F457973

General Info

Members Datasets Scaffolds Average Seq Length
516 292 1032 307

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100254900|Ga0070697_1002549002
Length 301
Sequence MPAETLKAEPGRLDAVVAKLTGASRAEVQRAIDDGLVRVDGERKSRSFRLRGGERIESELPTEPAIPAEGPPVPVRFRDDDLAVIAKPAGLPTHPTARRRTGTLVNRLRGMGLPLSAAGGPLRPGIVHRLDVGTSGLMIVALSDEAHRALSAMFRRHEPDRRYLALVRGGVAYDSFDVEAPLGRRGGRVTVSAGGGRHAETAFEVKERFEGATLLEARPRTGRTHQIRVHLSAVEHPVLGDRSYGGGGDIARRLGLTRPFLHSWRLAFDHPFTGVRIRLEEPLPGDLDAALRRAAGEEVTA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
245 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
246 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
247 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
248 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
249 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
255 2643221546 Microbacterium sp. Root53 Isolate Unclassified
256 2643221566 Microbacterium sp. Root166 Isolate Unclassified
257 2643221575 Microbacterium sp. Root61 Isolate Unclassified
258 2643221679 Angustibacter sp. Root456 Isolate Unclassified
259 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
260 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
261 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
262 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
263 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
264 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
265 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
266 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
267 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
268 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
269 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
270 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
271 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
272 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
273 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
274 2808606394 Promicromonospora sp. C35 Isolate Unclassified
275 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
276 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
277 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
278 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
279 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
280 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
281 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
282 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
283 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
284 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
285 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
286 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
287 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
288 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
289 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
290 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
291 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
292 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.47
Metatranscriptomes 0.78
Isolates 7.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 0
Rhizoplane 6.98
Rhizosphere 75.58
Stem 0
Stem Tuber 0.19
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100254900 3300005536 Bacteria 1501
2 JGI25406J46586_10002503 3300003203 Bacteria 8693
3 Ga0007423J48922_100139 3300003285 Bacteria 33024
4 Ga0006562J51391_1013228 3300003578 Bacteria 9500
5 Ga0070658_10037035 3300005327 Bacteria 3931
6 Ga0070658_10038778 3300005327 Bacteria 3842
7 Ga0070658_10206129 3300005327 Bacteria 1660
8 Ga0070683_100000788 3300005329 Bacteria 23382
9 Ga0070683_100011229 3300005329 Bacteria 7728
10 Ga0070683_100275177 3300005329 Bacteria 1602
11 Ga0070680_100089920 3300005336 Bacteria 2541
12 Ga0070680_100219528 3300005336 Bacteria 1604
13 Ga0070682_100053199 3300005337 Bacteria 2536
14 Ga0070682_100204111 3300005337 Bacteria 1396
15 Ga0068868_100020276 3300005338 Bacteria 4990
16 Ga0068868_100297987 3300005338 Bacteria 1369
17 Ga0070661_100018602 3300005344 Bacteria 4941
18 Ga0070668_100002892 3300005347 Bacteria 12673
19 Ga0070659_100000366 3300005366 Bacteria 34220
20 Ga0070667_100266000 3300005367 Bacteria 1536
21 Ga0070713_100063291 3300005436 Bacteria 3101
22 Ga0070681_10072056 3300005458 Bacteria 3418
23 Ga0070681_10184109 3300005458 Bacteria 2009
24 Ga0070685_10038518 3300005466 Bacteria 2711
25 Ga0070679_100057416 3300005530 Bacteria 3880
26 Ga0070679_100102334 3300005530 Bacteria 2850
27 Ga0070684_100005779 3300005535 Bacteria 9514
28 Ga0070684_100034787 3300005535 Bacteria 4309
29 Ga0070684_100128556 3300005535 Bacteria 2284
30 Ga0068853_100121712 3300005539 Bacteria 2328
31 Ga0070665_100014281 3300005548 Bacteria 7974
32 Ga0068855_100003828 3300005563 Bacteria 18395
33 Ga0068855_100012277 3300005563 Bacteria 10351
34 Ga0068855_100093255 3300005563 Bacteria 3472
35 Ga0068855_100119913 3300005563 Bacteria 3011
36 Ga0068855_100264911 3300005563 Bacteria 1913
37 Ga0068855_100340944 3300005563 Bacteria 1652
38 Ga0068855_100372887 3300005563 Bacteria 1568
39 Ga0070664_100343867 3300005564 Bacteria 1356
