496100_0074571 | 3300048903 | Bacteria | 2273 |
| 313 | Ga0496102_0000791 | 3300048905 | Bacteria | 30774 |
| 314 | Ga0496103_0010962 | 3300048906 | Bacteria | 5365 |
| 315 | Ga0496104_0018187 | 3300048907 | Bacteria | 6409 |
| 316 | Ga0496104_0109150 | 3300048907 | Bacteria | 2652 |
| 317 | Ga0496104_0203415 | 3300048907 | Bacteria | 1892 |
| 318 | Ga0496105_0034528 | 3300048908 | Bacteria | 4160 |
| 319 | Ga0496105_0134391 | 3300048908 | Bacteria | 2038 |
| 320 | Ga0496105_0199497 | 3300048908 | Bacteria | 1633 |
| 321 | Ga0496106_0117782 | 3300048909 | Bacteria | 2073 |
| 322 | Ga0496108_0000130 | 3300048911 | Bacteria | 74276 |
| 323 | Ga0496108_0005233 | 3300048911 | Bacteria | 10476 |
| 324 | Ga0496108_0034676 | 3300048911 | Bacteria | 4192 |
| 325 | Ga0496108_0056117 | 3300048911 | Bacteria | 3308 |
| 326 | Ga0496109_0042613 | 3300048912 | Bacteria | 4112 |
| 327 | Ga0496109_0054077 | 3300048912 | Bacteria | 3663 |
| 328 | Ga0496109_0054947 | 3300048912 | Bacteria | 3632 |
| 329 | Ga0496109_0121712 | 3300048912 | Bacteria | 2431 |
| 330 | Ga0496109_0136023 | 3300048912 | Bacteria | 2296 |
| 331 | Ga0496109_0404380 | 3300048912 | Bacteria | 1290 |
| 332 | Ga0496110_0012751 | 3300048913 | Bacteria | 6921 |
| 333 | Ga0496111_0006024 | 3300048914 | Bacteria | 7835 |
| 334 | Ga0496111_0072222 | 3300048914 | Bacteria | 2512 |
| 335 | Ga0496112_0022411 | 3300048915 | Bacteria | 6019 |
| 336 | Ga0496112_0056567 | 3300048915 | Bacteria | 3860 |
| 337 | Ga0496112_0111883 | 3300048915 | Bacteria | 2700 |
| 338 | Ga0496112_0254043 | 3300048915 | Bacteria | 1708 |
| 339 | Ga0496112_0328076 | 3300048915 | Bacteria | 1474 |
| 340 | Ga0496112_0367441 | 3300048915 | Bacteria | 1380 |
| 341 | Ga0496113_0017742 | 3300048916 | Bacteria | 4948 |
| 342 | Ga0496113_0257321 | 3300048916 | Bacteria | 1394 |
| 343 | Ga0496114_0016318 | 3300048917 | Bacteria | 5981 |
| 344 | Ga0496114_0046418 | 3300048917 | Bacteria | 3609 |
| 345 | Ga0496114_0110062 | 3300048917 | Bacteria | 2359 |
| 346 | Ga0496114_0177834 | 3300048917 | Bacteria | 1857 |
| 347 | Ga0496117_0004850 | 3300048920 | Bacteria | 14534 |
| 348 | Ga0496117_0025622 | 3300048920 | Bacteria | 4633 |
| 349 | Ga0496118_0050084 | 3300048921 | Bacteria | 3209 |
| 350 | Ga0496119_0000341 | 3300048922 | Bacteria | 65282 |
| 351 | Ga0496119_0001875 | 3300048922 | Bacteria | 24260 |
| 352 | Ga0496119_0077619 | 3300048922 | Bacteria | 1923 |
| 353 | Ga0496120_0000456 | 3300048923 | Bacteria | 64535 |
| 354 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 355 | Ga0496122_0000120 | 3300048925 | Bacteria | 182539 |
| 356 | Ga0496123_0000051 | 3300048926 | Bacteria | 237095 |
| 357 | Ga0496124_0005668 | 3300048927 | Bacteria | 13925 |
| 358 | Ga0496125_0087422 | 3300048928 | Bacteria | 2354 |
| 359 | Ga0496126_0073947 | 3300048929 | Bacteria | 3028 |
| 360 | Ga0501031_0022836 | 3300049568 | Bacteria | 4079 |
| 361 | Ga0501031_0028765 | 3300049568 | Bacteria | 3622 |
| 362 | Ga0501031_0081171 | 3300049568 | Bacteria | 2114 |
| 363 | Ga0501032_0006227 | 3300049569 | Bacteria | 8781 |
| 364 | Ga0501032_0026576 | 3300049569 | Bacteria | 3979 |
| 365 | Ga0501032_0041904 | 3300049569 | Bacteria | 3107 |
| 366 | Ga0501032_0063319 | 3300049569 | Bacteria | 2476 |
| 367 | Ga0501034_0020171 | 3300049571 | Bacteria | 6805 |
| 368 | Ga0501034_0030259 | 3300049571 | Bacteria | 5503 |
| 369 | Ga0501034_0048617 | 3300049571 | Bacteria | 4281 |
| 370 | Ga0501034_0050021 | 3300049571 | Bacteria | 4216 |
| 371 | Ga0501034_0073806 | 3300049571 | Bacteria | 3420 |
| 372 | Ga0501034_0116712 | 3300049571 | Bacteria | 2657 |
| 373 | Ga0501034_0369275 | 3300049571 | Bacteria | 1361 |
| 374 | Ga0501034_0423867 | 3300049571 | Bacteria | 1251 |
| 375 | Ga0501036_0164951 | 3300049572 | Bacteria | 1867 |
| 376 | Ga0501036_0204963 | 3300049572 | Bacteria | 1658 |
