F457989

General Info

Members Datasets Scaffolds Average Seq Length
516 326 1032 149

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10000656|Ga0105242_1000065627
Length 182
Sequence LLPSLPGACLGRAALSRFLFFSHLGGPIVRRLSMKIDLKILDPRMAEQLPAYATPGSAGLDLRACLDAPITLEPNAWQLVPTGIAIHLRDPGYAAMILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSAWNRSDTAFTLQPMERLAQLVIVPVVQAQFNVVDEFSGASERGQGGYGSTGTN

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
91 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
195 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
196 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
197 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
198 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
199 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
200 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
201 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
323 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
324 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 3.29
Rhizosphere 68.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10000656 3300009176 Bacteria 27099
2 JGI24739J22299_10049111 3300001989 Bacteria 1369
3 JGI24735J21928_10021797 3300002067 Bacteria 1954
4 JGI25162J39368_1000027 3300002737 Bacteria 223163
5 JGI25163J39215_1004601 3300002771 Bacteria 952
6 JGI25165J46597_1000031 3300003214 Bacteria 296858
7 JGI25160J50197_1000279 3300003354 Bacteria 37135
8 JGI25160J50197_1026696 3300003354 Bacteria 1587
9 Ga0055538_1000018 3300003751 Bacteria 296858
10 Ga0055539_1000023 3300003752 Bacteria 296858
11 Ga0055533_1000031 3300003756 Bacteria 296858
12 Ga0055532_1001850 3300003758 Bacteria 5190
13 Ga0055532_1002401 3300003758 Bacteria 3924
14 Ga0055532_1002405 3300003758 Bacteria 3921
15 Ga0055525_1000038 3300003759 Bacteria 297540
16 Ga0055525_1000039 3300003759 Bacteria 296858
17 Ga0055527_1001077 3300003760 Bacteria 6432
18 Ga0055527_1001080 3300003760 Bacteria 6414
19 Ga0055535_1002463 3300003761 Bacteria 6432
20 Ga0055535_1002468 3300003761 Bacteria 6414
21 Ga0055542_1002359 3300003762 Bacteria 6414
22 Ga0055542_1003231 3300003762 Bacteria 4558
23 Ga0055529_1001317 3300003763 Bacteria 8412
24 Ga0055534_1026131 3300003784 Bacteria 932
25 Ga0055528_1001724 3300003790 Bacteria 12650
26 Ga0055541_1000016 3300003841 Bacteria 296861
27 Ga0058692_1009562 3300003856 Bacteria 2434
28 Ga0055543_1007895 3300004625 Bacteria 2412
29 Ga0065165_1000214 3300005262 Bacteria 100283
30 Ga0065165_1000286 3300005262 Bacteria 85993
31 Ga0065165_1000905 3300005262 Bacteria 38287
32 Ga0065714_10141060 3300005288 Bacteria 1171
33 Ga0065712_10030383 3300005290 Bacteria 1287
34 Ga0070658_10109366 3300005327 Bacteria 2288
35 Ga0070676_10228686 3300005328 Bacteria 1232
36 Ga0070676_10858057 3300005328 Bacteria 674
37 Ga0070670_100003254 3300005331 Bacteria 13419
38 Ga0070670_101189122 3300005331 Bacteria 697
39 Ga0070677_10105109 3300005333 Bacteria 1252
40 Ga0070666_10164922 3300005335 Bacteria 1549
41 Ga0068868_100073946 3300005338 Bacteria 2721
42 Ga0070660_100004289 3300005339 Bacteria 9850
43 Ga0070661_100440097 3300005344 Bacteria 1036
44 Ga0070668_100055793 3300005347 Bacteria 3050
45 Ga0070669_100054000 3300005353 Bacteria 2942
46 Ga0070669_100283211 3300005353 Bacteria 1329
47 Ga0070669_100611605 3300005353 Bacteria 914
48 Ga0070675_100000705 3300005354 Bacteria 23206
49 Ga0070671_100006437 3300005355 Bacteria 9384