40 Ga0068857_100032767 3300005577 Bacteria 4593
41 Ga0068857_100107945 3300005577 Bacteria 2500
42 Ga0068857_100142277 3300005577 Bacteria 2169
43 Ga0068854_100183454 3300005578 Bacteria 1636
44 Ga0068856_100027143 3300005614 Bacteria 5586
45 Ga0070702_100006280 3300005615 Bacteria 5613
46 Ga0068852_100004834 3300005616 Bacteria 9572
47 Ga0068852_100210694 3300005616 Bacteria 1843
48 Ga0068859_100291783 3300005617 Bacteria 1724
49 Ga0068864_100025648 3300005618 Bacteria 4966
50 Ga0068866_10078640 3300005718 Bacteria 1765
51 Ga0068851_10000020 3300005834 Bacteria 133551
52 Ga0068858_100000233 3300005842 Bacteria 60097
53 Ga0068858_100000389 3300005842 Bacteria 46073
54 Ga0068858_100054250 3300005842 Bacteria 3707
55 Ga0068858_100058959 3300005842 Bacteria 3548
56 Ga0081455_10000025 3300005937 Bacteria 157583
57 Ga0081455_10000216 3300005937 Bacteria 73781
58 Ga0081538_10004745 3300005981 Bacteria 12440
59 Ga0081540_1002284 3300005983 Bacteria 15742
60 Ga0081540_1007058 3300005983 Bacteria 8073
61 Ga0081540_1028837 3300005983 Bacteria 3105
62 Ga0081539_10000406 3300005985 Bacteria 91786
63 Ga0081539_10001654 3300005985 Bacteria 36124
64 Ga0081539_10003071 3300005985 Bacteria 21521
65 Ga0081539_10004512 3300005985 Bacteria 15299
66 Ga0081539_10015562 3300005985 Bacteria 5518
67 Ga0081539_10016547 3300005985 Bacteria 5253
68 Ga0075364_10093212 3300006051 Bacteria 2000
69 Ga0070716_100114300 3300006173 Bacteria 1678
70 Ga0070712_100135730 3300006175 Bacteria 1870
71 Ga0075367_10013697 3300006178 Bacteria 4369
72 Ga0097621_100440201 3300006237 Bacteria 1173
73 Ga0075370_10019082 3300006353 Bacteria 3728
74 Ga0075430_100002938 3300006846 Bacteria 14258
75 Ga0075430_100004419 3300006846 Bacteria 11862
76 Ga0075431_100003270 3300006847 Bacteria 15678
77 Ga0075431_100010252 3300006847 Bacteria 9420
78 Ga0075429_100002781 3300006880 Bacteria 14795
79 Ga0075429_100023558 3300006880 Bacteria 5343
80 Ga0075429_100025151 3300006880 Bacteria 5168
81 Ga0097620_100291806 3300006931 Bacteria 1724
82 Ga0105240_10002356 3300009093 Bacteria 30453
83 Ga0105240_10036680 3300009093 Bacteria 6305
84 Ga0105240_10087693 3300009093 Bacteria 3810
85 Ga0105245_10038697 3300009098 Bacteria 4244
86 Ga0105245_10143603 3300009098 Bacteria 2250
87 Ga0105245_10292174 3300009098 Bacteria 1597
88 Ga0105247_10160870 3300009101 Bacteria 1486
89 Ga0114129_10004719 3300009147 Bacteria 19248
90 Ga0114129_10027492 3300009147 Bacteria 8053
91 Ga0114129_10032726 3300009147 Bacteria 7346
92 Ga0105241_10000260 3300009174 Bacteria 39516
93 Ga0105242_10006821 3300009176 Bacteria 8806
94 Ga0105242_10297029 3300009176 Bacteria 1473
95 Ga0105248_10000882 3300009177 Bacteria 33632
96 Ga0105248_10093803 3300009177 Bacteria 3381
97 Ga0105237_10002645 3300009545 Bacteria 22052
98 Ga0105237_10390869 3300009545 Bacteria 1396
99 Ga0105238_10002073 3300009551 Bacteria 20252
100 Ga0105238_10106378 3300009551 Bacteria 2787
101 Ga0105238_10198817 3300009551 Bacteria 1980
102 Ga0105239_10108514 3300010375 Bacteria 3075
103 Ga0105239_10904018 3300010375 Bacteria 1013
104 Ga0157370_10011259 3300013104 Bacteria 9378
105 Ga0157370_10126242 3300013104 Bacteria 2388
106 Ga0157369_10193367 3300013105 Bacteria 2137
107 Ga0157369_10273992 3300013105 Bacteria 1758
108 Ga0171462_1003 3300013250 Bacteria 853796
109 Ga0157374_10429586 3300013296 Bacteria 1320
110 Ga0157378_10150915 3300013297 Bacteria 2165
111 Ga0163162_10039386 3300013306 Bacteria 4722
112 Ga0163162_10853336 3300013306 Bacteria 1026
113 Ga0157372_10515884 3300013307 Bacteria 1393
114 Ga0163163_10003315 3300014325 Bacteria 13656
115 Ga0163163_10121008 3300014325 Bacteria 2652
116 Ga0163163_10399109 3300014325 Bacteria 1433
117 Ga0163163_10717727 3300014325 Bacteria 1063
118 Ga0157379_10000039 3300014968 Bacteria 79484
119 Ga0157379_10042168 3300014968 Bacteria 4074
120 Ga0157379_10045499 3300014968 Bacteria 3917
121 Ga0157379_10060966 3300014968 Bacteria 3373
122 Ga0157379_10127646 3300014968 Bacteria 2288
123 Ga0163161_10156672 3300017792 Bacteria 1734
124 Ga0206356_10827201 3300020070 Bacteria 2491
125 Ga0206353_10050241 3300020082 Bacteria 2614
126 Ga0213873_10000109 3300021358 Bacteria 16093
127 Ga0213876_10098035 3300021384 Bacteria 1553
128 Ga0213876_10175744 3300021384 Bacteria 1139
129 Ga0213875_10000035 3300021388 Bacteria 167011
130 Ga0207656_10000003 3300025321 Bacteria 771644
131 Ga0207642_10050794 3300025899 Bacteria 1872
132 Ga0207705_10009536 3300025909 Bacteria 7063
133 Ga0207705_10026536 3300025909 Bacteria 4131
134 Ga0207705_10027763 3300025909 Bacteria 4036
135 Ga0207654_10000003 3300025911 Bacteria 1030378
136 Ga0207707_10046834 3300025912 Bacteria 3766
137 Ga0207695_10030700 3300025913 Bacteria 5913
138 Ga0207695_10113716 3300025913 Bacteria 2683
139 Ga0207671_10000002 3300025914 Bacteria 1144816
140 Ga0207671_10175153 3300025914 Bacteria 1667
141 Ga0207660_10050301 3300025917 Bacteria 2958
142 Ga0207660_10067964 3300025917 Bacteria 2583
143 Ga0207657_10010292 3300025919 Bacteria 9338
144 Ga0207649_10151547 3300025920 Bacteria 1597
145 Ga0207652_10403049 3300025921 Bacteria 1234