| 377 | Ga0501037_0051486 | 3300049573 | Bacteria | 3012 |
| 378 | Ga0501037_0092233 | 3300049573 | Bacteria | 2191 |
| 379 | Ga0501037_0140255 | 3300049573 | Bacteria | 1730 |
| 380 | Ga0501038_0000236 | 3300049574 | Bacteria | 46834 |
| 381 | Ga0501038_0008533 | 3300049574 | Bacteria | 9414 |
| 382 | Ga0501038_0028314 | 3300049574 | Bacteria | 4978 |
| 383 | Ga0501038_0294797 | 3300049574 | Bacteria | 1274 |
| 384 | Ga0501039_0033393 | 3300049575 | Bacteria | 3968 |
| 385 | Ga0501039_0054960 | 3300049575 | Bacteria | 3083 |
| 386 | Ga0501039_0060829 | 3300049575 | Bacteria | 2924 |
| 387 | Ga0501040_0001340 | 3300049576 | Bacteria | 15574 |
| 388 | Ga0501041_0002143 | 3300049577 | Bacteria | 11133 |
| 389 | Ga0501041_0291409 | 3300049577 | Bacteria | 1028 |
| 390 | Ga0501042_0018119 | 3300049578 | Bacteria | 4871 |
| 391 | Ga0501043_0007175 | 3300049579 | Bacteria | 8857 |
| 392 | Ga0501043_0021814 | 3300049579 | Bacteria | 5023 |
| 393 | Ga0501043_0062724 | 3300049579 | Bacteria | 2918 |
| 394 | Ga0501043_0140267 | 3300049579 | Bacteria | 1893 |
| 395 | Ga0501046_0012430 | 3300049580 | Bacteria | 7248 |
| 396 | Ga0501046_0189343 | 3300049580 | Bacteria | 1535 |
| 397 | Ga0501047_0019137 | 3300049581 | Bacteria | 6568 |
| 398 | Ga0501047_0037345 | 3300049581 | Bacteria | 4697 |
| 399 | Ga0501047_0043258 | 3300049581 | Bacteria | 4350 |
| 400 | Ga0501047_0176862 | 3300049581 | Bacteria | 2001 |
| 401 | Ga0501048_0001562 | 3300049582 | Bacteria | 17396 |
| 402 | Ga0501048_0025140 | 3300049582 | Bacteria | 4341 |
| 403 | Ga0501048_0034926 | 3300049582 | Bacteria | 3623 |
| 404 | Ga0501048_0093499 | 3300049582 | Bacteria | 2121 |
| 405 | Ga0501067_0056001 | 3300049583 | Bacteria | 2185 |
| 406 | Ga0501068_0030310 | 3300049584 | Bacteria | 3208 |
| 407 | Ga0501069_0023499 | 3300049585 | Bacteria | 3362 |
| 408 | Ga0501070_0003210 | 3300049586 | Bacteria | 14219 |
| 409 | Ga0501070_0003401 | 3300049586 | Bacteria | 13809 |
| 410 | Ga0501070_0017478 | 3300049586 | Bacteria | 6021 |
| 411 | Ga0501070_0026601 | 3300049586 | Bacteria | 4854 |
| 412 | Ga0501070_0056516 | 3300049586 | Bacteria | 3253 |
| 413 | Ga0501070_0099618 | 3300049586 | Bacteria | 2404 |
| 414 | Ga0501070_0175822 | 3300049586 | Bacteria | 1763 |
| 415 | Ga0501070_0218549 | 3300049586 | Bacteria | 1563 |
| 416 | Ga0501071_0014139 | 3300049587 | Bacteria | 5456 |
| 417 | Ga0501071_0025934 | 3300049587 | Bacteria | 4109 |
| 418 | Ga0501072_0008276 | 3300049588 | Bacteria | 7904 |
| 419 | Ga0501072_0040450 | 3300049588 | Bacteria | 3660 |
| 420 | Ga0501073_0000226 | 3300049589 | Bacteria | 36967 |
| 421 | Ga0501073_0069635 | 3300049589 | Bacteria | 2451 |
| 422 | Ga0501073_0078133 | 3300049589 | Bacteria | 2303 |
| 423 | Ga0501073_0088670 | 3300049589 | Bacteria | 2151 |
| 424 | Ga0501074_0086563 | 3300049590 | Bacteria | 2245 |
| 425 | Ga0501075_0014072 | 3300049591 | Bacteria | 5729 |
| 426 | Ga0501076_0136725 | 3300049592 | Bacteria | 1990 |
| 427 | Ga0501077_0042751 | 3300049593 | Bacteria | 2880 |
| 428 | Ga0501079_0023902 | 3300049741 | Bacteria | 4688 |
| 429 | Ga0501079_0165795 | 3300049741 | Bacteria | 1723 |
| 430 | Ga0501080_0000084 | 3300049742 | Bacteria | 62784 |
| 431 | Ga0501080_0035093 | 3300049742 | Bacteria | 4682 |
| 432 | Ga0501080_0134954 | 3300049742 | Bacteria | 2284 |
| 433 | Ga0501080_0426299 | 3300049742 | Bacteria | 1191 |
| 434 | Ga0501081_0020497 | 3300049743 | Bacteria | 4406 |
| 435 | Ga0501083_0000527 | 3300049744 | Bacteria | 24400 |
| 436 | Ga0501035_0013456 | 3300049822 | Bacteria | 7553 |
| 437 | Ga0501035_0043300 | 3300049822 | Bacteria | 4057 |
| 438 | Ga0501044_0043234 | 3300049823 | Bacteria | 4682 |
| 439 | Ga0501044_0148960 | 3300049823 | Bacteria | 2323 |
| 440 | Ga0501045_0007616 | 3300049824 | Bacteria | 7526 |