50 Ga0070674_100001989 3300005356 Bacteria 11192
51 Ga0070674_100154280 3300005356 Bacteria 1736
52 Ga0070674_102154740 3300005356 Bacteria 509
53 Ga0070673_100014074 3300005364 Bacteria 5557
54 Ga0070659_100000697 3300005366 Bacteria 24441
55 Ga0070667_100152675 3300005367 Bacteria 2029
56 Ga0070667_100581315 3300005367 Bacteria 1031
57 Ga0070701_10172997 3300005438 Bacteria 1259
58 Ga0070663_100000289 3300005455 Bacteria 25666
59 Ga0070663_100595585 3300005455 Bacteria 929
60 Ga0070678_100005858 3300005456 Bacteria 7149
61 Ga0070678_100408116 3300005456 Bacteria 1182
62 Ga0070678_100729463 3300005456 Bacteria 895
63 Ga0070678_101867712 3300005456 Bacteria 567
64 Ga0068867_100003695 3300005459 Bacteria 10764
65 Ga0068867_100572991 3300005459 Bacteria 981
66 Ga0068867_100590354 3300005459 Bacteria 967
67 Ga0070679_100170005 3300005530 Bacteria 2153
68 Ga0070696_100368106 3300005546 Bacteria 1117
69 Ga0070665_100114839 3300005548 Bacteria 2695
70 Ga0070665_100997812 3300005548 Bacteria 849
71 Ga0070704_100221356 3300005549 Bacteria 1539
72 Ga0070664_100067450 3300005564 Bacteria 3058
73 Ga0070664_100561589 3300005564 Bacteria 1056
74 Ga0068864_100190388 3300005618 Bacteria 1880
75 Ga0068866_10370926 3300005718 Bacteria 915
76 Ga0068851_10263009 3300005834 Bacteria 982
77 Ga0068870_10121050 3300005840 Bacteria 1508
78 Ga0075368_10036069 3300006042 Bacteria 1931
79 Ga0075363_100414612 3300006048 Bacteria 792
80 Ga0075364_10260865 3300006051 Bacteria 1178
81 Ga0075364_10444776 3300006051 Bacteria 885
82 Ga0075362_10012577 3300006177 Bacteria 3365
83 Ga0075367_10205983 3300006178 Bacteria 1229
84 Ga0075369_10024462 3300006186 Bacteria 2503
85 Ga0075366_10021910 3300006195 Bacteria 3715
86 Ga0097621_100092319 3300006237 Bacteria 2535
87 Ga0097621_101130468 3300006237 Bacteria 736
88 Ga0075370_10055016 3300006353 Bacteria 2261
89 Ga0075370_10159158 3300006353 Bacteria 1325
90 Ga0068871_100075709 3300006358 Bacteria 2779
91 Ga0075430_100202313 3300006846 Bacteria 1649
92 Ga0075431_100018750 3300006847 Bacteria 7049
93 Ga0075429_100000294 3300006880 Bacteria 35361
94 Ga0075429_100020879 3300006880 Bacteria 5683
95 Ga0068865_101291042 3300006881 Bacteria 649
96 Ga0075436_100569324 3300006914 Bacteria 833
97 Ga0105251_10001210 3300009011 Bacteria 22309
98 Ga0105244_10128297 3300009036 Bacteria 1225
99 Ga0105240_10069966 3300009093 Bacteria 4343
100 Ga0105240_10095788 3300009093 Bacteria 3618
101 Ga0105240_10096638 3300009093 Bacteria 3600
102 Ga0114129_11225266 3300009147 Bacteria 933
103 Ga0105248_10037595 3300009177 Bacteria 5416
104 Ga0105248_11060135 3300009177 Bacteria 916
105 Ga0105237_10079024 3300009545 Bacteria 3279
106 Ga0105238_10169272 3300009551 Bacteria 2161
107 Ga0105238_10283723 3300009551 Bacteria 1638
108 Ga0105239_10008632 3300010375 Bacteria 11551
109 Ga0105239_10418444 3300010375 Bacteria 1518
110 Ga0105246_11177647 3300011119 Bacteria 704
111 Ga0157371_10000001 3300013102 Bacteria 1162285
112 Ga0157370_10455738 3300013104 Bacteria 1176
113 Ga0157369_10218107 3300013105 Bacteria 1998
114 Ga0157369_11572772 3300013105 Bacteria 669
115 Ga0157369_11983714 3300013105 Bacteria 591
116 Ga0163162_11324280 3300013306 Bacteria 818
117 Ga0157375_10061759 3300013308 Bacteria 3722
118 Ga0157375_10315722 3300013308 Bacteria 1727
119 Ga0163163_10069193 3300014325 Bacteria 3514
120 Ga0157380_10419371 3300014326 Bacteria 1276
121 Ga0157380_12131862 3300014326 Bacteria 624