146 Ga0207694_10000073 3300025924 Bacteria 118507
147 Ga0207694_10217896 3300025924 Bacteria 1556
148 Ga0207687_10060122 3300025927 Bacteria 2679
149 Ga0207687_10156907 3300025927 Bacteria 1742
150 Ga0207687_10238377 3300025927 Bacteria 1440
151 Ga0207700_10029732 3300025928 Bacteria 3860
152 Ga0207690_10007665 3300025932 Bacteria 6403
153 Ga0207686_10228551 3300025934 Bacteria 1347
154 Ga0207704_10022384 3300025938 Bacteria 3385
155 Ga0207665_10263561 3300025939 Bacteria 1277
156 Ga0207711_10001209 3300025941 Bacteria 24455
157 Ga0207711_10054994 3300025941 Bacteria 3417
158 Ga0207711_10083018 3300025941 Bacteria 2802
159 Ga0207661_10005928 3300025944 Bacteria 8625
160 Ga0207661_10014739 3300025944 Bacteria 5734
161 Ga0207661_10197932 3300025944 Bacteria 1765
162 Ga0207667_10011531 3300025949 Bacteria 10270
163 Ga0207667_10024891 3300025949 Bacteria 6564
164 Ga0207667_10032079 3300025949 Bacteria 5663
165 Ga0207667_10084466 3300025949 Bacteria 3287
166 Ga0207667_10218437 3300025949 Bacteria 1953
167 Ga0207667_10258277 3300025949 Bacteria 1782
168 Ga0207712_10176177 3300025961 Bacteria 1676
169 Ga0207668_10307718 3300025972 Bacteria 1310
170 Ga0207640_10169204 3300025981 Bacteria 1626
171 Ga0207658_10133601 3300025986 Bacteria 1997
172 Ga0207703_10000001 3300026035 Bacteria 822925
173 Ga0207703_10000044 3300026035 Bacteria 158471
174 Ga0207703_10124859 3300026035 Bacteria 2214
175 Ga0207639_10005967 3300026041 Bacteria 8264
176 Ga0207639_10190975 3300026041 Bacteria 1749
177 Ga0207702_10033872 3300026078 Bacteria 4269
178 Ga0207641_10146983 3300026088 Bacteria 2132
179 Ga0207641_10290803 3300026088 Bacteria 1540
180 Ga0207676_10128648 3300026095 Bacteria 2149
181 Ga0207674_10042050 3300026116 Bacteria 4723
182 Ga0207674_10075281 3300026116 Bacteria 3386
183 Ga0207674_10288687 3300026116 Bacteria 1589
184 Ga0207674_10383477 3300026116 Bacteria 1359
185 Ga0207698_10001186 3300026142 Bacteria 15193
186 Ga0207698_10012641 3300026142 Bacteria 5533
187 Ga0207698_10120695 3300026142 Bacteria 2218
188 Ga0268266_10028939 3300028379 Bacteria 4708
189 Ga0307515_10002200 3300028794 Bacteria 42791
190 Ga0307515_10010401 3300028794 Bacteria 17825
191 Ga0307515_10060794 3300028794 Bacteria 5378
192 Ga0307515_10063082 3300028794 Bacteria 5216
193 Ga0307512_10005296 3300030522 Bacteria 13532
194 Ga0307512_10006381 3300030522 Bacteria 11952
195 Ga0307512_10018977 3300030522 Bacteria 6273
196 Ga0307512_10072384 3300030522 Bacteria 2550
197 Ga0307512_10101169 3300030522 Bacteria 1951
198 Ga0314311_1025891 3300030733 Bacteria 1917
199 Ga0307513_10013396 3300031456 Bacteria 10063
200 Ga0307513_10086337 3300031456 Bacteria 3217
201 Ga0307513_10132594 3300031456 Bacteria 2434
202 Ga0307513_10208479 3300031456 Bacteria 1788
203 Ga0307509_10029064 3300031507 Bacteria 6139
204 Ga0307509_10057480 3300031507 Bacteria 4124
205 Ga0307408_100198532 3300031548 Bacteria 1622
206 Ga0307508_10001138 3300031616 Bacteria 30634
207 Ga0307508_10043515 3300031616 Bacteria 4023
208 Ga0316575_10000002 3300031665 Bacteria 148142
209 Ga0316575_10019866 3300031665 Bacteria 2572
210 Ga0316576_10002842 3300031727 Bacteria 9976
211 Ga0316576_10030920 3300031727 Bacteria 3795
212 Ga0316576_10114487 3300031727 Bacteria 2023
213 Ga0307516_10010554 3300031730 Bacteria 10141
214 Ga0307516_10018270 3300031730 Bacteria 7291
215 Ga0307516_10161031 3300031730 Bacteria 1994
216 Ga0307405_10010744 3300031731 Bacteria 4760
217 Ga0307405_10140209 3300031731 Bacteria 1684
218 Ga0307413_10034372 3300031824 Bacteria 2897
219 Ga0307413_10070349 3300031824 Bacteria 2200
220 Ga0307413_10077040 3300031824 Bacteria 2122
221 Ga0307413_10095114 3300031824 Bacteria 1952
222 Ga0307413_10149642 3300031824 Bacteria 1625
223 Ga0307518_10110957 3300031838 Bacteria 1954
224 Ga0307518_10145135 3300031838 Bacteria 1649
225 Ga0307410_10051419 3300031852 Bacteria 2777
226 Ga0326468_10000389 3300031889 Bacteria 4643
227 Ga0307406_10009793 3300031901 Bacteria 5391
228 Ga0307406_10070403 3300031901 Bacteria 2290
229 Ga0307412_10048649 3300031911 Bacteria 2790
230 Ga0307412_10189445 3300031911 Bacteria 1554
231 Ga0307409_100043084 3300031995 Bacteria 3385
232 Ga0307409_100228013 3300031995 Bacteria 1686
233 Ga0307409_100235348 3300031995 Bacteria 1663
234 Ga0307416_100096298 3300032002 Bacteria 2559
235 Ga0307416_100359259 3300032002 Bacteria 1478
236 Ga0307416_100509616 3300032002 Bacteria 1269
237 Ga0307414_10037247 3300032004 Bacteria 3255
238 Ga0307415_100012326 3300032126 Bacteria 4939
239 Ga0307415_100234531 3300032126 Bacteria 1480
240 Ga0307415_100417053 3300032126 Bacteria 1151
241 Ga0316580_10002677 3300032139 Bacteria 4951
242 Ga0307507_10025962 3300033179 Bacteria 6331
243 Ga0307507_10254214 3300033179 Bacteria 1131
244 Ga0373951_0001630 3300035091 Bacteria 5885
245 Ga0373946_0043876 3300035171 Unclassified 1844
246 Ga0373942_0000022 3300035207 Bacteria 30229
247 Ga0373962_0005028 3300035242 Bacteria 3196
248 Ga0316574_0073281 3300035398 Bacteria 2165
249 Ga0316574_0102244 3300035398 Bacteria 1834
250 Ga0373935_0024936 3300035692 Bacteria 3684
251 Ga0373935_0039005 3300035692 Bacteria 2976