| 441 | nmdc:mga05p37_14772_c1 | 3300050507 | Bacteria | 9377 |
| 442 | nmdc:mga05p37_24954_c1 | 3300050507 | Bacteria | 7267 |
| 443 | nmdc:mga05p37_49506_c1 | 3300050507 | Bacteria | 5169 |
| 444 | nmdc:mga09592_111880_c1 | 3300050508 | Bacteria | 2343 |
| 445 | nmdc:mga09592_13806_c1 | 3300050508 | Bacteria | 6600 |
| 446 | nmdc:mga09592_35883_c1 | 3300050508 | Bacteria | 4152 |
| 447 | nmdc:mga0qj67_118035_c1 | 3300050509 | Bacteria | 2144 |
| 448 | nmdc:mga0qj67_200680_c1 | 3300050509 | Bacteria | 1621 |
| 449 | nmdc:mga0qj67_286686_c1 | 3300050509 | Bacteria | 1335 |
| 450 | nmdc:mga06r32_136362_c1 | 3300050510 | Bacteria | 2429 |
| 451 | nmdc:mga06r32_48732_c1 | 3300050510 | Bacteria | 4050 |
| 452 | Ga0500644_0007068 | 3300053088 | Bacteria | 2908 |
| 453 | Ga0500646_0000405 | 3300053090 | Bacteria | 12788 |
| 454 | Ga0500646_0041513 | 3300053090 | Bacteria | 1297 |
| 455 | Ga0500651_0018931 | 3300053093 | Bacteria | 4267 |
| 456 | Ga0500660_025721 | 3300053100 | Bacteria | 3106 |
| 457 | Ga0500556_0080367 | 3300053104 | Bacteria | 1232 |
| 458 | Ga0500652_004043 | 3300053131 | Bacteria | 4500 |
| 459 | Ga0500559_0109013 | 3300053136 | Bacteria | 1282 |
| 460 | Ga0500568_0000014 | 3300053139 | Bacteria | 223550 |
| 461 | Ga0500568_0008086 | 3300053139 | Bacteria | 5104 |
| 462 | Ga0500568_0009268 | 3300053139 | Bacteria | 4690 |
| 463 | Ga0500573_0000059 | 3300053140 | Bacteria | 71066 |
| 464 | Ga0500577_0036532 | 3300053142 | Bacteria | 1759 |
| 465 | Ga0500588_0001538 | 3300053146 | Bacteria | 4428 |
| 466 | Ga0500589_039852 | 3300053147 | Bacteria | 2193 |
| 467 | Ga0500600_0064692 | 3300053149 | Bacteria | 2025 |
| 468 | Ga0500620_001055 | 3300053155 | Bacteria | 4862 |
| 469 | Ga0501084_0004926 | 3300054114 | Bacteria | 10910 |
| 470 | Ga0501084_0149553 | 3300054114 | Bacteria | 1968 |
| 471 | Ga0501082_0001508 | 3300060353 | Bacteria | 20522 |
| 472 | Ga0501082_0083008 | 3300060353 | Bacteria | 2764 |
| 473 | Ga0501082_0089427 | 3300060353 | Bacteria | 2659 |
| 474 | Ga0501082_0092358 | 3300060353 | Bacteria | 2615 |
| 475 | Ga0466962_0000826 | 3300061719 | Bacteria | 13937 |
| 476 | Ga0530510_0030253 | 3300061734 | Bacteria | 3888 |
| 477 | 2515850840 | 2515154155 | Bacteria | 7985436 |
| 478 | 2643753574 | 2643221546 | Bacteria | 2910897 |
| 479 | 2643848066 | 2643221566 | Bacteria | 3460379 |
| 480 | 2643885095 | 2643221575 | Bacteria | 4022601 |
| 481 | 2644446383 | 2643221679 | Bacteria | 3839507 |
| 482 | 2645726241 | 2643221962 | Bacteria | 3874254 |
| 483 | 2676476805 | 2675903058 | Bacteria | 6822861 |
| 484 | 2729906129 | 2728369276 | Bacteria | 5610032 |
| 485 | 2738692320 | 2738541272 | Bacteria | 6848551 |
| 486 | 2739323406 | 2738543027 | Bacteria | 6409078 |
| 487 | 2739609149 | 2739367654 | Bacteria | 6049412 |
| 488 | 2753268286 | 2751185782 | Bacteria | 11227053 |
| 489 | 2753301640 | 2751185788 | Bacteria | 4541048 |
| 490 | 2753301662 | 2751185788 | Bacteria | 4541048 |
| 491 | 2760303406 | 2758568522 | Bacteria | 5953541 |
| 492 | 2760622700 | 2758568621 | Bacteria | 5967089 |
| 493 | 2774399835 | 2773857763 | Bacteria | 4180068 |
| 494 | 2776375436 | 2775506925 | Bacteria | 7237746 |
| 495 | 2791913450 | 2791354901 | Bacteria | 8322202 |
| 496 | 2795795996 | 2795385472 | Bacteria | 6627535 |
| 497 | 2808631449 | 2808606306 | Bacteria | 3608896 |
| 498 | 2809027486 | 2808606394 | Bacteria | 6248540 |
| 499 | 2809227143 | 2808606447 | Bacteria | 3572005 |
| 500 | 2812322826 | 2811994872 | Bacteria | 4121241 |
| 501 | 2816425267 | 2816332119 | Bacteria | 8120218 |
| 502 | 2821269703 | 2821268502 | Bacteria | 3750023 |
| 503 | 2827630105 | 2827628540 | Bacteria | 6858585 |
| 504 | 2833710650 | 2833709550 | Bacteria | 4008291 |
| 505 | 2852633475 | 2852632344 | Bacteria | 3463163 |
