F457980

General Info

Members Datasets Scaffolds Average Seq Length
516 235 1032 268

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100249002|Ga0068871_1002490021
Length 304
Sequence MQVAVRISPAKSRLYVNPIGQGVPRSRTVVTKAMWLATGLVACWLLATAALAQQPFIVVASTTSTEQSGLFPQLLPAFENDTGIKVRVVAVGTGQALDIGRRGDADVVLVHDRDAELKWLSEGEGVKRYPVMYNDFILVGPAADRAHVKGGKDITAALKAIADAKAWFISRADKSGTHAAELRLWKDAGVDIDTAKGPWYRETGFGMGAALNTATAMNAYILADRGTWLNFKNRGELGIVVEGDKRLFNQYGVMLVNPAKHPNVKKDLGQKFIDWLVSPRGQAVIAAYKIDGQQLFFPNAGTDS

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
155 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
156 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
224 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
225 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
226 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
227 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
228 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
229 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
230 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
231 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
232 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
233 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
234 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
235 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.1
Nodule 2.52
Rhizoplane 5.04
Rhizosphere 87.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100249002 3300006358 Bacteria 1547
2 JGI24744J21845_10039039 3300002077 Bacteria 891
3 JGI25153J46596_10000697 3300003215 Bacteria 20546
4 JGI25160J50197_1016718 3300003354 Bacteria 2352
5 Ga0055531_10001781 3300003794 Bacteria 15298
6 Ga0065712_10142291 3300005290 Bacteria 1439
7 Ga0065715_10169866 3300005293 Bacteria 1555
8 Ga0070658_10007510 3300005327 Bacteria 8797
9 Ga0070658_10165782 3300005327 Bacteria 1855
10 Ga0070658_10202078 3300005327 Bacteria 1677
11 Ga0070676_10024310 3300005328 Bacteria 3412
12 Ga0070676_10154802 3300005328 Bacteria 1470
13 Ga0070683_100015951 3300005329 Bacteria 6609
14 Ga0070683_100033050 3300005329 Bacteria 4714
15 Ga0070683_100033783 3300005329 Bacteria 4667
16 Ga0070683_100048106 3300005329 Bacteria 3943
17 Ga0070683_100094466 3300005329 Bacteria 2810
18 Ga0070690_100138468 3300005330 Bacteria 1650
19 Ga0070670_100616404 3300005331 Bacteria 972
20 Ga0070677_10000279 3300005333 Bacteria 17887
21 Ga0070677_10004604 3300005333 Bacteria 4509
22 Ga0068869_100018799 3300005334 Bacteria 4710
23 Ga0070666_10000909 3300005335 Bacteria 17984
24 Ga0070666_10009328 3300005335 Bacteria 6114
25 Ga0070680_100042347 3300005336 Bacteria 3695
26 Ga0070680_100244796 3300005336 Bacteria 1516
27 Ga0070680_100352506 3300005336 Bacteria 1251
28 Ga0070682_100226119 3300005337 Bacteria 1335
29 Ga0068868_100014717 3300005338 Bacteria 5770
30 Ga0070660_100003025 3300005339 Bacteria 11572
31 Ga0070660_100005144 3300005339 Bacteria 9042
32 Ga0070660_100013300 3300005339 Bacteria 5898
33 Ga0070689_100014090 3300005340 Bacteria 5799
34 Ga0070661_100006294 3300005344 Bacteria 8189
35 Ga0070661_100006707 3300005344 Bacteria 7942
36 Ga0070661_100018286 3300005344 Bacteria 4981
37 Ga0070661_100028394 3300005344 Bacteria 4035
38 Ga0070661_100095953 3300005344 Bacteria 2200
39 Ga0070661_100169268 3300005344 Bacteria 1658
40 Ga0070668_100006984 3300005347 Bacteria 8364
41 Ga0070675_100002259 3300005354 Bacteria 14291
42 Ga0070671_100007760 3300005355 Bacteria 8572
43 Ga0070671_100172141 3300005355 Bacteria 1831
44 Ga0070674_100007912 3300005356 Bacteria 6291
45 Ga0070674_100029928 3300005356 Bacteria 3595
46 Ga0070674_100247866 3300005356 Bacteria 1398
47 Ga0070673_100031152 3300005364 Bacteria 4000
48 Ga0070673_100137596 3300005364 Bacteria 2057
49 Ga0070673_100153650 3300005364 Bacteria 1951
50 Ga0070673_100198300 3300005364 Bacteria 1728
51 Ga0070673_100274453 3300005364 Bacteria 1477
52 Ga0070659_100006487 3300005366 Bacteria 8444
53 Ga0070659_100016986 3300005366 Bacteria 5470
54 Ga0070659_100024659 3300005366 Bacteria 4613
55 Ga0070667_100028719 3300005367 Bacteria 4631
56 Ga0070667_100068856 3300005367 Bacteria 3012
57 Ga0070667_100080563 3300005367 Bacteria 2785
58 Ga0070667_100149407 3300005367 Bacteria 2051
59 Ga0070714_100005916 3300005435 Bacteria 9386
60 Ga0070714_100026036 3300005435 Bacteria 4832
61 Ga0070714_100029982 3300005435 Bacteria 4526
62 Ga0070714_100090910 3300005435 Bacteria 2674
63 Ga0070714_100093841 3300005435 Bacteria 2633
64 Ga0070713_100331451 3300005436 Bacteria 1408
65 Ga0070710_10008802 3300005437 Bacteria 4923
66 Ga0070710_10049965 3300005437 Bacteria 2342
67 Ga0070701_10130416 3300005438 Bacteria 1428
68 Ga0070711_100528396 3300005439 Bacteria 976
69 Ga0070663_100004923 3300005455 Bacteria 7885
70 Ga0070663_100017836 3300005455 Bacteria 4641
71 Ga0070663_100026482 3300005455 Bacteria 3929
72 Ga0070663_100108957 3300005455 Bacteria 2078
73 Ga0070678_100005292 3300005456 Bacteria 7436