122 Ga0182008_10015292 3300014497 Bacteria 4006
123 Ga0182008_10020248 3300014497 Bacteria 3428
124 Ga0157376_10106764 3300014969 Bacteria 2457
125 Ga0182006_1085684 3300015261 Bacteria 1142
126 Ga0182006_1109467 3300015261 Bacteria 971
127 Ga0182007_10002268 3300015262 Bacteria 9691
128 Ga0182007_10006994 3300015262 Bacteria 4786
129 Ga0182005_1032789 3300015265 Bacteria 1414
130 Ga0183362_10003 3300015683 Bacteria 977584
131 Ga0183361_10009 3300016635 Bacteria 205218
132 Ga0163161_10086155 3300017792 Bacteria 2318
133 Ga0213872_10000147 3300021361 Bacteria 64440
134 Ga0213872_10000232 3300021361 Bacteria 49039
135 Ga0213872_10109261 3300021361 Bacteria 1229
136 Ga0209435_100015 3300025206 Bacteria 321177
137 Ga0209435_100443 3300025206 Bacteria 8417
138 Ga0209435_102903 3300025206 Bacteria 1977
139 Ga0209566_100843 3300025225 Bacteria 15333
140 Ga0209674_101439 3300025226 Bacteria 6306
141 Ga0209674_116364 3300025226 Bacteria 620
142 Ga0209672_100033 3300025228 Bacteria 315326
143 Ga0209672_100034 3300025228 Bacteria 304973
144 Ga0209147_100004 3300025229 Bacteria 1371850
145 Ga0209147_100089 3300025229 Bacteria 178350
146 Ga0209147_100628 3300025229 Bacteria 19033
147 Ga0209563_100005 3300025230 Bacteria 1774893
148 Ga0207427_100718 3300025231 Bacteria 15457
149 Ga0209258_100023 3300025242 Bacteria 547286
150 Ga0209258_100242 3300025242 Bacteria 100588
151 Ga0209258_100523 3300025242 Bacteria 36787
152 Ga0209646_1000020 3300025246 Bacteria 462204
153 Ga0209646_1000040 3300025246 Bacteria 347867
154 Ga0209026_1000034 3300025250 Bacteria 306953
155 Ga0209026_1001823 3300025250 Bacteria 8753
156 Ga0209148_1000029 3300025254 Bacteria 579199
157 Ga0209148_1003502 3300025254 Bacteria 4302
158 Ga0209148_1012762 3300025254 Bacteria 1528
159 Ga0209759_1000049 3300025256 Bacteria 221692
160 Ga0209759_1000656 3300025256 Bacteria 32085
161 Ga0209455_1000123 3300025272 Bacteria 167231
162 Ga0209673_1000075 3300025273 Bacteria 232555
163 Ga0209130_1026653 3300025284 Bacteria 1237
164 Ga0209675_1035364 3300025291 Bacteria 1140
165 Ga0209676_1001036 3300025292 Bacteria 32214
166 Ga0209025_1004201 3300025294 Bacteria 12707
167 Ga0209564_1014545 3300025295 Bacteria 3267
168 Ga0209564_1035084 3300025295 Bacteria 1458
169 Ga0209050_1064264 3300025298 Bacteria 851
170 Ga0207426_1000326 3300025302 Bacteria 91021
171 Ga0207426_1006086 3300025302 Bacteria 5321
172 Ga0209051_1005682 3300025303 Bacteria 7207
173 Ga0209257_1016007 3300025304 Bacteria 3065
174 Ga0209257_1016909 3300025304 Bacteria 2909
175 Ga0207697_10079401 3300025315 Bacteria 1382
176 Ga0207656_10059814 3300025321 Bacteria 1669
177 Ga0207696_1053246 3300025711 Bacteria 1152
178 Ga0207713_1003216 3300025735 Bacteria 11274
179 Ga0207682_10004972 3300025893 Bacteria 5458
180 Ga0207688_10052635 3300025901 Bacteria 2282
181 Ga0207680_10161009 3300025903 Bacteria 1505
182 Ga0207647_10003550 3300025904 Bacteria 11705
183 Ga0207647_10063243 3300025904 Bacteria 2251
184 Ga0207645_10210231 3300025907 Bacteria 1281
185 Ga0207705_10080115 3300025909 Bacteria 2379
186 Ga0207695_10002948 3300025913 Bacteria 24555
187 Ga0207695_10018474 3300025913 Bacteria 8062
188 Ga0207695_10083561 3300025913 Bacteria 3225
189 Ga0207695_10313487 3300025913 Bacteria 1459
190 Ga0207671_10028629 3300025914 Bacteria 4162
191 Ga0207662_10120016 3300025918 Bacteria 1648
192 Ga0207657_10000098 3300025919 Bacteria 83552
193 Ga0207657_10366743 3300025919 Bacteria 1135