252 Ga0373925_0011518 3300037068 Bacteria 6399
253 Ga0395899_0005111 3300037312 Bacteria 10209
254 Ga0395900_0441829 3300037418 Bacteria 1258
255 Ga0395900_0637440 3300037418 Bacteria 1003
256 Ga0395898_0036168 3300037466 Bacteria 4904
257 Ga0395905_0020584 3300037471 Bacteria 6246
258 Ga0316581_0004174 3300037588 Bacteria 3660
259 Ga0436364_0245806 3300037853 Bacteria 18262
260 Ga0436364_0623424 3300037853 Bacteria 43926
261 Ga0395901_0038614 3300038443 Bacteria 4938
262 Ga0395901_0052057 3300038443 Bacteria 4256
263 Ga0395901_0052636 3300038443 Bacteria 4231
264 Ga0436365_0713928 3300039437 Bacteria 1166
265 Ga0436365_0788692 3300039437 Bacteria 10905
266 Ga0436362_0069678 3300039453 Bacteria 57350
267 Ga0451789_1030601 3300041443 Bacteria 3201
268 Ga0451837_0448576 3300041494 Bacteria 1533
269 Ga0451843_0244027 3300041509 Bacteria 1536
270 Ga0451853_0390984 3300041512 Bacteria 4288
271 Ga0466972_0013789 3300044658 Bacteria 4057
272 Ga0466966_0002287 3300044684 Bacteria 12487
273 Ga0466966_0011502 3300044684 Bacteria 5871
274 Ga0466961_0150698 3300044693 Bacteria 1452
275 Ga0466963_0000838 3300044694 Bacteria 15433
276 Ga0466963_0010371 3300044694 Bacteria 5639
277 Ga0466963_0084603 3300044694 Bacteria 2152
278 Ga0466963_0092761 3300044694 Bacteria 2058
279 Ga0466963_0160948 3300044694 Bacteria 1562
280 Ga0466963_0254849 3300044694 Bacteria 1232
281 Ga0466971_0004341 3300044719 Bacteria 6111
282 Ga0466968_0000580 3300044735 Bacteria 12453
283 Ga0466968_0010222 3300044735 Bacteria 3633
284 Ga0466970_0000004 3300044765 Bacteria 108620
285 Ga0466957_0015705 3300044842 Bacteria 4423
286 Ga0466957_0055027 3300044842 Bacteria 2431
287 Ga0466960_0022138 3300044901 Bacteria 2838
288 Ga0466959_0032652 3300045049 Bacteria 3853
289 Ga0466959_0222040 3300045049 Bacteria 1310
290 Ga0466958_0000033 3300045836 Bacteria 38883
291 Ga0466958_0015612 3300045836 Bacteria 4355
292 Ga0466967_0113408 3300045976 Bacteria 2494
293 Ga0466967_0255686 3300045976 Bacteria 1675
294 Ga0495627_019693 3300046453 Bacteria 2258
295 Ga0495641_0012860 3300046461 Bacteria 4644
296 Ga0495582_0001779 3300046473 Bacteria 12166
297 Ga0495606_0004232 3300046507 Bacteria 14511
298 Ga0495630_0113032 3300046517 Unclassified 2057
299 Ga0495665_0011525 3300046531 Bacteria 4785
300 Ga0495640_0068745 3300046533 Bacteria 2383
301 Ga0495668_0000464 3300046616 Bacteria 51784
302 Ga0495625_0000677 3300046660 Bacteria 48654
303 Ga0495647_0039825 3300046681 Unclassified 1783
304 Ga0495658_0000114 3300046683 Bacteria 42960
305 Ga0495613_0000739 3300046689 Bacteria 25623
306 Ga0495581_0000832 3300047315 Bacteria 16421
307 Ga0495581_0035242 3300047315 Bacteria 2896
308 Ga0495676_0017933 3300047321 Bacteria 6248
309 Ga0495593_0017299 3300047673 Bacteria 4058
310 Ga0495614_0066504 3300048089 Unclassified 1550
311 Ga0495626_0000184 3300048091 Bacteria 76088
312 Ga0496100_0074571 3300048903 Bacteria 2273
313 Ga0496102_0000791 3300048905 Bacteria 30774
314 Ga0496103_0010962 3300048906 Bacteria 5365
315 Ga0496104_0018187 3300048907 Bacteria 6409
316 Ga0496104_0109150 3300048907 Bacteria 2652
317 Ga0496104_0203415 3300048907 Bacteria 1892
318 Ga0496105_0034528 3300048908 Bacteria 4160
319 Ga0496105_0134391 3300048908 Bacteria 2038
320 Ga0496105_0199497 3300048908 Bacteria 1633
321 Ga0496106_0117782 3300048909 Bacteria 2073
322 Ga0496108_0000130 3300048911 Bacteria 74276
323 Ga0496108_0005233 3300048911 Bacteria 10476
324 Ga0496108_0034676 3300048911 Bacteria 4192
325 Ga0496108_0056117 3300048911 Bacteria 3308
326 Ga0496109_0042613 3300048912 Bacteria 4112
327 Ga0496109_0054077 3300048912 Bacteria 3663
328 Ga0496109_0054947 3300048912 Bacteria 3632
329 Ga0496109_0121712 3300048912 Bacteria 2431
330 Ga0496109_0136023 3300048912 Bacteria 2296
331 Ga0496109_0404380 3300048912 Bacteria 1290
332 Ga0496110_0012751 3300048913 Bacteria 6921
333 Ga0496111_0006024 3300048914 Bacteria 7835
334 Ga0496111_0072222 3300048914 Bacteria 2512
335 Ga0496112_0022411 3300048915 Bacteria 6019
336 Ga0496112_0056567 3300048915 Bacteria 3860
337 Ga0496112_0111883 3300048915 Bacteria 2700
338 Ga0496112_0254043 3300048915 Bacteria 1708
339 Ga0496112_0328076 3300048915 Bacteria 1474
340 Ga0496112_0367441 3300048915 Bacteria 1380
341 Ga0496113_0017742 3300048916 Bacteria 4948
342 Ga0496113_0257321 3300048916 Bacteria 1394
343 Ga0496114_0016318 3300048917 Bacteria 5981
344 Ga0496114_0046418 3300048917 Bacteria 3609
345 Ga0496114_0110062 3300048917 Bacteria 2359
346 Ga0496114_0177834 3300048917 Bacteria 1857
347 Ga0496117_0004850 3300048920 Bacteria 14534
348 Ga0496117_0025622 3300048920 Bacteria 4633
349 Ga0496118_0050084 3300048921 Bacteria 3209
350 Ga0496119_0000341 3300048922 Bacteria 65282
351 Ga0496119_0001875 3300048922 Bacteria 24260
352 Ga0496119_0077619 3300048922 Bacteria 1923
353 Ga0496120_0000456 3300048923 Bacteria 64535
354 Ga0496121_0000040 3300048924 Bacteria 348494
355 Ga0496122_0000120 3300048925 Bacteria 182539
356 Ga0496123_0000051 3300048926 Bacteria 237095
357 Ga0496124_0005668 3300048927 Bacteria 13925
358 Ga0496125_0087422 3300048928 Bacteria 2354
359 Ga0496126_0073947 3300048929 Bacteria 3028