74 Ga0070662_100000176 3300005457 Bacteria 37127
75 Ga0070662_100213880 3300005457 Bacteria 1535
76 Ga0070681_10018775 3300005458 Bacteria 6920
77 Ga0070681_10019135 3300005458 Bacteria 6852
78 Ga0068867_100012504 3300005459 Bacteria 6008
79 Ga0068867_100061533 3300005459 Bacteria 2787
80 Ga0070679_100041004 3300005530 Bacteria 4608
81 Ga0070679_100059215 3300005530 Bacteria 3817
82 Ga0070679_100187306 3300005530 Bacteria 2039
83 Ga0070679_100506202 3300005530 Bacteria 1151
84 Ga0070684_100011072 3300005535 Bacteria 7175
85 Ga0070684_100051881 3300005535 Bacteria 3564
86 Ga0070684_100141909 3300005535 Bacteria 2172
87 Ga0070684_100200258 3300005535 Bacteria 1818
88 Ga0068853_100002699 3300005539 Bacteria 13382
89 Ga0068853_100018236 3300005539 Bacteria 5807
90 Ga0068853_100144886 3300005539 Bacteria 2134
91 Ga0068853_100151346 3300005539 Bacteria 2089
92 Ga0068853_100346231 3300005539 Bacteria 1382
93 Ga0070672_100004215 3300005543 Bacteria 9405
94 Ga0070672_100020336 3300005543 Bacteria 4840
95 Ga0070672_100232774 3300005543 Bacteria 1548
96 Ga0070696_100017753 3300005546 Bacteria 4804
97 Ga0070665_100001520 3300005548 Bacteria 26875
98 Ga0070665_100084139 3300005548 Bacteria 3186
99 Ga0068855_100000851 3300005563 Bacteria 37847
100 Ga0068855_100006879 3300005563 Bacteria 13795
101 Ga0068855_100007145 3300005563 Bacteria 13553
102 Ga0068855_100012156 3300005563 Bacteria 10402
103 Ga0068855_100067326 3300005563 Bacteria 4173
104 Ga0068855_100099998 3300005563 Bacteria 3340
105 Ga0068855_100176418 3300005563 Bacteria 2418
106 Ga0068855_100261101 3300005563 Bacteria 1929
107 Ga0070664_100002386 3300005564 Bacteria 15087
108 Ga0070664_100005097 3300005564 Bacteria 10539
109 Ga0070664_100020677 3300005564 Bacteria 5421
110 Ga0070664_100022515 3300005564 Bacteria 5196
111 Ga0070664_100078837 3300005564 Bacteria 2834
112 Ga0070664_100089381 3300005564 Bacteria 2665
113 Ga0068857_100006451 3300005577 Bacteria 10059
114 Ga0068857_100017532 3300005577 Bacteria 6278
115 Ga0068857_100034957 3300005577 Bacteria 4447
116 Ga0068857_100188771 3300005577 Bacteria 1877
117 Ga0068857_100201582 3300005577 Bacteria 1814
118 Ga0068857_100462109 3300005577 Bacteria 1188
119 Ga0068854_100021119 3300005578 Bacteria 4415
120 Ga0068854_100112741 3300005578 Bacteria 2053
121 Ga0068856_100001266 3300005614 Bacteria 26611
122 Ga0068856_100020324 3300005614 Bacteria 6450
123 Ga0068856_100021333 3300005614 Bacteria 6295
124 Ga0068856_100024124 3300005614 Bacteria 5918
125 Ga0068856_100104480 3300005614 Bacteria 2827
126 Ga0068856_100145280 3300005614 Bacteria 2380
127 Ga0068856_100293288 3300005614 Bacteria 1643
128 Ga0068856_100453037 3300005614 Bacteria 1304
129 Ga0068852_100009114 3300005616 Bacteria 7347
130 Ga0068852_100010673 3300005616 Bacteria 6877
131 Ga0068852_100028326 3300005616 Bacteria 4582
132 Ga0068852_100093796 3300005616 Bacteria 2691
133 Ga0068852_100151145 3300005616 Bacteria 2159
134 Ga0068852_100170130 3300005616 Bacteria 2042
135 Ga0068859_100207669 3300005617 Bacteria 2044
136 Ga0068859_100330232 3300005617 Bacteria 1619
137 Ga0068859_100356190 3300005617 Bacteria 1558
138 Ga0068864_100013666 3300005618 Bacteria 6732
139 Ga0068864_100667763 3300005618 Bacteria 1013
140 Ga0068866_10036483 3300005718 Bacteria 2409
141 Ga0068851_10000824 3300005834 Bacteria 13390
142 Ga0068851_10000909 3300005834 Bacteria 12750
143 Ga0068851_10004313 3300005834 Bacteria 6402
144 Ga0068851_10012042 3300005834 Bacteria 4071
145 Ga0068870_10006392 3300005840 Bacteria 5190
146 Ga0068870_10049631 3300005840 Bacteria 2214
147 Ga0068863_100017681 3300005841 Bacteria 6826
148 Ga0068858_100020003 3300005842 Bacteria 6261
149 Ga0068858_100134652 3300005842 Bacteria 2318
150 Ga0068858_100178331 3300005842 Bacteria 2005
151 Ga0068858_100497337 3300005842 Bacteria 1178
152 Ga0068858_100536522 3300005842 Bacteria 1132
153 Ga0068860_100033550 3300005843 Bacteria 4925
154 Ga0070717_10001296 3300006028 Bacteria 17113
155 Ga0075365_10007768 3300006038 Bacteria 6040
156 Ga0097621_100071118 3300006237 Bacteria 2874
157 Ga0097621_100099829 3300006237 Bacteria 2441
158 Ga0097621_100718796 3300006237 Bacteria 921
159 Ga0075433_10062711 3300006852 Bacteria 3256
160 Ga0075434_100104946 3300006871 Bacteria 2836
161 Ga0075434_100375131 3300006871 Bacteria 1443
162 Ga0068865_100010976 3300006881 Bacteria 5653
163 Ga0068865_100071874 3300006881 Bacteria 2456
164 Ga0068865_100102558 3300006881 Bacteria 2097
165 Ga0075436_100006862 3300006914 Bacteria 7787
166 Ga0097620_100207657 3300006931 Bacteria 2044
167 Ga0097620_100330211 3300006931 Bacteria 1619
168 Ga0097620_100356202 3300006931 Bacteria 1558
169 Ga0099822_1003706 3300006943 Bacteria 19688
170 Ga0075435_100037211 3300007076 Bacteria 3873
171 Ga0075435_100193711 3300007076 Bacteria 1721
172 Ga0075435_100545862 3300007076 Bacteria 1003
173 Ga0105240_10000332 3300009093 Bacteria 88613
174 Ga0105240_10013728 3300009093 Bacteria 11101