194 Ga0207646_10614104 3300025922 Bacteria 975
195 Ga0207681_10384804 3300025923 Bacteria 1130
196 Ga0207694_10386482 3300025924 Bacteria 1162
197 Ga0207650_10002051 3300025925 Bacteria 14094
198 Ga0207650_10073515 3300025925 Bacteria 2575
199 Ga0207659_10005314 3300025926 Bacteria 7806
200 Ga0207659_10735814 3300025926 Bacteria 845
201 Ga0207644_10001988 3300025931 Bacteria 13223
202 Ga0207690_10000055 3300025932 Bacteria 102536
203 Ga0207709_10005490 3300025935 Bacteria 7198
204 Ga0207709_10033765 3300025935 Bacteria 3008
205 Ga0207670_10391012 3300025936 Bacteria 1110
206 Ga0207691_10000361 3300025940 Bacteria 45833
207 Ga0207691_10046489 3300025940 Bacteria 3989
208 Ga0207691_10531794 3300025940 Bacteria 997
209 Ga0207711_10248049 3300025941 Bacteria 1634
210 Ga0207711_10664146 3300025941 Bacteria 972
211 Ga0207711_11145057 3300025941 Bacteria 719
212 Ga0207689_10832452 3300025942 Bacteria 779
213 Ga0207679_10040210 3300025945 Bacteria 3346
214 Ga0207679_10504436 3300025945 Bacteria 1080
215 Ga0207651_10039281 3300025960 Bacteria 3119
216 Ga0207651_10372707 3300025960 Bacteria 1208
217 Ga0207668_10065332 3300025972 Bacteria 2575
218 Ga0207658_10000319 3300025986 Bacteria 48401
219 Ga0207658_10098944 3300025986 Bacteria 2280
220 Ga0207677_10005131 3300026023 Bacteria 7088
221 Ga0207677_10028107 3300026023 Bacteria 3552
222 Ga0207703_10331552 3300026035 Bacteria 1396
223 Ga0207678_10002325 3300026067 Bacteria 17226
224 Ga0207678_10445964 3300026067 Bacteria 1124
225 Ga0207702_10485699 3300026078 Bacteria 1202
226 Ga0207641_10522938 3300026088 Bacteria 1154
227 Ga0207648_10007787 3300026089 Bacteria 10457
228 Ga0207648_11331613 3300026089 Bacteria 675
229 Ga0207674_10138110 3300026116 Bacteria 2398
230 Ga0207683_10253689 3300026121 Bacteria 1605
231 Ga0207683_10585374 3300026121 Bacteria 1032
232 Ga0207683_12046828 3300026121 Bacteria 521
233 Ga0207698_10015048 3300026142 Bacteria 5168
234 Ga0207698_10474589 3300026142 Bacteria 1212
235 Ga0209371_1000676 3300027312 Bacteria 29463
236 Ga0209969_1021074 3300027360 Bacteria 972
237 Ga0209984_1002498 3300027424 Bacteria 2059
238 Ga0209970_1000679 3300027614 Bacteria 5887
239 Ga0209971_1009117 3300027682 Bacteria 2353
240 Ga0307515_10000152 3300028794 Bacteria 167305
241 Ga0265324_10065087 3300029957 Bacteria 1244
242 Ga0268256_1004071 3300030500 Bacteria 6261
243 Ga0265331_10009839 3300031250 Bacteria 5329
244 Ga0265327_10000144 3300031251 Bacteria 156779
245 Ga0265327_10005755 3300031251 Bacteria 10210
246 Ga0265327_10028374 3300031251 Bacteria 3204
247 Ga0265327_10049683 3300031251 Bacteria 2199
248 Ga0307513_10000004 3300031456 Bacteria 558931
249 Ga0307408_100140697 3300031548 Bacteria 1894
250 Ga0307408_100158087 3300031548 Bacteria 1797
251 Ga0307408_100387198 3300031548 Bacteria 1197
252 Ga0316575_10062853 3300031665 Bacteria 1485
253 Ga0307516_10094111 3300031730 Bacteria 2821
254 Ga0307516_10449662 3300031730 Bacteria 945
255 Ga0307405_10012250 3300031731 Bacteria 4531
256 Ga0307405_10234871 3300031731 Bacteria 1354
257 Ga0307413_10653376 3300031824 Bacteria 868
258 Ga0307410_10089256 3300031852 Bacteria 2184
259 Ga0307406_10353794 3300031901 Bacteria 1149
260 Ga0307412_10287940 3300031911 Bacteria 1293
261 Ga0307416_100085777 3300032002 Bacteria 2681
262 Ga0307416_101337452 3300032002 Bacteria 822
263 Ga0307411_10030605 3300032005 Bacteria 3301
264 Ga0307411_10462404 3300032005 Bacteria 1064
265 Ga0307411_10719569 3300032005 Bacteria 871