| 506 | 2863071284 | 2863067949 | Bacteria | 8541735 |
| 507 | 2866552485 | 2866552031 | Bacteria | 5824618 |
| 508 | 2887481159 | 2887478801 | Bacteria | 8972725 |
| 509 | 2893684728 | 2893684298 | Bacteria | 2897960 |
| 510 | 2899373226 | 2899370129 | Bacteria | 6781179 |
| 511 | 2904433174 | 2904430863 | Bacteria | 3486923 |
| 512 | 2906800201 | 2906799679 | Bacteria | 4031749 |
| 513 | 8001789907 | 8001781756 | Bacteria | 9586736 |
| 514 | 8045830877 | 8045830549 | Bacteria | 4444727 |
| 515 | 8056212248 | 8056207758 | Bacteria | 8639239 |
| 516 | 8056584197 | 8056579771 | Bacteria | 5840325 |
| 517 | Ga0070697_100254900 | |||
| 518 | JGI25406J46586_10002503 | |||
| 519 | Ga0007423J48922_100139 | |||
| 520 | Ga0006562J51391_1013228 | |||
| 521 | Ga0070658_10037035 | |||
| 522 | Ga0070658_10038778 | |||
| 523 | Ga0070658_10206129 | |||
| 524 | Ga0070683_100000788 | |||
| 525 | Ga0070683_100011229 | |||
| 526 | Ga0070683_100275177 | |||
| 527 | Ga0070680_100089920 | |||
| 528 | Ga0070680_100219528 | |||
| 529 | Ga0070682_100053199 | |||
| 530 | Ga0070682_100204111 | |||
| 531 | Ga0068868_100020276 | |||
| 532 | Ga0068868_100297987 | |||
| 533 | Ga0070661_100018602 | |||
| 534 | Ga0070668_100002892 | |||
| 535 | Ga0070659_100000366 | |||
| 536 | Ga0070667_100266000 | |||
| 537 | Ga0070713_100063291 | |||
| 538 | Ga0070681_10072056 | |||
| 539 | Ga0070681_10184109 | |||
| 540 | Ga0070685_10038518 | |||
| 541 | Ga0070679_100057416 | |||
| 542 | Ga0070679_100102334 | |||
| 543 | Ga0070684_100005779 | |||
| 544 | Ga0070684_100034787 | |||
| 545 | Ga0070684_100128556 | |||
| 546 | Ga0068853_100121712 | |||
| 547 | Ga0070665_100014281 | |||
| 548 | Ga0068855_100003828 | |||
| 549 | Ga0068855_100012277 | |||
| 550 | Ga0068855_100093255 | |||
| 551 | Ga0068855_100119913 | |||
| 552 | Ga0068855_100264911 | |||
| 553 | Ga0068855_100340944 | |||
| 554 | Ga0068855_100372887 | |||
| 555 | Ga0070664_100343867 | |||
| 556 | Ga0068857_100032767 | |||
| 557 | Ga0068857_100107945 | |||
| 558 | Ga0068857_100142277 | |||
| 559 | Ga0068854_100183454 | |||
| 560 | Ga0068856_100027143 | |||
| 561 | Ga0070702_100006280 | |||
| 562 | Ga0068852_100004834 | |||
| 563 | Ga0068852_100210694 | |||
| 564 | Ga0068859_100291783 | |||
| 565 | Ga0068864_100025648 | |||
| 566 | Ga0068866_10078640 | |||
| 567 | Ga0068851_10000020 | |||
| 568 | Ga0068858_100000233 | |||
| 569 | Ga0068858_100000389 | |||
| 570 | Ga0068858_100054250 | |||
| 571 | Ga0068858_100058959 | |||
| 572 | Ga0081455_10000025 | |||
| 573 | Ga0081455_10000216 | |||
| 574 | Ga0081538_10004745 | |||
| 575 | Ga0081540_1002284 | |||
| 576 | Ga0081540_1007058 | |||
| 577 | Ga0081540_1028837 | |||
| 578 | Ga0081539_10000406 | |||
| 579 | Ga0081539_10001654 | |||
| 580 | Ga0081539_10003071 | |||
| 581 | Ga0081539_10004512 | |||
| 582 | Ga0081539_10015562 | |||
| 583 | Ga0081539_10016547 | |||
| 584 | Ga0075364_10093212 | |||
| 585 | Ga0070716_100114300 | |||
| 586 | Ga0070712_100135730 | |||
| 587 | Ga0075367_10013697 | |||
| 588 | Ga0097621_100440201 | |||
| 589 | Ga0075370_10019082 | |||
| 590 | Ga0075430_100002938 | |||
| 591 | Ga0075430_100004419 | |||
| 592 | Ga0075431_100003270 | |||
| 593 | Ga0075431_100010252 | |||
| 594 | Ga0075429_100002781 | |||
| 595 | Ga0075429_100023558 | |||
| 596 | Ga0075429_100025151 | |||
| 597 | Ga0097620_100291806 | |||
| 598 | Ga0105240_10002356 | |||
| 599 | Ga0105240_10036680 | |||
| 600 | Ga0105240_10087693 | |||
| 601 | Ga0105245_10038697 | |||
| 602 | Ga0105245_10143603 | |||
| 603 | Ga0105245_10292174 | |||
| 604 | Ga0105247_10160870 | |||
| 605 | Ga0114129_10004719 | |||
| 606 | Ga0114129_10027492 | |||
| 607 | Ga0114129_10032726 | |||
| 608 | Ga0105241_10000260 | |||
| 609 | Ga0105242_10006821 | |||
| 610 | Ga0105242_10297029 | |||
| 611 | Ga0105248_10000882 | |||
| 612 | Ga0105248_10093803 | |||