175 Ga0105240_10033938 3300009093 Bacteria 6589
176 Ga0111539_10111532 3300009094 Bacteria 3209
177 Ga0105241_10003744 3300009174 Bacteria 11281
178 Ga0105241_10179466 3300009174 Bacteria 1755
179 Ga0105241_10242766 3300009174 Bacteria 1523
180 Ga0105242_10000453 3300009176 Bacteria 32663
181 Ga0105242_10180014 3300009176 Bacteria 1864
182 Ga0105248_10003684 3300009177 Bacteria 16977
183 Ga0105248_10121436 3300009177 Bacteria 2947
184 Ga0105248_10274503 3300009177 Bacteria 1898
185 Ga0105248_10338045 3300009177 Bacteria 1695
186 Ga0105248_10417514 3300009177 Bacteria 1511
187 Ga0105248_10507468 3300009177 Bacteria 1360
188 Ga0105237_10120603 3300009545 Bacteria 2617
189 Ga0105237_10122414 3300009545 Bacteria 2595
190 Ga0105238_10001058 3300009551 Bacteria 27802
191 Ga0105238_10011120 3300009551 Bacteria 9049
192 Ga0105238_10057303 3300009551 Bacteria 3907
193 Ga0105238_10062676 3300009551 Bacteria 3718
194 Ga0105249_10218552 3300009553 Bacteria 1874
195 Ga0105239_10050704 3300010375 Bacteria 4551
196 Ga0105239_10654926 3300010375 Bacteria 1200
197 Ga0105246_10220483 3300011119 Bacteria 1486
198 Ga0157373_10008042 3300013100 Bacteria 7837
199 Ga0157373_10257451 3300013100 Bacteria 1235
200 Ga0157371_10000194 3300013102 Bacteria 90011
201 Ga0157371_10061815 3300013102 Bacteria 2655
202 Ga0157370_10010640 3300013104 Bacteria 9683
203 Ga0157370_10052778 3300013104 Bacteria 3880
204 Ga0157370_10258626 3300013104 Bacteria 1609
205 Ga0157369_10011173 3300013105 Bacteria 10204
206 Ga0157369_10044614 3300013105 Bacteria 4824
207 Ga0157369_10082153 3300013105 Bacteria 3448
208 Ga0157369_10488040 3300013105 Bacteria 1275
209 Ga0157374_10103596 3300013296 Bacteria 2731
210 Ga0157374_10500702 3300013296 Bacteria 1219
211 Ga0157378_10127037 3300013297 Bacteria 2356
212 Ga0157378_10133221 3300013297 Bacteria 2302
213 Ga0157378_10365637 3300013297 Bacteria 1413
214 Ga0157378_10737650 3300013297 Bacteria 1007
215 Ga0163162_10014258 3300013306 Bacteria 7764
216 Ga0163162_10260323 3300013306 Bacteria 1866
217 Ga0163162_10334055 3300013306 Bacteria 1648
218 Ga0157372_10001272 3300013307 Bacteria 27282
219 Ga0157372_10003176 3300013307 Bacteria 17723
220 Ga0157372_10051946 3300013307 Bacteria 4563
221 Ga0157372_10067960 3300013307 Bacteria 4006
222 Ga0157372_10147182 3300013307 Bacteria 2716
223 Ga0157372_10159116 3300013307 Bacteria 2609
224 Ga0157372_10162389 3300013307 Bacteria 2582
225 Ga0157372_10644574 3300013307 Bacteria 1234
226 Ga0157375_10009192 3300013308 Bacteria 8664
227 Ga0157375_10062879 3300013308 Bacteria 3690
228 Ga0157375_10645665 3300013308 Bacteria 1215
229 Ga0163163_10058784 3300014325 Bacteria 3802
230 Ga0157380_10166869 3300014326 Bacteria 1920
231 Ga0157379_10016563 3300014968 Bacteria 6482
232 Ga0157379_10414012 3300014968 Bacteria 1240
233 Ga0157376_10008379 3300014969 Bacteria 7456
234 Ga0157376_10008591 3300014969 Bacteria 7380
235 Ga0163161_10035976 3300017792 Bacteria 3545
236 Ga0163161_10122912 3300017792 Bacteria 1952
237 Ga0207425_1016882 3300025245 Bacteria 1613
238 Ga0209564_1007414 3300025295 Bacteria 5673
239 Ga0209758_1000026 3300025297 Bacteria 582706
240 Ga0209758_1000097 3300025297 Bacteria 230529
241 Ga0209758_1060436 3300025297 Bacteria 1254
242 Ga0209256_1009481 3300025299 Bacteria 4262
243 Ga0207426_1013811 3300025302 Bacteria 2977
244 Ga0209257_1000201 3300025304 Bacteria 147272
245 Ga0207697_10002605 3300025315 Bacteria 9281
246 Ga0207697_10111055 3300025315 Bacteria 1174
247 Ga0207656_10007517 3300025321 Bacteria 3973
248 Ga0207656_10013274 3300025321 Bacteria 3144
249 Ga0207656_10023313 3300025321 Bacteria 2491
250 Ga0207682_10002556 3300025893 Bacteria 8121
251 Ga0207692_10101527 3300025898 Bacteria 1580
252 Ga0207688_10000438 3300025901 Bacteria 19706
253 Ga0207680_10018388 3300025903 Bacteria 3715
254 Ga0207647_10148290 3300025904 Bacteria 1372
255 Ga0207647_10185971 3300025904 Bacteria 1205
256 Ga0207645_10000139 3300025907 Bacteria 55848
257 Ga0207645_10011262 3300025907 Bacteria 6113
258 Ga0207643_10000089 3300025908 Bacteria 61020
259 Ga0207643_10046360 3300025908 Bacteria 2457
260 Ga0207705_10051043 3300025909 Bacteria 2978
261 Ga0207705_10149748 3300025909 Bacteria 1748
262 Ga0207705_10227890 3300025909 Bacteria 1417
263 Ga0207654_10075274 3300025911 Bacteria 2017
264 Ga0207654_10132439 3300025911 Bacteria 1579
265 Ga0207654_10340114 3300025911 Bacteria 1031
266 Ga0207707_10017469 3300025912 Bacteria 6255
267 Ga0207707_10046829 3300025912 Bacteria 3766
268 Ga0207707_10058218 3300025912 Bacteria 3363
269 Ga0207695_10041522 3300025913 Bacteria 4923
270 Ga0207695_10067902 3300025913 Bacteria 3655
271 Ga0207695_10211687 3300025913 Bacteria 1849
272 Ga0207671_10203410 3300025914 Bacteria 1547
273 Ga0207671_10346711 3300025914 Bacteria 1177
274 Ga0207660_10019993 3300025917 Bacteria 4487
275 Ga0207660_10059701 3300025917 Bacteria 2739
276 Ga0207660_10309179 3300025917 Bacteria 1260
277 Ga0207657_10000240 3300025919 Bacteria 58053