266 Ga0316574_0339027 3300035398 Bacteria 953
267 Ga0395899_0000054 3300037312 Bacteria 220952
268 Ga0395899_0005159 3300037312 Bacteria 10160
269 Ga0395900_0000220 3300037418 Bacteria 90109
270 Ga0395900_0016002 3300037418 Bacteria 7643
271 Ga0395898_0000510 3300037466 Bacteria 75287
272 Ga0395898_0057480 3300037466 Bacteria 3790
273 Ga0395898_1507936 3300037466 Bacteria 598
274 Ga0395905_0007060 3300037471 Bacteria 11226
275 Ga0395905_0024865 3300037471 Bacteria 5651
276 Ga0395905_0198592 3300037471 Bacteria 1880
277 Ga0395905_0329011 3300037471 Bacteria 1418
278 Ga0395905_0516901 3300037471 Bacteria 1094
279 Ga0395901_0002022 3300038443 Bacteria 20858
280 Ga0395901_0006544 3300038443 Bacteria 11783
281 Ga0395901_0229644 3300038443 Bacteria 1938
282 Ga0436365_1170741 3300039437 Bacteria 1213
283 Ga0436361_0061503 3300039447 Bacteria 127805
284 Ga0436361_0292464 3300039447 Bacteria 1226
285 Ga0436361_0481389 3300039447 Bacteria 1261
286 Ga0436361_0777699 3300039447 Bacteria 723
287 Ga0436361_0848343 3300039447 Bacteria 176869
288 Ga0451793_0387167 3300041452 Bacteria 757
289 Ga0451795_0239490 3300041456 Bacteria 596
290 Ga0451798_0112165 3300041458 Bacteria 714
291 Ga0451837_0266051 3300041494 Bacteria 683
292 Ga0451847_0818075 3300041503 Bacteria 590
293 Ga0439431_0067820 3300041997 Bacteria 947
294 Ga0439432_007117 3300042006 Bacteria 3974
295 Ga0439449_0002109 3300042007 Bacteria 7806
296 Ga0439449_0007819 3300042007 Bacteria 4060
297 Ga0439452_014679 3300042010 Bacteria 2168
298 Ga0439457_008633 3300042014 Bacteria 2395
299 Ga0450911_000542 3300042115 Bacteria 11763
300 Ga0450914_049551 3300042118 Bacteria 550
301 Ga0450921_014837 3300042123 Bacteria 695
302 Ga0450897_000200 3300042128 Bacteria 2984
303 Ga0450894_003837 3300042131 Bacteria 1965
304 Ga0450895_012740 3300042132 Bacteria 734
305 Ga0450899_002285 3300042135 Bacteria 2086
306 Ga0450899_039162 3300042135 Bacteria 590
307 Ga0450908_021483 3300042184 Bacteria 1132
308 Ga0450909_005365 3300042185 Bacteria 1844
309 Ga0439434_0004361 3300042435 Bacteria 4136
310 Ga0439434_0021460 3300042435 Bacteria 1940
311 Ga0439464_0078516 3300042439 Bacteria 983
312 Ga0451577_0000142 3300042876 Bacteria 160598
313 Ga0451577_0000879 3300042876 Bacteria 44584
314 Ga0451577_0003831 3300042876 Bacteria 16362
315 Ga0451577_1033168 3300042876 Bacteria 737
316 Ga0466969_0029637 3300044656 Bacteria 2793
317 Ga0466969_0037105 3300044656 Bacteria 2460
318 Ga0466972_0000111 3300044658 Bacteria 70764
319 Ga0453683_0013236 3300044673 Bacteria 5392
320 Ga0466965_0000099 3300044683 Bacteria 25415
321 Ga0466965_0004051 3300044683 Bacteria 6502
322 Ga0466965_0120408 3300044683 Bacteria 1355
323 Ga0466966_0000087 3300044684 Bacteria 57881
324 Ga0466966_0001623 3300044684 Bacteria 14487
325 Ga0466966_0892031 3300044684 Bacteria 536
326 Ga0466961_0000724 3300044693 Bacteria 20747
327 Ga0466961_0022051 3300044693 Bacteria 4098
328 Ga0466963_0036933 3300044694 Bacteria 3188
329 Ga0466963_0266552 3300044694 Bacteria 1203
330 Ga0466964_0000850 3300044706 Bacteria 10013
331 Ga0466964_0015718 3300044706 Bacteria 2881
332 Ga0453684_0000126 3300044712 Bacteria 336395
333 Ga0466971_0079058 3300044719 Bacteria 1499
334 Ga0466968_0026539 3300044735 Bacteria 2378
335 Ga0466968_0087190 3300044735 Bacteria 1378
336 Ga0466968_0169681 3300044735 Bacteria 1010
337 Ga0466968_0422769 3300044735 Bacteria 656
338 Ga0466970_0035821 3300044765 Bacteria 2628