360 Ga0501031_0022836 3300049568 Bacteria 4079
361 Ga0501031_0028765 3300049568 Bacteria 3622
362 Ga0501031_0081171 3300049568 Bacteria 2114
363 Ga0501032_0006227 3300049569 Bacteria 8781
364 Ga0501032_0026576 3300049569 Bacteria 3979
365 Ga0501032_0041904 3300049569 Bacteria 3107
366 Ga0501032_0063319 3300049569 Bacteria 2476
367 Ga0501034_0020171 3300049571 Bacteria 6805
368 Ga0501034_0030259 3300049571 Bacteria 5503
369 Ga0501034_0048617 3300049571 Bacteria 4281
370 Ga0501034_0050021 3300049571 Bacteria 4216
371 Ga0501034_0073806 3300049571 Bacteria 3420
372 Ga0501034_0116712 3300049571 Bacteria 2657
373 Ga0501034_0369275 3300049571 Bacteria 1361
374 Ga0501034_0423867 3300049571 Bacteria 1251
375 Ga0501036_0164951 3300049572 Bacteria 1867
376 Ga0501036_0204963 3300049572 Bacteria 1658
377 Ga0501037_0051486 3300049573 Bacteria 3012
378 Ga0501037_0092233 3300049573 Bacteria 2191
379 Ga0501037_0140255 3300049573 Bacteria 1730
380 Ga0501038_0000236 3300049574 Bacteria 46834
381 Ga0501038_0008533 3300049574 Bacteria 9414
382 Ga0501038_0028314 3300049574 Bacteria 4978
383 Ga0501038_0294797 3300049574 Bacteria 1274
384 Ga0501039_0033393 3300049575 Bacteria 3968
385 Ga0501039_0054960 3300049575 Bacteria 3083
386 Ga0501039_0060829 3300049575 Bacteria 2924
387 Ga0501040_0001340 3300049576 Bacteria 15574
388 Ga0501041_0002143 3300049577 Bacteria 11133
389 Ga0501041_0291409 3300049577 Bacteria 1028
390 Ga0501042_0018119 3300049578 Bacteria 4871
391 Ga0501043_0007175 3300049579 Bacteria 8857
392 Ga0501043_0021814 3300049579 Bacteria 5023
393 Ga0501043_0062724 3300049579 Bacteria 2918
394 Ga0501043_0140267 3300049579 Bacteria 1893
395 Ga0501046_0012430 3300049580 Bacteria 7248
396 Ga0501046_0189343 3300049580 Bacteria 1535
397 Ga0501047_0019137 3300049581 Bacteria 6568
398 Ga0501047_0037345 3300049581 Bacteria 4697
399 Ga0501047_0043258 3300049581 Bacteria 4350
400 Ga0501047_0176862 3300049581 Bacteria 2001
401 Ga0501048_0001562 3300049582 Bacteria 17396
402 Ga0501048_0025140 3300049582 Bacteria 4341
403 Ga0501048_0034926 3300049582 Bacteria 3623
404 Ga0501048_0093499 3300049582 Bacteria 2121
405 Ga0501067_0056001 3300049583 Bacteria 2185
406 Ga0501068_0030310 3300049584 Bacteria 3208
407 Ga0501069_0023499 3300049585 Bacteria 3362
408 Ga0501070_0003210 3300049586 Bacteria 14219
409 Ga0501070_0003401 3300049586 Bacteria 13809
410 Ga0501070_0017478 3300049586 Bacteria 6021
411 Ga0501070_0026601 3300049586 Bacteria 4854
412 Ga0501070_0056516 3300049586 Bacteria 3253
413 Ga0501070_0099618 3300049586 Bacteria 2404
414 Ga0501070_0175822 3300049586 Bacteria 1763
415 Ga0501070_0218549 3300049586 Bacteria 1563
416 Ga0501071_0014139 3300049587 Bacteria 5456
417 Ga0501071_0025934 3300049587 Bacteria 4109
418 Ga0501072_0008276 3300049588 Bacteria 7904
419 Ga0501072_0040450 3300049588 Bacteria 3660
420 Ga0501073_0000226 3300049589 Bacteria 36967
421 Ga0501073_0069635 3300049589 Bacteria 2451
422 Ga0501073_0078133 3300049589 Bacteria 2303
423 Ga0501073_0088670 3300049589 Bacteria 2151
424 Ga0501074_0086563 3300049590 Bacteria 2245
425 Ga0501075_0014072 3300049591 Bacteria 5729
426 Ga0501076_0136725 3300049592 Bacteria 1990
427 Ga0501077_0042751 3300049593 Bacteria 2880
428 Ga0501079_0023902 3300049741 Bacteria 4688
429 Ga0501079_0165795 3300049741 Bacteria 1723
430 Ga0501080_0000084 3300049742 Bacteria 62784
431 Ga0501080_0035093 3300049742 Bacteria 4682
432 Ga0501080_0134954 3300049742 Bacteria 2284
433 Ga0501080_0426299 3300049742 Bacteria 1191
434 Ga0501081_0020497 3300049743 Bacteria 4406
435 Ga0501083_0000527 3300049744 Bacteria 24400
436 Ga0501035_0013456 3300049822 Bacteria 7553
437 Ga0501035_0043300 3300049822 Bacteria 4057
438 Ga0501044_0043234 3300049823 Bacteria 4682
439 Ga0501044_0148960 3300049823 Bacteria 2323
440 Ga0501045_0007616 3300049824 Bacteria 7526
441 nmdc:mga05p37_14772_c1 3300050507 Bacteria 9377
442 nmdc:mga05p37_24954_c1 3300050507 Bacteria 7267
443 nmdc:mga05p37_49506_c1 3300050507 Bacteria 5169
444 nmdc:mga09592_111880_c1 3300050508 Bacteria 2343
445 nmdc:mga09592_13806_c1 3300050508 Bacteria 6600
446 nmdc:mga09592_35883_c1 3300050508 Bacteria 4152
447 nmdc:mga0qj67_118035_c1 3300050509 Bacteria 2144
448 nmdc:mga0qj67_200680_c1 3300050509 Bacteria 1621
449 nmdc:mga0qj67_286686_c1 3300050509 Bacteria 1335
450 nmdc:mga06r32_136362_c1 3300050510 Bacteria 2429
451 nmdc:mga06r32_48732_c1 3300050510 Bacteria 4050
452 Ga0500644_0007068 3300053088 Bacteria 2908
453 Ga0500646_0000405 3300053090 Bacteria 12788
454 Ga0500646_0041513 3300053090 Bacteria 1297
455 Ga0500651_0018931 3300053093 Bacteria 4267
456 Ga0500660_025721 3300053100 Bacteria 3106
457 Ga0500556_0080367 3300053104 Bacteria 1232
458 Ga0500652_004043 3300053131 Bacteria 4500
459 Ga0500559_0109013 3300053136 Bacteria 1282
460 Ga0500568_0000014 3300053139 Bacteria 223550
461 Ga0500568_0008086 3300053139 Bacteria 5104
462 Ga0500568_0009268 3300053139 Bacteria 4690
463 Ga0500573_0000059 3300053140 Bacteria 71066
464 Ga0500577_0036532 3300053142 Bacteria 1759
465 Ga0500588_0001538 3300053146 Bacteria 4428
466 Ga0500589_039852 3300053147 Bacteria 2193