278 Ga0207657_10000803 3300025919 Bacteria 33281
279 Ga0207657_10005719 3300025919 Bacteria 12972
280 Ga0207657_10013201 3300025919 Bacteria 8110
281 Ga0207657_10013747 3300025919 Bacteria 7925
282 Ga0207657_10017881 3300025919 Bacteria 6784
283 Ga0207657_10151043 3300025919 Bacteria 1892
284 Ga0207649_10014372 3300025920 Bacteria 4431
285 Ga0207649_10018271 3300025920 Bacteria 3984
286 Ga0207649_10054193 3300025920 Bacteria 2495
287 Ga0207649_10155735 3300025920 Bacteria 1578
288 Ga0207649_10324659 3300025920 Bacteria 1132
289 Ga0207652_10076161 3300025921 Bacteria 2925
290 Ga0207652_10078076 3300025921 Bacteria 2890
291 Ga0207652_10187801 3300025921 Bacteria 1858
292 Ga0207652_10323114 3300025921 Bacteria 1393
293 Ga0207652_10554386 3300025921 Bacteria 1033
294 Ga0207681_10028259 3300025923 Bacteria 3632
295 Ga0207694_10002852 3300025924 Bacteria 13942
296 Ga0207694_10038187 3300025924 Bacteria 3692
297 Ga0207694_10045460 3300025924 Bacteria 3392
298 Ga0207694_10067024 3300025924 Bacteria 2802
299 Ga0207694_10095860 3300025924 Bacteria 2346
300 Ga0207650_10034392 3300025925 Bacteria 3675
301 Ga0207650_10102100 3300025925 Bacteria 2209
302 Ga0207659_10120452 3300025926 Bacteria 2010
303 Ga0207700_10193289 3300025928 Bacteria 1711
304 Ga0207664_10011033 3300025929 Bacteria 6401
305 Ga0207664_10051453 3300025929 Bacteria 3252
306 Ga0207664_10081637 3300025929 Bacteria 2631
307 Ga0207644_10007082 3300025931 Bacteria 7311
308 Ga0207644_10201383 3300025931 Bacteria 1570
309 Ga0207690_10057581 3300025932 Bacteria 2626
310 Ga0207690_10065109 3300025932 Bacteria 2491
311 Ga0207690_10223127 3300025932 Bacteria 1443
312 Ga0207690_10250389 3300025932 Bacteria 1368
313 Ga0207706_10000002 3300025933 Bacteria 360309
314 Ga0207706_10000456 3300025933 Bacteria 43575
315 Ga0207706_10043559 3300025933 Bacteria 3977
316 Ga0207706_10368169 3300025933 Bacteria 1248
317 Ga0207686_10174187 3300025934 Bacteria 1520
318 Ga0207670_10006537 3300025936 Bacteria 6472
319 Ga0207669_10004348 3300025937 Bacteria 6225
320 Ga0207704_10368178 3300025938 Bacteria 1124
321 Ga0207691_10000040 3300025940 Bacteria 106561
322 Ga0207691_10003578 3300025940 Bacteria 15125
323 Ga0207691_10009315 3300025940 Bacteria 9423
324 Ga0207711_10013697 3300025941 Bacteria 6732
325 Ga0207711_10305759 3300025941 Bacteria 1467
326 Ga0207711_10548073 3300025941 Bacteria 1079
327 Ga0207689_10001781 3300025942 Bacteria 20348
328 Ga0207661_10029815 3300025944 Bacteria 4194
329 Ga0207661_10067072 3300025944 Bacteria 2917
330 Ga0207679_10006221 3300025945 Bacteria 7538
331 Ga0207679_10018114 3300025945 Bacteria 4711
332 Ga0207679_10019867 3300025945 Bacteria 4524
333 Ga0207679_10031330 3300025945 Bacteria 3721
334 Ga0207679_10053421 3300025945 Bacteria 2969
335 Ga0207667_10011280 3300025949 Bacteria 10393
336 Ga0207667_10012368 3300025949 Bacteria 9838
337 Ga0207667_10021438 3300025949 Bacteria 7159
338 Ga0207667_10032823 3300025949 Bacteria 5589
339 Ga0207667_10033094 3300025949 Bacteria 5561
340 Ga0207667_10069071 3300025949 Bacteria 3678
341 Ga0207667_10103601 3300025949 Bacteria 2935
342 Ga0207651_10000966 3300025960 Bacteria 12704
343 Ga0207651_10077558 3300025960 Bacteria 2379
344 Ga0207651_10231415 3300025960 Bacteria 1500
345 Ga0207651_10432293 3300025960 Bacteria 1126
346 Ga0207712_10123539 3300025961 Bacteria 1962
347 Ga0207668_10008843 3300025972 Bacteria 6021
348 Ga0207668_10030829 3300025972 Bacteria 3527
349 Ga0207640_10018881 3300025981 Bacteria 4060
350 Ga0207640_10046229 3300025981 Bacteria 2800
351 Ga0207640_10132575 3300025981 Bacteria 1803
352 Ga0207658_10008367 3300025986 Bacteria 7042
353 Ga0207658_10045659 3300025986 Bacteria 3195
354 Ga0207658_10067571 3300025986 Bacteria 2693
355 Ga0207658_10081450 3300025986 Bacteria 2482
356 Ga0207658_10178271 3300025986 Bacteria 1757
357 Ga0207658_10223924 3300025986 Bacteria 1584
358 Ga0207658_10701591 3300025986 Bacteria 914
359 Ga0207677_10712024 3300026023 Bacteria 892
360 Ga0207703_10019682 3300026035 Bacteria 5275
361 Ga0207703_10134308 3300026035 Bacteria 2140
362 Ga0207639_10035409 3300026041 Bacteria 3694
363 Ga0207639_10052336 3300026041 Bacteria 3111
364 Ga0207639_10201975 3300026041 Bacteria 1705
365 Ga0207678_10001203 3300026067 Bacteria 23759
366 Ga0207678_10001320 3300026067 Bacteria 22902
367 Ga0207678_10005474 3300026067 Bacteria 11357
368 Ga0207678_10008360 3300026067 Bacteria 9126
369 Ga0207678_10023571 3300026067 Bacteria 5382
370 Ga0207678_10230294 3300026067 Bacteria 1586
371 Ga0207708_10000775 3300026075 Bacteria 24063
372 Ga0207702_10005409 3300026078 Bacteria 11176
373 Ga0207702_10016317 3300026078 Bacteria 6147
374 Ga0207702_10245138 3300026078 Bacteria 1680
375 Ga0207702_10322695 3300026078 Bacteria 1471
376 Ga0207702_10470102 3300026078 Bacteria 1222
377 Ga0207641_10213539 3300026088 Bacteria 1785
378 Ga0207648_10002404 3300026089 Bacteria 20161
379 Ga0207648_10007985 3300026089 Bacteria 10323
380 Ga0207648_10019772 3300026089 Bacteria 6076