339 Ga0466957_0025046 3300044842 Bacteria 3534
340 Ga0466959_0006559 3300045049 Bacteria 8075
341 Ga0466959_0017642 3300045049 Bacteria 5234
342 Ga0451576_0023432 3300045051 Bacteria 6683
343 Ga0466958_0006352 3300045836 Bacteria 6426
344 Ga0466958_0021076 3300045836 Bacteria 3804
345 Ga0495592_0042768 3300046454 Bacteria 3392
346 Ga0495592_0438802 3300046454 Bacteria 820
347 Ga0495590_0000630 3300046457 Bacteria 16380
348 Ga0495651_0101433 3300046462 Bacteria 2142
349 Ga0495651_0396110 3300046462 Bacteria 902
350 Ga0495653_0003931 3300046463 Bacteria 12016
351 Ga0495653_0179559 3300046463 Bacteria 1454
352 Ga0495653_0274026 3300046463 Bacteria 1110
353 Ga0495650_0126883 3300046471 Bacteria 934
354 Ga0495580_0911067 3300046472 Bacteria 564
355 Ga0495582_0521925 3300046473 Bacteria 687
356 Ga0495605_0393043 3300046474 Bacteria 577
357 Ga0495664_0060226 3300046477 Bacteria 2260
358 Ga0495584_0037588 3300046491 Bacteria 2447
359 Ga0495585_0007791 3300046492 Bacteria 6525
360 Ga0495596_0112653 3300046500 Bacteria 1056
361 Ga0495583_0003698 3300046506 Bacteria 11378
362 Ga0495616_0049273 3300046513 Bacteria 2112
363 Ga0495618_0182184 3300046514 Bacteria 1334
364 Ga0495620_0018493 3300046515 Bacteria 3450
365 Ga0495620_0264397 3300046515 Bacteria 655
366 Ga0495628_0008227 3300046516 Bacteria 8971
367 Ga0495628_0018646 3300046516 Bacteria 5743
368 Ga0495628_0072664 3300046516 Bacteria 2680
369 Ga0495630_0378752 3300046517 Bacteria 1084
370 Ga0495631_0057978 3300046518 Bacteria 1684
371 Ga0495632_0153200 3300046519 Bacteria 1065
372 Ga0495643_0010464 3300046522 Bacteria 5709
373 Ga0495642_0030532 3300046528 Bacteria 2156
374 Ga0495652_0013479 3300046529 Bacteria 7358
375 Ga0495652_0071319 3300046529 Bacteria 2900
376 Ga0495652_0126467 3300046529 Bacteria 2030
377 Ga0495654_0169692 3300046530 Bacteria 952
378 Ga0495654_0404347 3300046530 Bacteria 542
379 Ga0495586_0100845 3300046535 Bacteria 1602
380 Ga0495609_0005408 3300046538 Bacteria 6719
381 Ga0495597_0005314 3300046542 Bacteria 6829
382 Ga0495597_0007513 3300046542 Bacteria 5527
383 Ga0495645_0017116 3300046543 Bacteria 5192
384 Ga0495633_0006804 3300046558 Bacteria 6702
385 Ga0495667_0135696 3300046559 Bacteria 1586
386 Ga0495634_0152637 3300046642 Bacteria 1460
387 Ga0495611_0206269 3300046648 Bacteria 916
388 Ga0495635_0111045 3300046663 Bacteria 1873
389 Ga0495635_0375383 3300046663 Bacteria 947
390 Ga0495661_0037408 3300046665 Bacteria 3030
391 Ga0495599_0004516 3300046678 Bacteria 8251
392 Ga0495623_0024279 3300046679 Bacteria 3907
393 Ga0495646_0001683 3300046680 Bacteria 13232
394 Ga0495646_0166690 3300046680 Bacteria 1216
395 Ga0495669_0408131 3300046684 Bacteria 658
396 Ga0495624_0094865 3300046690 Bacteria 1839
397 Ga0495624_0121941 3300046690 Bacteria 1600
398 Ga0495649_0021009 3300046694 Bacteria 3660
399 Ga0495589_0031647 3300046794 Bacteria 2662
400 Ga0495589_0451914 3300046794 Bacteria 588
401 Ga0495600_0001160 3300046809 Bacteria 14378
402 Ga0495604_0003928 3300047317 Bacteria 11841
403 Ga0495604_0138900 3300047317 Bacteria 1738
404 Ga0495604_0142882 3300047317 Bacteria 1708
405 Ga0495674_0374312 3300047319 Bacteria 1153
406 Ga0495674_0886187 3300047319 Bacteria 689
407 Ga0495672_0108737 3300047320 Bacteria 1491
408 Ga0495680_0135838 3300047322 Bacteria 1803
409 Ga0495683_0001407 3300047323 Bacteria 15868
410 Ga0495683_0038828 3300047323 Bacteria 2408
411 Ga0495683_0118914 3300047323 Bacteria 1255