467 Ga0500600_0064692 3300053149 Bacteria 2025
468 Ga0500620_001055 3300053155 Bacteria 4862
469 Ga0501084_0004926 3300054114 Bacteria 10910
470 Ga0501084_0149553 3300054114 Bacteria 1968
471 Ga0501082_0001508 3300060353 Bacteria 20522
472 Ga0501082_0083008 3300060353 Bacteria 2764
473 Ga0501082_0089427 3300060353 Bacteria 2659
474 Ga0501082_0092358 3300060353 Bacteria 2615
475 Ga0466962_0000826 3300061719 Bacteria 13937
476 Ga0530510_0030253 3300061734 Bacteria 3888
477 2515850840 2515154155 Bacteria 7985436
478 2643753574 2643221546 Bacteria 2910897
479 2643848066 2643221566 Bacteria 3460379
480 2643885095 2643221575 Bacteria 4022601
481 2644446383 2643221679 Bacteria 3839507
482 2645726241 2643221962 Bacteria 3874254
483 2676476805 2675903058 Bacteria 6822861
484 2729906129 2728369276 Bacteria 5610032
485 2738692320 2738541272 Bacteria 6848551
486 2739323406 2738543027 Bacteria 6409078
487 2739609149 2739367654 Bacteria 6049412
488 2753268286 2751185782 Bacteria 11227053
489 2753301640 2751185788 Bacteria 4541048
490 2753301662 2751185788 Bacteria 4541048
491 2760303406 2758568522 Bacteria 5953541
492 2760622700 2758568621 Bacteria 5967089
493 2774399835 2773857763 Bacteria 4180068
494 2776375436 2775506925 Bacteria 7237746
495 2791913450 2791354901 Bacteria 8322202
496 2795795996 2795385472 Bacteria 6627535
497 2808631449 2808606306 Bacteria 3608896
498 2809027486 2808606394 Bacteria 6248540
499 2809227143 2808606447 Bacteria 3572005
500 2812322826 2811994872 Bacteria 4121241
501 2816425267 2816332119 Bacteria 8120218
502 2821269703 2821268502 Bacteria 3750023
503 2827630105 2827628540 Bacteria 6858585
504 2833710650 2833709550 Bacteria 4008291
505 2852633475 2852632344 Bacteria 3463163
506 2863071284 2863067949 Bacteria 8541735
507 2866552485 2866552031 Bacteria 5824618
508 2887481159 2887478801 Bacteria 8972725
509 2893684728 2893684298 Bacteria 2897960
510 2899373226 2899370129 Bacteria 6781179
511 2904433174 2904430863 Bacteria 3486923
512 2906800201 2906799679 Bacteria 4031749
513 8001789907 8001781756 Bacteria 9586736
514 8045830877 8045830549 Bacteria 4444727
515 8056212248 8056207758 Bacteria 8639239
516 8056584197 8056579771 Bacteria 5840325
517 Ga0070697_100254900
518 JGI25406J46586_10002503
519 Ga0007423J48922_100139
520 Ga0006562J51391_1013228
521 Ga0070658_10037035
522 Ga0070658_10038778
523 Ga0070658_10206129
524 Ga0070683_100000788
525 Ga0070683_100011229
526 Ga0070683_100275177
527 Ga0070680_100089920
528 Ga0070680_100219528
529 Ga0070682_100053199
530 Ga0070682_100204111
531 Ga0068868_100020276
532 Ga0068868_100297987
533 Ga0070661_100018602
534 Ga0070668_100002892
535 Ga0070659_100000366
536 Ga0070667_100266000
537 Ga0070713_100063291
538 Ga0070681_10072056
539 Ga0070681_10184109
540 Ga0070685_10038518
541 Ga0070679_100057416
542 Ga0070679_100102334
543 Ga0070684_100005779
544 Ga0070684_100034787
545 Ga0070684_100128556
546 Ga0068853_100121712
547 Ga0070665_100014281
548 Ga0068855_100003828
549 Ga0068855_100012277
550 Ga0068855_100093255
551 Ga0068855_100119913
552 Ga0068855_100264911
553 Ga0068855_100340944
554 Ga0068855_100372887
555 Ga0070664_100343867
556 Ga0068857_100032767
557 Ga0068857_100107945
558 Ga0068857_100142277
559 Ga0068854_100183454
560 Ga0068856_100027143
561 Ga0070702_100006280
562 Ga0068852_100004834
563 Ga0068852_100210694
564 Ga0068859_100291783
565 Ga0068864_100025648
566 Ga0068866_10078640
567 Ga0068851_10000020
568 Ga0068858_100000233
569 Ga0068858_100000389
570 Ga0068858_100054250
571 Ga0068858_100058959
572 Ga0081455_10000025
573 Ga0081455_10000216
574 Ga0081538_10004745
575 Ga0081540_1002284
576 Ga0081540_1007058
577 Ga0081540_1028837
578 Ga0081539_10000406
579 Ga0081539_10001654
580 Ga0081539_10003071
581 Ga0081539_10004512
582 Ga0081539_10015562
583 Ga0081539_10016547
584 Ga0075364_10093212
585 Ga0070716_100114300
586 Ga0070712_100135730
587 Ga0075367_10013697
588 Ga0097621_100440201
589 Ga0075370_10019082
590 Ga0075430_100002938
591 Ga0075430_100004419
592 Ga0075431_100003270
593 Ga0075431_100010252
594 Ga0075429_100002781
595 Ga0075429_100023558
596 Ga0075429_100025151
597 Ga0097620_100291806
598 Ga0105240_10002356
599 Ga0105240_10036680
600 Ga0105240_10087693
601 Ga0105245_10038697
602 Ga0105245_10143603
603 Ga0105245_10292174
604 Ga0105247_10160870
605 Ga0114129_10004719
606 Ga0114129_10027492
607 Ga0114129_10032726
608 Ga0105241_10000260
609 Ga0105242_10006821
610 Ga0105242_10297029
611 Ga0105248_10000882
612 Ga0105248_10093803
613 Ga0105237_10002645
614 Ga0105237_10390869
615 Ga0105238_10002073
616 Ga0105238_10106378
617 Ga0105238_10198817
618 Ga0105239_10108514
619 Ga0105239_10904018
620 Ga0157370_10011259
621 Ga0157370_10126242
622 Ga0157369_10193367
623 Ga0157369_10273992
624 Ga0171462_1003
625 Ga0157374_10429586
626 Ga0157378_10150915
627 Ga0163162_10039386
628 Ga0163162_10853336
629 Ga0157372_10515884
630 Ga0163163_10003315
631 Ga0163163_10121008
632 Ga0163163_10399109
633 Ga0163163_10717727
634 Ga0157379_10000039
635 Ga0157379_10042168
636 Ga0157379_10045499
637 Ga0157379_10060966
638 Ga0157379_10127646
639 Ga0163161_10156672
640 Ga0206356_10827201
641 Ga0206353_10050241