381 Ga0207648_10059981 3300026089 Bacteria 3318
382 Ga0207676_10033173 3300026095 Bacteria 3899
383 Ga0207674_10000064 3300026116 Bacteria 109914
384 Ga0207674_10000237 3300026116 Bacteria 68721
385 Ga0207674_10083006 3300026116 Bacteria 3204
386 Ga0207674_10200138 3300026116 Bacteria 1947
387 Ga0207674_10226919 3300026116 Bacteria 1816
388 Ga0207675_100001078 3300026118 Bacteria 27027
389 Ga0207675_100452411 3300026118 Bacteria 1273
390 Ga0207683_10000059 3300026121 Bacteria 83666
391 Ga0207683_10009554 3300026121 Bacteria 8268
392 Ga0207683_10014708 3300026121 Bacteria 6664
393 Ga0207683_10039783 3300026121 Bacteria 4102
394 Ga0207698_10005749 3300026142 Bacteria 7694
395 Ga0207698_10012411 3300026142 Bacteria 5573
396 Ga0207698_10269044 3300026142 Bacteria 1570
397 Ga0209389_1000060 3300027296 Bacteria 106050
398 Ga0209589_1000015 3300027357 Bacteria 225913
399 Ga0209589_1000062 3300027357 Bacteria 106048
400 Ga0209969_1022618 3300027360 Bacteria 941
401 Ga0209489_100015 3300027361 Bacteria 225913
402 Ga0209489_103702 3300027361 Bacteria 29364
403 Ga0209700_100025 3300027363 Bacteria 225913
404 Ga0209995_1004767 3300027471 Bacteria 2178
405 Ga0209983_1003323 3300027665 Bacteria 3445
406 Ga0209971_1003271 3300027682 Bacteria 3851
407 Ga0209971_1029627 3300027682 Bacteria 1311
408 Ga0209974_10000662 3300027876 Bacteria 11657
409 Ga0209974_10031576 3300027876 Bacteria 1754
410 Ga0268266_10086274 3300028379 Bacteria 2744
411 Ga0268266_10262293 3300028379 Bacteria 1601
412 Ga0268264_10161622 3300028381 Bacteria 2018
413 Ga0265330_10000014 3300031235 Bacteria 175673
414 Ga0265332_10000011 3300031238 Bacteria 284299
415 Ga0265332_10004125 3300031238 Bacteria 6894
416 Ga0265325_10008886 3300031241 Bacteria 5902
417 Ga0265340_10013732 3300031247 Bacteria 4248
418 Ga0307408_100036177 3300031548 Bacteria 3469
419 Ga0307408_100268752 3300031548 Bacteria 1415
420 Ga0265314_10000026 3300031711 Bacteria 284299
421 Ga0265314_10003013 3300031711 Bacteria 16655
422 Ga0307413_10171462 3300031824 Bacteria 1536
423 Ga0307407_10034461 3300031903 Bacteria 2772
424 Ga0307416_100057753 3300032002 Bacteria 3141
425 Ga0373956_0074400 3300035119 Bacteria 1553
426 Ga0373937_0101719 3300036401 Bacteria 2667
427 Ga0373937_0312855 3300036401 Bacteria 1485
428 Ga0395899_0128331 3300037312 Bacteria 1812
429 Ga0395900_0011743 3300037418 Bacteria 8956
430 Ga0395900_0015947 3300037418 Bacteria 7656
431 Ga0395900_0058938 3300037418 Bacteria 3953
432 Ga0395900_0072140 3300037418 Bacteria 3550
433 Ga0395900_0205387 3300037418 Bacteria 1991
434 Ga0395898_0057482 3300037466 Bacteria 3790
435 Ga0395905_0000377 3300037471 Bacteria 63595
436 Ga0395905_0037335 3300037471 Bacteria 4562
437 Ga0395905_0540194 3300037471 Bacteria 1067
438 Ga0395901_0015978 3300038443 Bacteria 7648
439 Ga0395901_0026809 3300038443 Bacteria 5917
440 Ga0395901_0048127 3300038443 Bacteria 4428
441 Ga0395901_0351839 3300038443 Bacteria 1520
442 Ga0395901_0353987 3300038443 Bacteria 1515
443 Ga0395901_0645311 3300038443 Bacteria 1062
444 Ga0395901_0950203 3300038443 Bacteria 838
445 Ga0436365_1361131 3300039437 Bacteria 1709
446 Ga0451577_0000851 3300042876 Bacteria 45473
447 Ga0451577_0726820 3300042876 Bacteria 899
448 Ga0466969_0076759 3300044656 Bacteria 1599
449 Ga0466972_0044257 3300044658 Bacteria 2160
450 Ga0453683_0115078 3300044673 Bacteria 1692
451 Ga0466966_0002649 3300044684 Bacteria 11727
452 Ga0466961_0004698 3300044693 Bacteria 8587
453 Ga0466963_0171045 3300044694 Bacteria 1515
454 Ga0466963_0203555 3300044694 Bacteria 1385
455 Ga0453684_0001945 3300044712 Bacteria 53289
456 Ga0453684_0003131 3300044712 Bacteria 38095
457 Ga0466970_0019696 3300044765 Bacteria 3500
458 Ga0466959_0026963 3300045049 Bacteria 4261
459 Ga0466959_0477577 3300045049 Bacteria 844
460 Ga0451576_0005539 3300045051 Bacteria 15773
461 Ga0495580_0289611 3300046472 Bacteria 1116
462 Ga0495659_0106068 3300046664 Bacteria 1093
463 Ga0496101_0003156 3300048904 Bacteria 10200
464 Ga0496101_0289583 3300048904 Bacteria 1281
465 Ga0496102_0001341 3300048905 Bacteria 22071
466 Ga0496102_0019726 3300048905 Bacteria 5943
467 Ga0496102_0580692 3300048905 Bacteria 1044
468 Ga0496103_0060295 3300048906 Bacteria 2358
469 Ga0496105_0004030 3300048908 Bacteria 10992
470 Ga0496106_0006681 3300048909 Bacteria 8538
471 Ga0496106_0253922 3300048909 Bacteria 1406
472 Ga0496107_0006330 3300048910 Bacteria 8138
473 Ga0496107_0071999 3300048910 Bacteria 2512
474 Ga0496107_0193398 3300048910 Bacteria 1512
475 Ga0496107_0321892 3300048910 Bacteria 1151
476 Ga0496108_0019241 3300048911 Bacteria 5605
477 Ga0496109_0020734 3300048912 Bacteria 5805
478 Ga0496109_0136740 3300048912 Bacteria 2290
479 Ga0496110_0054590 3300048913 Bacteria 3514
480 Ga0496110_0165606 3300048913 Bacteria 2005
481 Ga0496111_0281687 3300048914 Bacteria 1233
482 Ga0496112_0006440 3300048915 Bacteria 10307
483 Ga0496112_0101990 3300048915 Bacteria 2839
484 Ga0496112_0269624 3300048915 Bacteria 1651