412 Ga0495687_000169 3300047443 Bacteria 97243
413 Ga0495687_028428 3300047443 Bacteria 2601
414 Ga0495687_037500 3300047443 Bacteria 2158
415 Ga0495675_0537110 3300047444 Bacteria 668
416 Ga0495686_0000002 3300047472 Bacteria 1050777
417 Ga0495686_0046812 3300047472 Bacteria 2733
418 Ga0495686_0350164 3300047472 Bacteria 803
419 Ga0495593_0124416 3300047673 Bacteria 1311
420 Ga0495602_0016723 3300048088 Bacteria 7368
421 Ga0495602_0064434 3300048088 Bacteria 3168
422 Ga0495602_0234091 3300048088 Bacteria 1378
423 Ga0496100_0043465 3300048903 Bacteria 2873
424 Ga0496101_0014626 3300048904 Bacteria 5277
425 Ga0496102_0001320 3300048905 Bacteria 22249
426 Ga0496103_0007295 3300048906 Bacteria 6589
427 Ga0496104_0900794 3300048907 Bacteria 789
428 Ga0496106_0017418 3300048909 Bacteria 5316
429 Ga0496107_0010544 3300048910 Bacteria 6424
430 Ga0496109_0427176 3300048912 Bacteria 1252
431 Ga0496110_0029250 3300048913 Bacteria 4740
432 Ga0496110_0225286 3300048913 Bacteria 1705
433 Ga0496111_0840342 3300048914 Bacteria 663
434 Ga0496112_0387745 3300048915 Bacteria 1337
435 Ga0496113_0017346 3300048916 Bacteria 4995
436 Ga0496114_0413596 3300048917 Bacteria 1194
437 Ga0496116_0012240 3300048919 Bacteria 7016
438 Ga0496116_0025650 3300048919 Bacteria 4329
439 Ga0496116_0056147 3300048919 Bacteria 2583
440 Ga0496116_0083790 3300048919 Bacteria 1966
441 Ga0496117_0109676 3300048920 Bacteria 1722
442 Ga0496117_0157305 3300048920 Bacteria 1336
443 Ga0496117_0391254 3300048920 Bacteria 705
444 Ga0496118_0041267 3300048921 Bacteria 3656
445 Ga0496118_0085353 3300048921 Bacteria 2199
446 Ga0496118_0107942 3300048921 Bacteria 1857
447 Ga0496119_0150913 3300048922 Bacteria 1245
448 Ga0496119_0202098 3300048922 Bacteria 1028
449 Ga0496121_0026672 3300048924 Bacteria 5432
450 Ga0496121_0055225 3300048924 Bacteria 3311
451 Ga0496121_0095542 3300048924 Bacteria 2309
452 Ga0496121_0149288 3300048924 Bacteria 1722
453 Ga0496121_0155932 3300048924 Bacteria 1675
454 Ga0496121_0376782 3300048924 Bacteria 937
455 Ga0496121_0388081 3300048924 Bacteria 919
456 Ga0496122_0007506 3300048925 Bacteria 12093
457 Ga0496122_0016989 3300048925 Bacteria 6834
458 Ga0496122_0201623 3300048925 Bacteria 1163
459 Ga0496123_0013377 3300048926 Bacteria 6896
460 Ga0496123_0164858 3300048926 Bacteria 1177
461 Ga0496123_0316224 3300048926 Bacteria 739
462 Ga0496124_0016661 3300048927 Bacteria 6973
463 Ga0496124_0147198 3300048927 Bacteria 1852
464 Ga0496124_0151704 3300048927 Bacteria 1817
465 Ga0496124_0216033 3300048927 Bacteria 1446
466 Ga0496124_0220722 3300048927 Bacteria 1426
467 Ga0496125_0001986 3300048928 Bacteria 27786
468 Ga0496125_0005041 3300048928 Bacteria 14902
469 Ga0496125_0009210 3300048928 Bacteria 10201
470 Ga0496125_0017768 3300048928 Bacteria 6769
471 Ga0496125_0034310 3300048928 Bacteria 4475
472 Ga0496125_0041736 3300048928 Bacteria 3918
473 Ga0496125_0291771 3300048928 Bacteria 1004
474 Ga0496126_0053155 3300048929 Bacteria 3677
475 Ga0496126_0096964 3300048929 Bacteria 2585
476 Ga0496126_0474798 3300048929 Bacteria 1003
477 Ga0496126_0503168 3300048929 Bacteria 968
478 Ga0496126_0722132 3300048929 Bacteria 772
479 Ga0496126_0815518 3300048929 Bacteria 715
480 Ga0495678_135378 3300049459 Bacteria 812
481 Ga0501034_0094658 3300049571 Bacteria 2984
482 Ga0501036_1022829 3300049572 Bacteria 676
483 Ga0501075_0224535 3300049591 Bacteria 1433
484 Ga0501076_0130489 3300049592 Bacteria 2038
485 Ga0501235_116457 3300049669 Bacteria 665