| 613 | Ga0105237_10002645 | |||
| 614 | Ga0105237_10390869 | |||
| 615 | Ga0105238_10002073 | |||
| 616 | Ga0105238_10106378 | |||
| 617 | Ga0105238_10198817 | |||
| 618 | Ga0105239_10108514 | |||
| 619 | Ga0105239_10904018 | |||
| 620 | Ga0157370_10011259 | |||
| 621 | Ga0157370_10126242 | |||
| 622 | Ga0157369_10193367 | |||
| 623 | Ga0157369_10273992 | |||
| 624 | Ga0171462_1003 | |||
| 625 | Ga0157374_10429586 | |||
| 626 | Ga0157378_10150915 | |||
| 627 | Ga0163162_10039386 | |||
| 628 | Ga0163162_10853336 | |||
| 629 | Ga0157372_10515884 | |||
| 630 | Ga0163163_10003315 | |||
| 631 | Ga0163163_10121008 | |||
| 632 | Ga0163163_10399109 | |||
| 633 | Ga0163163_10717727 | |||
| 634 | Ga0157379_10000039 | |||
| 635 | Ga0157379_10042168 | |||
| 636 | Ga0157379_10045499 | |||
| 637 | Ga0157379_10060966 | |||
| 638 | Ga0157379_10127646 | |||
| 639 | Ga0163161_10156672 | |||
| 640 | Ga0206356_10827201 | |||
| 641 | Ga0206353_10050241 | |||
| 642 | Ga0213873_10000109 | |||
| 643 | Ga0213876_10098035 | |||
| 644 | Ga0213876_10175744 | |||
| 645 | Ga0213875_10000035 | |||
| 646 | Ga0207656_10000003 | |||
| 647 | Ga0207642_10050794 | |||
| 648 | Ga0207705_10009536 | |||
| 649 | Ga0207705_10026536 | |||
| 650 | Ga0207705_10027763 | |||
| 651 | Ga0207654_10000003 | |||
| 652 | Ga0207707_10046834 | |||
| 653 | Ga0207695_10030700 | |||
| 654 | Ga0207695_10113716 | |||
| 655 | Ga0207671_10000002 | |||
| 656 | Ga0207671_10175153 | |||
| 657 | Ga0207660_10050301 | |||
| 658 | Ga0207660_10067964 | |||
| 659 | Ga0207657_10010292 | |||
| 660 | Ga0207649_10151547 | |||
| 661 | Ga0207652_10403049 | |||
| 662 | Ga0207694_10000073 | |||
| 663 | Ga0207694_10217896 | |||
| 664 | Ga0207687_10060122 | |||
| 665 | Ga0207687_10156907 | |||
| 666 | Ga0207687_10238377 | |||
| 667 | Ga0207700_10029732 | |||
| 668 | Ga0207690_10007665 | |||
| 669 | Ga0207686_10228551 | |||
| 670 | Ga0207704_10022384 | |||
| 671 | Ga0207665_10263561 | |||
| 672 | Ga0207711_10001209 | |||
| 673 | Ga0207711_10054994 | |||
| 674 | Ga0207711_10083018 | |||
| 675 | Ga0207661_10005928 | |||
| 676 | Ga0207661_10014739 | |||
| 677 | Ga0207661_10197932 | |||
| 678 | Ga0207667_10011531 | |||
| 679 | Ga0207667_10024891 | |||
| 680 | Ga0207667_10032079 | |||
| 681 | Ga0207667_10084466 | |||
| 682 | Ga0207667_10218437 | |||
| 683 | Ga0207667_10258277 | |||
| 684 | Ga0207712_10176177 | |||
| 685 | Ga0207668_10307718 | |||
| 686 | Ga0207640_10169204 | |||
| 687 | Ga0207658_10133601 | |||
| 688 | Ga0207703_10000001 | |||
| 689 | Ga0207703_10000044 | |||
| 690 | Ga0207703_10124859 | |||
| 691 | Ga0207639_10005967 | |||
| 692 | Ga0207639_10190975 | |||
| 693 | Ga0207702_10033872 | |||
| 694 | Ga0207641_10146983 | |||
| 695 | Ga0207641_10290803 | |||
| 696 | Ga0207676_10128648 | |||
| 697 | Ga0207674_10042050 | |||
| 698 | Ga0207674_10075281 | |||
| 699 | Ga0207674_10288687 | |||
| 700 | Ga0207674_10383477 | |||
| 701 | Ga0207698_10001186 | |||
| 702 | Ga0207698_10012641 | |||
| 703 | Ga0207698_10120695 | |||
| 704 | Ga0268266_10028939 | |||
| 705 | Ga0307515_10002200 | |||
| 706 | Ga0307515_10010401 | |||
| 707 | Ga0307515_10060794 | |||
| 708 | Ga0307515_10063082 | |||
| 709 | Ga0307512_10005296 | |||
| 710 | Ga0307512_10006381 | |||
| 711 | Ga0307512_10018977 | |||
| 712 | Ga0307512_10072384 | |||
| 713 | Ga0307512_10101169 | |||
| 714 | Ga0314311_1025891 | |||
| 715 | Ga0307513_10013396 | |||
| 716 | Ga0307513_10086337 | |||
| 717 | Ga0307513_10132594 | |||
| 718 | Ga0307513_10208479 | |||
| 719 | Ga0307509_10029064 | |||
| 720 | Ga0307509_10057480 | |||
| 721 | Ga0307408_100198532 | |||
| 722 | Ga0307508_10001138 | |||
| 723 | Ga0307508_10043515 | |||
| 724 | Ga0316575_10000002 | |||
| 725 | Ga0316575_10019866 | |||
| 726 | Ga0316576_10002842 | |||
| 727 | Ga0316576_10030920 | |||