485 Ga0496113_0126987 3300048916 Bacteria 1998
486 Ga0496114_0010872 3300048917 Bacteria 7251
487 Ga0496114_0245064 3300048917 Bacteria 1577
488 Ga0496115_0012251 3300048918 Bacteria 6450
489 Ga0501036_0161993 3300049572 Bacteria 1886
490 Ga0501037_0080570 3300049573 Bacteria 2362
491 Ga0501038_0107728 3300049574 Bacteria 2312
492 Ga0501047_0154858 3300049581 Bacteria 2166
493 nmdc:mga0yw44_98881_c1 3300050492 Bacteria 1856
494 nmdc:mga08y16_581991_c1 3300050511 Bacteria 1130
495 nmdc:mga0n895_10713_c1 3300050512 Bacteria 8124
496 nmdc:mga0n895_14725_c1 3300050512 Bacteria 7113
497 nmdc:mga0rr50_142934_c1 3300050513 Bacteria 1926
498 nmdc:mga08x19_4952_c1 3300050514 Bacteria 7865
499 nmdc:mga0a205_32557_c1 3300050515 Bacteria 4998
500 Ga0495612_0155796 3300053078 Bacteria 996
501 Ga0500642_0015291 3300053130 Bacteria 2881
502 Ga0500603_028660 3300053150 Bacteria 1422
503 Ga0500616_0000038 3300053153 Bacteria 386801
504 2513701071 2513237102 Bacteria 7703324
505 2824620811 2824617872 Bacteria 8814715
506 2824628327 2824626560 Bacteria 8813858
507 2824636124 2824635225 Bacteria 8785348
508 2824647231 2824644064 Bacteria 8743947
509 2824681012 2824679649 Bacteria 8248951
510 2824718059 2824714736 Bacteria 8717648
511 2824726861 2824723954 Bacteria 8758240
512 2841960479 2841957949 Bacteria 8652217
513 2842043129 2842038055 Bacteria 8002051
514 2842051170 2842045827 Bacteria 8006841
515 2849081231 2849076700 Bacteria 7039503
516 2922399490 2922393267 Bacteria 8285685
517 Ga0068871_100249002
518 JGI24744J21845_10039039
519 JGI25153J46596_10000697
520 JGI25160J50197_1016718
521 Ga0055531_10001781
522 Ga0065712_10142291
523 Ga0065715_10169866
524 Ga0070658_10007510
525 Ga0070658_10165782
526 Ga0070658_10202078
527 Ga0070676_10024310
528 Ga0070676_10154802
529 Ga0070683_100015951
530 Ga0070683_100033050
531 Ga0070683_100033783
532 Ga0070683_100048106
533 Ga0070683_100094466
534 Ga0070690_100138468
535 Ga0070670_100616404
536 Ga0070677_10000279
537 Ga0070677_10004604
538 Ga0068869_100018799
539 Ga0070666_10000909
540 Ga0070666_10009328
541 Ga0070680_100042347
542 Ga0070680_100244796
543 Ga0070680_100352506
544 Ga0070682_100226119
545 Ga0068868_100014717
546 Ga0070660_100003025
547 Ga0070660_100005144
548 Ga0070660_100013300
549 Ga0070689_100014090
550 Ga0070661_100006294
551 Ga0070661_100006707
552 Ga0070661_100018286
553 Ga0070661_100028394
554 Ga0070661_100095953
555 Ga0070661_100169268
556 Ga0070668_100006984
557 Ga0070675_100002259
558 Ga0070671_100007760
559 Ga0070671_100172141
560 Ga0070674_100007912
561 Ga0070674_100029928
562 Ga0070674_100247866
563 Ga0070673_100031152
564 Ga0070673_100137596
565 Ga0070673_100153650
566 Ga0070673_100198300
567 Ga0070673_100274453
568 Ga0070659_100006487
569 Ga0070659_100016986
570 Ga0070659_100024659
571 Ga0070667_100028719
572 Ga0070667_100068856
573 Ga0070667_100080563
574 Ga0070667_100149407
575 Ga0070714_100005916
576 Ga0070714_100026036
577 Ga0070714_100029982
578 Ga0070714_100090910
579 Ga0070714_100093841
580 Ga0070713_100331451
581 Ga0070710_10008802
582 Ga0070710_10049965
583 Ga0070701_10130416
584 Ga0070711_100528396
585 Ga0070663_100004923
586 Ga0070663_100017836
587 Ga0070663_100026482
588 Ga0070663_100108957
589 Ga0070678_100005292
590 Ga0070662_100000176
591 Ga0070662_100213880
592 Ga0070681_10018775
593 Ga0070681_10019135
594 Ga0068867_100012504
595 Ga0068867_100061533
596 Ga0070679_100041004
597 Ga0070679_100059215
598 Ga0070679_100187306
599 Ga0070679_100506202
600 Ga0070684_100011072
601 Ga0070684_100051881
602 Ga0070684_100141909
603 Ga0070684_100200258
604 Ga0068853_100002699
605 Ga0068853_100018236
606 Ga0068853_100144886
607 Ga0068853_100151346
608 Ga0068853_100346231
609 Ga0070672_100004215
610 Ga0070672_100020336
611 Ga0070672_100232774
612 Ga0070696_100017753
613 Ga0070665_100001520
614 Ga0070665_100084139
615 Ga0068855_100000851
616 Ga0068855_100006879
617 Ga0068855_100007145
618 Ga0068855_100012156
619 Ga0068855_100067326
620 Ga0068855_100099998
621 Ga0068855_100176418
622 Ga0068855_100261101
623 Ga0070664_100002386
624 Ga0070664_100005097
625 Ga0070664_100020677
626 Ga0070664_100022515
627 Ga0070664_100078837
628 Ga0070664_100089381
629 Ga0068857_100006451
630 Ga0068857_100017532
631 Ga0068857_100034957
632 Ga0068857_100188771
633 Ga0068857_100201582
634 Ga0068857_100462109
635 Ga0068854_100021119
636 Ga0068854_100112741
637 Ga0068856_100001266
638 Ga0068856_100020324
639 Ga0068856_100021333
640 Ga0068856_100024124
641 Ga0068856_100104480
642 Ga0068856_100145280
643 Ga0068856_100293288
644 Ga0068856_100453037
645 Ga0068852_100009114
646 Ga0068852_100010673
647 Ga0068852_100028326
648 Ga0068852_100093796
649 Ga0068852_100151145
650 Ga0068852_100170130
651 Ga0068859_100207669
652 Ga0068859_100330232
653 Ga0068859_100356190
654 Ga0068864_100013666
655 Ga0068864_100667763
656 Ga0068866_10036483
657 Ga0068851_10000824
658 Ga0068851_10000909
659 Ga0068851_10004313
660 Ga0068851_10012042