642 Ga0213873_10000109
643 Ga0213876_10098035
644 Ga0213876_10175744
645 Ga0213875_10000035
646 Ga0207656_10000003
647 Ga0207642_10050794
648 Ga0207705_10009536
649 Ga0207705_10026536
650 Ga0207705_10027763
651 Ga0207654_10000003
652 Ga0207707_10046834
653 Ga0207695_10030700
654 Ga0207695_10113716
655 Ga0207671_10000002
656 Ga0207671_10175153
657 Ga0207660_10050301
658 Ga0207660_10067964
659 Ga0207657_10010292
660 Ga0207649_10151547
661 Ga0207652_10403049
662 Ga0207694_10000073
663 Ga0207694_10217896
664 Ga0207687_10060122
665 Ga0207687_10156907
666 Ga0207687_10238377
667 Ga0207700_10029732
668 Ga0207690_10007665
669 Ga0207686_10228551
670 Ga0207704_10022384
671 Ga0207665_10263561
672 Ga0207711_10001209
673 Ga0207711_10054994
674 Ga0207711_10083018
675 Ga0207661_10005928
676 Ga0207661_10014739
677 Ga0207661_10197932
678 Ga0207667_10011531
679 Ga0207667_10024891
680 Ga0207667_10032079
681 Ga0207667_10084466
682 Ga0207667_10218437
683 Ga0207667_10258277
684 Ga0207712_10176177
685 Ga0207668_10307718
686 Ga0207640_10169204
687 Ga0207658_10133601
688 Ga0207703_10000001
689 Ga0207703_10000044
690 Ga0207703_10124859
691 Ga0207639_10005967
692 Ga0207639_10190975
693 Ga0207702_10033872
694 Ga0207641_10146983
695 Ga0207641_10290803
696 Ga0207676_10128648
697 Ga0207674_10042050
698 Ga0207674_10075281
699 Ga0207674_10288687
700 Ga0207674_10383477
701 Ga0207698_10001186
702 Ga0207698_10012641
703 Ga0207698_10120695
704 Ga0268266_10028939
705 Ga0307515_10002200
706 Ga0307515_10010401
707 Ga0307515_10060794
708 Ga0307515_10063082
709 Ga0307512_10005296
710 Ga0307512_10006381
711 Ga0307512_10018977
712 Ga0307512_10072384
713 Ga0307512_10101169
714 Ga0314311_1025891
715 Ga0307513_10013396
716 Ga0307513_10086337
717 Ga0307513_10132594
718 Ga0307513_10208479
719 Ga0307509_10029064
720 Ga0307509_10057480
721 Ga0307408_100198532
722 Ga0307508_10001138
723 Ga0307508_10043515
724 Ga0316575_10000002
725 Ga0316575_10019866
726 Ga0316576_10002842
727 Ga0316576_10030920
728 Ga0316576_10114487
729 Ga0307516_10010554
730 Ga0307516_10018270
731 Ga0307516_10161031
732 Ga0307405_10010744
733 Ga0307405_10140209
734 Ga0307413_10034372
735 Ga0307413_10070349
736 Ga0307413_10077040
737 Ga0307413_10095114
738 Ga0307413_10149642
739 Ga0307518_10110957
740 Ga0307518_10145135
741 Ga0307410_10051419
742 Ga0326468_10000389
743 Ga0307406_10009793
744 Ga0307406_10070403
745 Ga0307412_10048649
746 Ga0307412_10189445
747 Ga0307409_100043084
748 Ga0307409_100228013
749 Ga0307409_100235348
750 Ga0307416_100096298
751 Ga0307416_100359259
752 Ga0307416_100509616
753 Ga0307414_10037247
754 Ga0307415_100012326
755 Ga0307415_100234531
756 Ga0307415_100417053
757 Ga0316580_10002677
758 Ga0307507_10025962
759 Ga0307507_10254214
760 Ga0373951_0001630
761 Ga0373946_0043876
762 Ga0373942_0000022
763 Ga0373962_0005028
764 Ga0316574_0073281
765 Ga0316574_0102244
766 Ga0373935_0024936
767 Ga0373935_0039005
768 Ga0373925_0011518
769 Ga0395899_0005111
770 Ga0395900_0441829
771 Ga0395900_0637440
772 Ga0395898_0036168
773 Ga0395905_0020584
774 Ga0316581_0004174
775 Ga0436364_0245806
776 Ga0436364_0623424
777 Ga0395901_0038614
778 Ga0395901_0052057
779 Ga0395901_0052636
780 Ga0436365_0713928
781 Ga0436365_0788692
782 Ga0436362_0069678
783 Ga0451789_1030601
784 Ga0451837_0448576
785 Ga0451843_0244027
786 Ga0451853_0390984
787 Ga0466972_0013789
788 Ga0466966_0002287
789 Ga0466966_0011502
790 Ga0466961_0150698
791 Ga0466963_0000838
792 Ga0466963_0010371
793 Ga0466963_0084603
794 Ga0466963_0092761
795 Ga0466963_0160948
796 Ga0466963_0254849
797 Ga0466971_0004341
798 Ga0466968_0000580
799 Ga0466968_0010222
800 Ga0466970_0000004
801 Ga0466957_0015705
802 Ga0466957_0055027
803 Ga0466960_0022138
804 Ga0466959_0032652
805 Ga0466959_0222040
806 Ga0466958_0000033
807 Ga0466958_0015612
808 Ga0466967_0113408
809 Ga0466967_0255686
810 Ga0495627_019693
811 Ga0495641_0012860
812 Ga0495582_0001779
813 Ga0495606_0004232
814 Ga0495630_0113032
815 Ga0495665_0011525
816 Ga0495640_0068745
817 Ga0495668_0000464
818 Ga0495625_0000677
819 Ga0495647_0039825
820 Ga0495658_0000114
821 Ga0495613_0000739
822 Ga0495581_0000832
823 Ga0495581_0035242
824 Ga0495676_0017933
825 Ga0495593_0017299
826 Ga0495614_0066504
827 Ga0495626_0000184
828 Ga0496100_0074571
829 Ga0496102_0000791
830 Ga0496103_0010962
831 Ga0496104_0018187
832 Ga0496104_0109150
833 Ga0496104_0203415
834 Ga0496105_0034528
835 Ga0496105_0134391
836 Ga0496105_0199497
837 Ga0496106_0117782
838 Ga0496108_0000130
839 Ga0496108_0005233
840 Ga0496108_0034676
841 Ga0496108_0056117
842 Ga0496109_0042613
843 Ga0496109_0054077
844 Ga0496109_0054947
845 Ga0496109_0121712
846 Ga0496109_0136023
847 Ga0496109_0404380
848 Ga0496110_0012751
849 Ga0496111_0006024
850 Ga0496111_0072222
851 Ga0496112_0022411
852 Ga0496112_0056567
853 Ga0496112_0111883
854 Ga0496112_0254043
855 Ga0496112_0328076
856 Ga0496112_0367441
857 Ga0496113_0017742
858 Ga0496113_0257321
859 Ga0496114_0016318
860 Ga0496114_0046418
861 Ga0496114_0110062
862 Ga0496114_0177834
863 Ga0496117_0004850
864 Ga0496117_0025622
865 Ga0496118_0050084
866 Ga0496119_0000341
867 Ga0496119_0001875