| 728 | Ga0316576_10114487 | |||
| 729 | Ga0307516_10010554 | |||
| 730 | Ga0307516_10018270 | |||
| 731 | Ga0307516_10161031 | |||
| 732 | Ga0307405_10010744 | |||
| 733 | Ga0307405_10140209 | |||
| 734 | Ga0307413_10034372 | |||
| 735 | Ga0307413_10070349 | |||
| 736 | Ga0307413_10077040 | |||
| 737 | Ga0307413_10095114 | |||
| 738 | Ga0307413_10149642 | |||
| 739 | Ga0307518_10110957 | |||
| 740 | Ga0307518_10145135 | |||
| 741 | Ga0307410_10051419 | |||
| 742 | Ga0326468_10000389 | |||
| 743 | Ga0307406_10009793 | |||
| 744 | Ga0307406_10070403 | |||
| 745 | Ga0307412_10048649 | |||
| 746 | Ga0307412_10189445 | |||
| 747 | Ga0307409_100043084 | |||
| 748 | Ga0307409_100228013 | |||
| 749 | Ga0307409_100235348 | |||
| 750 | Ga0307416_100096298 | |||
| 751 | Ga0307416_100359259 | |||
| 752 | Ga0307416_100509616 | |||
| 753 | Ga0307414_10037247 | |||
| 754 | Ga0307415_100012326 | |||
| 755 | Ga0307415_100234531 | |||
| 756 | Ga0307415_100417053 | |||
| 757 | Ga0316580_10002677 | |||
| 758 | Ga0307507_10025962 | |||
| 759 | Ga0307507_10254214 | |||
| 760 | Ga0373951_0001630 | |||
| 761 | Ga0373946_0043876 | |||
| 762 | Ga0373942_0000022 | |||
| 763 | Ga0373962_0005028 | |||
| 764 | Ga0316574_0073281 | |||
| 765 | Ga0316574_0102244 | |||
| 766 | Ga0373935_0024936 | |||
| 767 | Ga0373935_0039005 | |||
| 768 | Ga0373925_0011518 | |||
| 769 | Ga0395899_0005111 | |||
| 770 | Ga0395900_0441829 | |||
| 771 | Ga0395900_0637440 | |||
| 772 | Ga0395898_0036168 | |||
| 773 | Ga0395905_0020584 | |||
| 774 | Ga0316581_0004174 | |||
| 775 | Ga0436364_0245806 | |||
| 776 | Ga0436364_0623424 | |||
| 777 | Ga0395901_0038614 | |||
| 778 | Ga0395901_0052057 | |||
| 779 | Ga0395901_0052636 | |||
| 780 | Ga0436365_0713928 | |||
| 781 | Ga0436365_0788692 | |||
| 782 | Ga0436362_0069678 | |||
| 783 | Ga0451789_1030601 | |||
| 784 | Ga0451837_0448576 | |||
| 785 | Ga0451843_0244027 | |||
| 786 | Ga0451853_0390984 | |||
| 787 | Ga0466972_0013789 | |||
| 788 | Ga0466966_0002287 | |||
| 789 | Ga0466966_0011502 | |||
| 790 | Ga0466961_0150698 | |||
| 791 | Ga0466963_0000838 | |||
| 792 | Ga0466963_0010371 | |||
| 793 | Ga0466963_0084603 | |||
| 794 | Ga0466963_0092761 | |||
| 795 | Ga0466963_0160948 | |||
| 796 | Ga0466963_0254849 | |||
| 797 | Ga0466971_0004341 | |||
| 798 | Ga0466968_0000580 | |||
| 799 | Ga0466968_0010222 | |||
| 800 | Ga0466970_0000004 | |||
| 801 | Ga0466957_0015705 | |||
| 802 | Ga0466957_0055027 | |||
| 803 | Ga0466960_0022138 | |||
| 804 | Ga0466959_0032652 | |||
| 805 | Ga0466959_0222040 | |||
| 806 | Ga0466958_0000033 | |||
| 807 | Ga0466958_0015612 | |||
| 808 | Ga0466967_0113408 | |||
| 809 | Ga0466967_0255686 | |||
| 810 | Ga0495627_019693 | |||
| 811 | Ga0495641_0012860 | |||
| 812 | Ga0495582_0001779 | |||
| 813 | Ga0495606_0004232 | |||
| 814 | Ga0495630_0113032 | |||
| 815 | Ga0495665_0011525 | |||
| 816 | Ga0495640_0068745 | |||
| 817 | Ga0495668_0000464 | |||
| 818 | Ga0495625_0000677 | |||
| 819 | Ga0495647_0039825 | |||
| 820 | Ga0495658_0000114 | |||
| 821 | Ga0495613_0000739 | |||
| 822 | Ga0495581_0000832 | |||
| 823 | Ga0495581_0035242 | |||
| 824 | Ga0495676_0017933 | |||
| 825 | Ga0495593_0017299 | |||
| 826 | Ga0495614_0066504 | |||
| 827 | Ga0495626_0000184 | |||
| 828 | Ga0496100_0074571 | |||
| 829 | Ga0496102_0000791 | |||
| 830 | Ga0496103_0010962 | |||
| 831 | Ga0496104_0018187 | |||
| 832 | Ga0496104_0109150 | |||
| 833 | Ga0496104_0203415 | |||
| 834 | Ga0496105_0034528 | |||
| 835 | Ga0496105_0134391 | |||
| 836 | Ga0496105_0199497 | |||
| 837 | Ga0496106_0117782 | |||
| 838 | Ga0496108_0000130 | |||
| 839 | Ga0496108_0005233 | |||
| 840 | Ga0496108_0034676 | |||
| 841 | Ga0496108_0056117 | |||
| 842 | Ga0496109_0042613 | |||
| 843 | Ga0496109_0054077 | |||
| 844 | Ga0496109_0054947 | |||
| 845 | Ga0496109_0121712 | |||