661 Ga0068870_10006392
662 Ga0068870_10049631
663 Ga0068863_100017681
664 Ga0068858_100020003
665 Ga0068858_100134652
666 Ga0068858_100178331
667 Ga0068858_100497337
668 Ga0068858_100536522
669 Ga0068860_100033550
670 Ga0070717_10001296
671 Ga0075365_10007768
672 Ga0097621_100071118
673 Ga0097621_100099829
674 Ga0097621_100718796
675 Ga0075433_10062711
676 Ga0075434_100104946
677 Ga0075434_100375131
678 Ga0068865_100010976
679 Ga0068865_100071874
680 Ga0068865_100102558
681 Ga0075436_100006862
682 Ga0097620_100207657
683 Ga0097620_100330211
684 Ga0097620_100356202
685 Ga0099822_1003706
686 Ga0075435_100037211
687 Ga0075435_100193711
688 Ga0075435_100545862
689 Ga0105240_10000332
690 Ga0105240_10013728
691 Ga0105240_10033938
692 Ga0111539_10111532
693 Ga0105241_10003744
694 Ga0105241_10179466
695 Ga0105241_10242766
696 Ga0105242_10000453
697 Ga0105242_10180014
698 Ga0105248_10003684
699 Ga0105248_10121436
700 Ga0105248_10274503
701 Ga0105248_10338045
702 Ga0105248_10417514
703 Ga0105248_10507468
704 Ga0105237_10120603
705 Ga0105237_10122414
706 Ga0105238_10001058
707 Ga0105238_10011120
708 Ga0105238_10057303
709 Ga0105238_10062676
710 Ga0105249_10218552
711 Ga0105239_10050704
712 Ga0105239_10654926
713 Ga0105246_10220483
714 Ga0157373_10008042
715 Ga0157373_10257451
716 Ga0157371_10000194
717 Ga0157371_10061815
718 Ga0157370_10010640
719 Ga0157370_10052778
720 Ga0157370_10258626
721 Ga0157369_10011173
722 Ga0157369_10044614
723 Ga0157369_10082153
724 Ga0157369_10488040
725 Ga0157374_10103596
726 Ga0157374_10500702
727 Ga0157378_10127037
728 Ga0157378_10133221
729 Ga0157378_10365637
730 Ga0157378_10737650
731 Ga0163162_10014258
732 Ga0163162_10260323
733 Ga0163162_10334055
734 Ga0157372_10001272
735 Ga0157372_10003176
736 Ga0157372_10051946
737 Ga0157372_10067960
738 Ga0157372_10147182
739 Ga0157372_10159116
740 Ga0157372_10162389
741 Ga0157372_10644574
742 Ga0157375_10009192
743 Ga0157375_10062879
744 Ga0157375_10645665
745 Ga0163163_10058784
746 Ga0157380_10166869
747 Ga0157379_10016563
748 Ga0157379_10414012
749 Ga0157376_10008379
750 Ga0157376_10008591
751 Ga0163161_10035976
752 Ga0163161_10122912
753 Ga0207425_1016882
754 Ga0209564_1007414
755 Ga0209758_1000026
756 Ga0209758_1000097
757 Ga0209758_1060436
758 Ga0209256_1009481
759 Ga0207426_1013811
760 Ga0209257_1000201
761 Ga0207697_10002605
762 Ga0207697_10111055
763 Ga0207656_10007517
764 Ga0207656_10013274
765 Ga0207656_10023313
766 Ga0207682_10002556
767 Ga0207692_10101527
768 Ga0207688_10000438
769 Ga0207680_10018388
770 Ga0207647_10148290
771 Ga0207647_10185971
772 Ga0207645_10000139
773 Ga0207645_10011262
774 Ga0207643_10000089
775 Ga0207643_10046360
776 Ga0207705_10051043
777 Ga0207705_10149748
778 Ga0207705_10227890
779 Ga0207654_10075274
780 Ga0207654_10132439
781 Ga0207654_10340114
782 Ga0207707_10017469
783 Ga0207707_10046829
784 Ga0207707_10058218
785 Ga0207695_10041522
786 Ga0207695_10067902
787 Ga0207695_10211687
788 Ga0207671_10203410
789 Ga0207671_10346711
790 Ga0207660_10019993
791 Ga0207660_10059701
792 Ga0207660_10309179
793 Ga0207657_10000240
794 Ga0207657_10000803
795 Ga0207657_10005719
796 Ga0207657_10013201
797 Ga0207657_10013747
798 Ga0207657_10017881
799 Ga0207657_10151043
800 Ga0207649_10014372
801 Ga0207649_10018271
802 Ga0207649_10054193
803 Ga0207649_10155735
804 Ga0207649_10324659
805 Ga0207652_10076161
806 Ga0207652_10078076
807 Ga0207652_10187801
808 Ga0207652_10323114
809 Ga0207652_10554386
810 Ga0207681_10028259
811 Ga0207694_10002852
812 Ga0207694_10038187
813 Ga0207694_10045460
814 Ga0207694_10067024
815 Ga0207694_10095860
816 Ga0207650_10034392
817 Ga0207650_10102100
818 Ga0207659_10120452
819 Ga0207700_10193289
820 Ga0207664_10011033
821 Ga0207664_10051453
822 Ga0207664_10081637
823 Ga0207644_10007082
824 Ga0207644_10201383
825 Ga0207690_10057581
826 Ga0207690_10065109
827 Ga0207690_10223127
828 Ga0207690_10250389
829 Ga0207706_10000002
830 Ga0207706_10000456
831 Ga0207706_10043559
832 Ga0207706_10368169
833 Ga0207686_10174187
834 Ga0207670_10006537
835 Ga0207669_10004348
836 Ga0207704_10368178
837 Ga0207691_10000040
838 Ga0207691_10003578
839 Ga0207691_10009315
840 Ga0207711_10013697
841 Ga0207711_10305759
842 Ga0207711_10548073
843 Ga0207689_10001781
844 Ga0207661_10029815
845 Ga0207661_10067072
846 Ga0207679_10006221
847 Ga0207679_10018114
848 Ga0207679_10019867
849 Ga0207679_10031330
850 Ga0207679_10053421
851 Ga0207667_10011280
852 Ga0207667_10012368
853 Ga0207667_10021438
854 Ga0207667_10032823
855 Ga0207667_10033094
856 Ga0207667_10069071
857 Ga0207667_10103601
858 Ga0207651_10000966
859 Ga0207651_10077558
860 Ga0207651_10231415
861 Ga0207651_10432293
862 Ga0207712_10123539
863 Ga0207668_10008843
864 Ga0207668_10030829
865 Ga0207640_10018881
866 Ga0207640_10046229
867 Ga0207640_10132575
868 Ga0207658_10008367
869 Ga0207658_10045659
870 Ga0207658_10067571
871 Ga0207658_10081450
872 Ga0207658_10178271
873 Ga0207658_10223924
874 Ga0207658_10701591