868 Ga0496119_0077619
869 Ga0496120_0000456
870 Ga0496121_0000040
871 Ga0496122_0000120
872 Ga0496123_0000051
873 Ga0496124_0005668
874 Ga0496125_0087422
875 Ga0496126_0073947
876 Ga0501031_0022836
877 Ga0501031_0028765
878 Ga0501031_0081171
879 Ga0501032_0006227
880 Ga0501032_0026576
881 Ga0501032_0041904
882 Ga0501032_0063319
883 Ga0501034_0020171
884 Ga0501034_0030259
885 Ga0501034_0048617
886 Ga0501034_0050021
887 Ga0501034_0073806
888 Ga0501034_0116712
889 Ga0501034_0369275
890 Ga0501034_0423867
891 Ga0501036_0164951
892 Ga0501036_0204963
893 Ga0501037_0051486
894 Ga0501037_0092233
895 Ga0501037_0140255
896 Ga0501038_0000236
897 Ga0501038_0008533
898 Ga0501038_0028314
899 Ga0501038_0294797
900 Ga0501039_0033393
901 Ga0501039_0054960
902 Ga0501039_0060829
903 Ga0501040_0001340
904 Ga0501041_0002143
905 Ga0501041_0291409
906 Ga0501042_0018119
907 Ga0501043_0007175
908 Ga0501043_0021814
909 Ga0501043_0062724
910 Ga0501043_0140267
911 Ga0501046_0012430
912 Ga0501046_0189343
913 Ga0501047_0019137
914 Ga0501047_0037345
915 Ga0501047_0043258
916 Ga0501047_0176862
917 Ga0501048_0001562
918 Ga0501048_0025140
919 Ga0501048_0034926
920 Ga0501048_0093499
921 Ga0501067_0056001
922 Ga0501068_0030310
923 Ga0501069_0023499
924 Ga0501070_0003210
925 Ga0501070_0003401
926 Ga0501070_0017478
927 Ga0501070_0026601
928 Ga0501070_0056516
929 Ga0501070_0099618
930 Ga0501070_0175822
931 Ga0501070_0218549
932 Ga0501071_0014139
933 Ga0501071_0025934
934 Ga0501072_0008276
935 Ga0501072_0040450
936 Ga0501073_0000226
937 Ga0501073_0069635
938 Ga0501073_0078133
939 Ga0501073_0088670
940 Ga0501074_0086563
941 Ga0501075_0014072
942 Ga0501076_0136725
943 Ga0501077_0042751
944 Ga0501079_0023902
945 Ga0501079_0165795
946 Ga0501080_0000084
947 Ga0501080_0035093
948 Ga0501080_0134954
949 Ga0501080_0426299
950 Ga0501081_0020497
951 Ga0501083_0000527
952 Ga0501035_0013456
953 Ga0501035_0043300
954 Ga0501044_0043234
955 Ga0501044_0148960
956 Ga0501045_0007616
957 nmdc:mga05p37_14772_c1
958 nmdc:mga05p37_24954_c1
959 nmdc:mga05p37_49506_c1
960 nmdc:mga09592_111880_c1
961 nmdc:mga09592_13806_c1
962 nmdc:mga09592_35883_c1
963 nmdc:mga0qj67_118035_c1
964 nmdc:mga0qj67_200680_c1
965 nmdc:mga0qj67_286686_c1
966 nmdc:mga06r32_136362_c1
967 nmdc:mga06r32_48732_c1
968 Ga0500644_0007068
969 Ga0500646_0000405
970 Ga0500646_0041513
971 Ga0500651_0018931
972 Ga0500660_025721
973 Ga0500556_0080367
974 Ga0500652_004043
975 Ga0500559_0109013
976 Ga0500568_0000014
977 Ga0500568_0008086
978 Ga0500568_0009268
979 Ga0500573_0000059
980 Ga0500577_0036532
981 Ga0500588_0001538
982 Ga0500589_039852
983 Ga0500600_0064692
984 Ga0500620_001055
985 Ga0501084_0004926
986 Ga0501084_0149553
987 Ga0501082_0001508
988 Ga0501082_0083008
989 Ga0501082_0089427
990 Ga0501082_0092358
991 Ga0466962_0000826
992 Ga0530510_0030253
993 2515850840
994 2643753574
995 2643848066
996 2643885095
997 2644446383
998 2645726241
999 2676476805
1000 2729906129
1001 2738692320
1002 2739323406
1003 2739609149
1004 2753268286
1005 2753301640
1006 2753301662
1007 2760303406
1008 2760622700
1009 2774399835
1010 2776375436
1011 2791913450
1012 2795795996
1013 2808631449
1014 2809027486
1015 2809227143
1016 2812322826
1017 2816425267
1018 2821269703
1019 2827630105
1020 2833710650
1021 2852633475
1022 2863071284
1023 2866552485
1024 2887481159
1025 2893684728
1026 2899373226
1027 2904433174
1028 2906800201
1029 8001789907
1030 8045830877
1031 8056212248
1032 8056584197

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

81

233

0.97

PF01479

S4

S4 domain

11

56

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.9327 15 60
1dm9-assembly1.cif.gz_A heat shock protein 15 kd 0.9149 14 60
2i82-assembly2.cif.gz_B crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure 0.9022 79 292
1prz-assembly1.cif.gz_A crystal structure of pseudouridine synthase rlud catalytic module 0.9021 74 305
1v9f-assembly1.cif.gz_A crystal structure of catalytic domain of pseudouridine synthase rlud from escherichia coli 0.9001 74 305
ID Description Score Start End Superfamily
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9937 5 65 3.10.290.10
af_P9WHQ3_81_307_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9889 83 305 3.30.2350.10
af_P9WHQ3_81_307_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9674 83 305 3.30.2350.10
af_Q2FZ78_82_304_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9616 83 305 3.30.2350.10
af_I1JSZ4_206_438_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9433 133 304 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A448UT97-F1-model_v4 Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) 0.9939 146 305 GO:0000455
GO:0003723
GO:0160140
AF-A0A2Z5QZT0-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.9904 74 305 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A3D2VKT9-F1-model_v4 RNA pseudouridine synthase 0.9879 186 305 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A6B3HYX2-F1-model_v4 RNA pseudouridine synthase 0.9862 111 218 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A6J6GGR7-F1-model_v4 Unannotated protein 0.9824 179 305 GO:0000455
GO:0003723
GO:0009982

Map