| 846 | Ga0496109_0136023 | |||
| 847 | Ga0496109_0404380 | |||
| 848 | Ga0496110_0012751 | |||
| 849 | Ga0496111_0006024 | |||
| 850 | Ga0496111_0072222 | |||
| 851 | Ga0496112_0022411 | |||
| 852 | Ga0496112_0056567 | |||
| 853 | Ga0496112_0111883 | |||
| 854 | Ga0496112_0254043 | |||
| 855 | Ga0496112_0328076 | |||
| 856 | Ga0496112_0367441 | |||
| 857 | Ga0496113_0017742 | |||
| 858 | Ga0496113_0257321 | |||
| 859 | Ga0496114_0016318 | |||
| 860 | Ga0496114_0046418 | |||
| 861 | Ga0496114_0110062 | |||
| 862 | Ga0496114_0177834 | |||
| 863 | Ga0496117_0004850 | |||
| 864 | Ga0496117_0025622 | |||
| 865 | Ga0496118_0050084 | |||
| 866 | Ga0496119_0000341 | |||
| 867 | Ga0496119_0001875 | |||
| 868 | Ga0496119_0077619 | |||
| 869 | Ga0496120_0000456 | |||
| 870 | Ga0496121_0000040 | |||
| 871 | Ga0496122_0000120 | |||
| 872 | Ga0496123_0000051 | |||
| 873 | Ga0496124_0005668 | |||
| 874 | Ga0496125_0087422 | |||
| 875 | Ga0496126_0073947 | |||
| 876 | Ga0501031_0022836 | |||
| 877 | Ga0501031_0028765 | |||
| 878 | Ga0501031_0081171 | |||
| 879 | Ga0501032_0006227 | |||
| 880 | Ga0501032_0026576 | |||
| 881 | Ga0501032_0041904 | |||
| 882 | Ga0501032_0063319 | |||
| 883 | Ga0501034_0020171 | |||
| 884 | Ga0501034_0030259 | |||
| 885 | Ga0501034_0048617 | |||
| 886 | Ga0501034_0050021 | |||
| 887 | Ga0501034_0073806 | |||
| 888 | Ga0501034_0116712 | |||
| 889 | Ga0501034_0369275 | |||
| 890 | Ga0501034_0423867 | |||
| 891 | Ga0501036_0164951 | |||
| 892 | Ga0501036_0204963 | |||
| 893 | Ga0501037_0051486 | |||
| 894 | Ga0501037_0092233 | |||
| 895 | Ga0501037_0140255 | |||
| 896 | Ga0501038_0000236 | |||
| 897 | Ga0501038_0008533 | |||
| 898 | Ga0501038_0028314 | |||
| 899 | Ga0501038_0294797 | |||
| 900 | Ga0501039_0033393 | |||
| 901 | Ga0501039_0054960 | |||
| 902 | Ga0501039_0060829 | |||
| 903 | Ga0501040_0001340 | |||
| 904 | Ga0501041_0002143 | |||
| 905 | Ga0501041_0291409 | |||
| 906 | Ga0501042_0018119 | |||
| 907 | Ga0501043_0007175 | |||
| 908 | Ga0501043_0021814 | |||
| 909 | Ga0501043_0062724 | |||
| 910 | Ga0501043_0140267 | |||
| 911 | Ga0501046_0012430 | |||
| 912 | Ga0501046_0189343 | |||
| 913 | Ga0501047_0019137 | |||
| 914 | Ga0501047_0037345 | |||
| 915 | Ga0501047_0043258 | |||
| 916 | Ga0501047_0176862 | |||
| 917 | Ga0501048_0001562 | |||
| 918 | Ga0501048_0025140 | |||
| 919 | Ga0501048_0034926 | |||
| 920 | Ga0501048_0093499 | |||
| 921 | Ga0501067_0056001 | |||
| 922 | Ga0501068_0030310 | |||
| 923 | Ga0501069_0023499 | |||
| 924 | Ga0501070_0003210 | |||
| 925 | Ga0501070_0003401 | |||
| 926 | Ga0501070_0017478 | |||
| 927 | Ga0501070_0026601 | |||
| 928 | Ga0501070_0056516 | |||
| 929 | Ga0501070_0099618 | |||
| 930 | Ga0501070_0175822 | |||
| 931 | Ga0501070_0218549 | |||
| 932 | Ga0501071_0014139 | |||
| 933 | Ga0501071_0025934 | |||
| 934 | Ga0501072_0008276 | |||
| 935 | Ga0501072_0040450 | |||
| 936 | Ga0501073_0000226 | |||
| 937 | Ga0501073_0069635 | |||
| 938 | Ga0501073_0078133 | |||
| 939 | Ga0501073_0088670 | |||
| 940 | Ga0501074_0086563 | |||
| 941 | Ga0501075_0014072 | |||
| 942 | Ga0501076_0136725 | |||
| 943 | Ga0501077_0042751 | |||
| 944 | Ga0501079_0023902 | |||
| 945 | Ga0501079_0165795 | |||
| 946 | Ga0501080_0000084 | |||
| 947 | Ga0501080_0035093 | |||
| 948 | Ga0501080_0134954 | |||
| 949 | Ga0501080_0426299 | |||
| 950 | Ga0501081_0020497 | |||
| 951 | Ga0501083_0000527 | |||
| 952 | Ga0501035_0013456 | |||
| 953 | Ga0501035_0043300 | |||
| 954 | Ga0501044_0043234 | |||
| 955 | Ga0501044_0148960 | |||
| 956 | Ga0501045_0007616 | |||
| 957 | nmdc:mga05p37_14772_c1 | |||
| 958 | nmdc:mga05p37_24954_c1 | |||
| 959 | nmdc:mga05p37_49506_c1 | |||
| 960 | nmdc:mga09592_111880_c1 | |||
| 961 | nmdc:mga09592_13806_c1 | |||
| 962 | nmdc:mga09592_35883_c1 | |||
| 963 | nmdc:mga0qj67_118035_c1 | |||