875 Ga0207677_10712024
876 Ga0207703_10019682
877 Ga0207703_10134308
878 Ga0207639_10035409
879 Ga0207639_10052336
880 Ga0207639_10201975
881 Ga0207678_10001203
882 Ga0207678_10001320
883 Ga0207678_10005474
884 Ga0207678_10008360
885 Ga0207678_10023571
886 Ga0207678_10230294
887 Ga0207708_10000775
888 Ga0207702_10005409
889 Ga0207702_10016317
890 Ga0207702_10245138
891 Ga0207702_10322695
892 Ga0207702_10470102
893 Ga0207641_10213539
894 Ga0207648_10002404
895 Ga0207648_10007985
896 Ga0207648_10019772
897 Ga0207648_10059981
898 Ga0207676_10033173
899 Ga0207674_10000064
900 Ga0207674_10000237
901 Ga0207674_10083006
902 Ga0207674_10200138
903 Ga0207674_10226919
904 Ga0207675_100001078
905 Ga0207675_100452411
906 Ga0207683_10000059
907 Ga0207683_10009554
908 Ga0207683_10014708
909 Ga0207683_10039783
910 Ga0207698_10005749
911 Ga0207698_10012411
912 Ga0207698_10269044
913 Ga0209389_1000060
914 Ga0209589_1000015
915 Ga0209589_1000062
916 Ga0209969_1022618
917 Ga0209489_100015
918 Ga0209489_103702
919 Ga0209700_100025
920 Ga0209995_1004767
921 Ga0209983_1003323
922 Ga0209971_1003271
923 Ga0209971_1029627
924 Ga0209974_10000662
925 Ga0209974_10031576
926 Ga0268266_10086274
927 Ga0268266_10262293
928 Ga0268264_10161622
929 Ga0265330_10000014
930 Ga0265332_10000011
931 Ga0265332_10004125
932 Ga0265325_10008886
933 Ga0265340_10013732
934 Ga0307408_100036177
935 Ga0307408_100268752
936 Ga0265314_10000026
937 Ga0265314_10003013
938 Ga0307413_10171462
939 Ga0307407_10034461
940 Ga0307416_100057753
941 Ga0373956_0074400
942 Ga0373937_0101719
943 Ga0373937_0312855
944 Ga0395899_0128331
945 Ga0395900_0011743
946 Ga0395900_0015947
947 Ga0395900_0058938
948 Ga0395900_0072140
949 Ga0395900_0205387
950 Ga0395898_0057482
951 Ga0395905_0000377
952 Ga0395905_0037335
953 Ga0395905_0540194
954 Ga0395901_0015978
955 Ga0395901_0026809
956 Ga0395901_0048127
957 Ga0395901_0351839
958 Ga0395901_0353987
959 Ga0395901_0645311
960 Ga0395901_0950203
961 Ga0436365_1361131
962 Ga0451577_0000851
963 Ga0451577_0726820
964 Ga0466969_0076759
965 Ga0466972_0044257
966 Ga0453683_0115078
967 Ga0466966_0002649
968 Ga0466961_0004698
969 Ga0466963_0171045
970 Ga0466963_0203555
971 Ga0453684_0001945
972 Ga0453684_0003131
973 Ga0466970_0019696
974 Ga0466959_0026963
975 Ga0466959_0477577
976 Ga0451576_0005539
977 Ga0495580_0289611
978 Ga0495659_0106068
979 Ga0496101_0003156
980 Ga0496101_0289583
981 Ga0496102_0001341
982 Ga0496102_0019726
983 Ga0496102_0580692
984 Ga0496103_0060295
985 Ga0496105_0004030
986 Ga0496106_0006681
987 Ga0496106_0253922
988 Ga0496107_0006330
989 Ga0496107_0071999
990 Ga0496107_0193398
991 Ga0496107_0321892
992 Ga0496108_0019241
993 Ga0496109_0020734
994 Ga0496109_0136740
995 Ga0496110_0054590
996 Ga0496110_0165606
997 Ga0496111_0281687
998 Ga0496112_0006440
999 Ga0496112_0101990
1000 Ga0496112_0269624
1001 Ga0496113_0126987
1002 Ga0496114_0010872
1003 Ga0496114_0245064
1004 Ga0496115_0012251
1005 Ga0501036_0161993
1006 Ga0501037_0080570
1007 Ga0501038_0107728
1008 Ga0501047_0154858
1009 nmdc:mga0yw44_98881_c1
1010 nmdc:mga08y16_581991_c1
1011 nmdc:mga0n895_10713_c1
1012 nmdc:mga0n895_14725_c1
1013 nmdc:mga0rr50_142934_c1
1014 nmdc:mga08x19_4952_c1
1015 nmdc:mga0a205_32557_c1
1016 Ga0495612_0155796
1017 Ga0500642_0015291
1018 Ga0500603_028660
1019 Ga0500616_0000038
1020 2513701071
1021 2824620811
1022 2824628327
1023 2824636124
1024 2824647231
1025 2824681012
1026 2824718059
1027 2824726861
1028 2841960479
1029 2842043129
1030 2842051170
1031 2849081231
1032 2922399490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

47

280

0.9

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

57

288

0.79

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

61

283

0.55

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.9197 16 235
3cvg-assembly1.cif.gz_A crystal structure of a periplasmic putative metal binding protein 0.8787 10 245
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.8747 9 247
3cvg-assembly5.cif.gz_C crystal structure of a periplasmic putative metal binding protein 0.8588 57 245
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.8524 16 235
ID Description Score Start End Superfamily
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9209 9 247 3.40.190.10
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9192 81 194 3.40.190.10
3kn3C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9185 16 236 3.40.190.10
3muqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9151 16 231 3.40.190.10
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8953 81 194 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6L8DK65-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9835 33 247
AF-A0A6L7MBB3-F1-model_v4 Sulfate transporter 0.9795 16 247
AF-A0A7C5SC37-F1-model_v4 PBP domain-containing protein 0.9786 78 246
AF-A0A537M5M2-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9785 16 247
AF-A0A0Q6KPG0-F1-model_v4 PBP domain-containing protein 0.9768 16 250

Map