| 964 | nmdc:mga0qj67_200680_c1 | |||
| 965 | nmdc:mga0qj67_286686_c1 | |||
| 966 | nmdc:mga06r32_136362_c1 | |||
| 967 | nmdc:mga06r32_48732_c1 | |||
| 968 | Ga0500644_0007068 | |||
| 969 | Ga0500646_0000405 | |||
| 970 | Ga0500646_0041513 | |||
| 971 | Ga0500651_0018931 | |||
| 972 | Ga0500660_025721 | |||
| 973 | Ga0500556_0080367 | |||
| 974 | Ga0500652_004043 | |||
| 975 | Ga0500559_0109013 | |||
| 976 | Ga0500568_0000014 | |||
| 977 | Ga0500568_0008086 | |||
| 978 | Ga0500568_0009268 | |||
| 979 | Ga0500573_0000059 | |||
| 980 | Ga0500577_0036532 | |||
| 981 | Ga0500588_0001538 | |||
| 982 | Ga0500589_039852 | |||
| 983 | Ga0500600_0064692 | |||
| 984 | Ga0500620_001055 | |||
| 985 | Ga0501084_0004926 | |||
| 986 | Ga0501084_0149553 | |||
| 987 | Ga0501082_0001508 | |||
| 988 | Ga0501082_0083008 | |||
| 989 | Ga0501082_0089427 | |||
| 990 | Ga0501082_0092358 | |||
| 991 | Ga0466962_0000826 | |||
| 992 | Ga0530510_0030253 | |||
| 993 | 2515850840 | |||
| 994 | 2643753574 | |||
| 995 | 2643848066 | |||
| 996 | 2643885095 | |||
| 997 | 2644446383 | |||
| 998 | 2645726241 | |||
| 999 | 2676476805 | |||
| 1000 | 2729906129 | |||
| 1001 | 2738692320 | |||
| 1002 | 2739323406 | |||
| 1003 | 2739609149 | |||
| 1004 | 2753268286 | |||
| 1005 | 2753301640 | |||
| 1006 | 2753301662 | |||
| 1007 | 2760303406 | |||
| 1008 | 2760622700 | |||
| 1009 | 2774399835 | |||
| 1010 | 2776375436 | |||
| 1011 | 2791913450 | |||
| 1012 | 2795795996 | |||
| 1013 | 2808631449 | |||
| 1014 | 2809027486 | |||
| 1015 | 2809227143 | |||
| 1016 | 2812322826 | |||
| 1017 | 2816425267 | |||
| 1018 | 2821269703 | |||
| 1019 | 2827630105 | |||
| 1020 | 2833710650 | |||
| 1021 | 2852633475 | |||
| 1022 | 2863071284 | |||
| 1023 | 2866552485 | |||
| 1024 | 2887481159 | |||
| 1025 | 2893684728 | |||
| 1026 | 2899373226 | |||
| 1027 | 2904433174 | |||
| 1028 | 2906800201 | |||
| 1029 | 8001789907 | |||
| 1030 | 8045830877 | |||
| 1031 | 8056212248 | |||
| 1032 | 8056584197 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z81-assembly1.cif.gz_C | trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution | 0.9327 | 15 | 60 |
| 1dm9-assembly1.cif.gz_A | heat shock protein 15 kd | 0.9149 | 14 | 60 |
| 2i82-assembly2.cif.gz_B | crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure | 0.9022 | 79 | 292 |
| 1prz-assembly1.cif.gz_A | crystal structure of pseudouridine synthase rlud catalytic module | 0.9021 | 74 | 305 |
| 1v9f-assembly1.cif.gz_A | crystal structure of catalytic domain of pseudouridine synthase rlud from escherichia coli | 0.9001 | 74 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHQ3_3_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9937 | 5 | 65 | 3.10.290.10 |
| af_P9WHQ3_81_307_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9889 | 83 | 305 | 3.30.2350.10 |
| af_P9WHQ3_81_307_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9674 | 83 | 305 | 3.30.2350.10 |
| af_Q2FZ78_82_304_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9616 | 83 | 305 | 3.30.2350.10 |
| af_I1JSZ4_206_438_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9433 | 133 | 304 | 3.30.2350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A448UT97-F1-model_v4 | Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) | 0.9939 | 146 | 305 |
GO:0000455
GO:0003723 GO:0160140 |
| AF-A0A2Z5QZT0-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.9904 | 74 | 305 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A3D2VKT9-F1-model_v4 | RNA pseudouridine synthase | 0.9879 | 186 | 305 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A6B3HYX2-F1-model_v4 | RNA pseudouridine synthase | 0.9862 | 111 | 218 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A6J6GGR7-F1-model_v4 | Unannotated protein | 0.9824 | 179 | 305 |
GO:0000455
GO:0003723 GO:0009982 |