486 Ga0501266_005385 3300049763 Bacteria 1592
487 Ga0501035_0025767 3300049822 Bacteria 5390
488 Ga0501044_0012767 3300049823 Bacteria 9097
489 nmdc:mga03683_27162_c1 3300050489 Bacteria 2264
490 nmdc:mga03683_42933_c1 3300050489 Bacteria 1863
491 nmdc:mga03n38_250905_c1 3300050490 Bacteria 935
492 nmdc:mga0yw44_442496_c1 3300050492 Bacteria 881
493 nmdc:mga0yw44_716466_c1 3300050492 Bacteria 680
494 nmdc:mga0k408_46528_c1 3300050493 Bacteria 2506
495 nmdc:mga0k408_5292_c2 3300050493 Bacteria 3995
496 nmdc:mga06z11_526962_c1 3300050494 Bacteria 717
497 nmdc:mga06z11_61447_c1 3300050494 Bacteria 1959
498 nmdc:mga07m45_40490_c1 3300050496 Bacteria 2607
499 nmdc:mga07m45_531332_c1 3300050496 Bacteria 681
500 nmdc:mga07m45_76695_c1 3300050496 Bacteria 1906
501 nmdc:mga05p37_929765_c1 3300050507 Bacteria 933
502 nmdc:mga09592_214556_c1 3300050508 Bacteria 1668
503 nmdc:mga09592_32207_c1 3300050508 Bacteria 4370
504 nmdc:mga0qj67_15201_c1 3300050509 Bacteria 5825
505 nmdc:mga0qj67_194524_c1 3300050509 Bacteria 1648
506 nmdc:mga06r32_26118_c1 3300050510 Bacteria 5441
507 nmdc:mga08x19_112619_c1 3300050514 Bacteria 1816
508 Ga0495601_0005804 3300053077 Bacteria 7197
509 Ga0500578_0044292 3300053086 Bacteria 2857
510 Ga0500643_212325 3300053087 Bacteria 519
511 Ga0500651_0039631 3300053093 Bacteria 2966
512 Ga0500573_0202152 3300053140 Bacteria 1054
513 Ga0500574_000304 3300053141 Bacteria 6049
514 Ga0500619_000795 3300053154 Bacteria 5389
515 Ga0500645_006109 3300053730 Bacteria 4339
516 Ga0466962_0394874 3300061719 Bacteria 692
517 Ga0105242_10000656
518 JGI24739J22299_10049111
519 JGI24735J21928_10021797
520 JGI25162J39368_1000027
521 JGI25163J39215_1004601
522 JGI25165J46597_1000031
523 JGI25160J50197_1000279
524 JGI25160J50197_1026696
525 Ga0055538_1000018
526 Ga0055539_1000023
527 Ga0055533_1000031
528 Ga0055532_1001850
529 Ga0055532_1002401
530 Ga0055532_1002405
531 Ga0055525_1000038
532 Ga0055525_1000039
533 Ga0055527_1001077
534 Ga0055527_1001080
535 Ga0055535_1002463
536 Ga0055535_1002468
537 Ga0055542_1002359
538 Ga0055542_1003231
539 Ga0055529_1001317
540 Ga0055534_1026131
541 Ga0055528_1001724
542 Ga0055541_1000016
543 Ga0058692_1009562
544 Ga0055543_1007895
545 Ga0065165_1000214
546 Ga0065165_1000286
547 Ga0065165_1000905
548 Ga0065714_10141060
549 Ga0065712_10030383
550 Ga0070658_10109366
551 Ga0070676_10228686
552 Ga0070676_10858057
553 Ga0070670_100003254
554 Ga0070670_101189122
555 Ga0070677_10105109
556 Ga0070666_10164922
557 Ga0068868_100073946
558 Ga0070660_100004289
559 Ga0070661_100440097
560 Ga0070668_100055793
561 Ga0070669_100054000
562 Ga0070669_100283211
563 Ga0070669_100611605
564 Ga0070675_100000705
565 Ga0070671_100006437
566 Ga0070674_100001989
567 Ga0070674_100154280
568 Ga0070674_102154740
569 Ga0070673_100014074
570 Ga0070659_100000697
571 Ga0070667_100152675
572 Ga0070667_100581315
573 Ga0070701_10172997
574 Ga0070663_100000289
575 Ga0070663_100595585
576 Ga0070678_100005858
577 Ga0070678_100408116
578 Ga0070678_100729463
579 Ga0070678_101867712
580 Ga0068867_100003695
581 Ga0068867_100572991
582 Ga0068867_100590354
583 Ga0070679_100170005
584 Ga0070696_100368106
585 Ga0070665_100114839
586 Ga0070665_100997812
587 Ga0070704_100221356
588 Ga0070664_100067450
589 Ga0070664_100561589
590 Ga0068864_100190388
591 Ga0068866_10370926
592 Ga0068851_10263009
593 Ga0068870_10121050
594 Ga0075368_10036069
595 Ga0075363_100414612
596 Ga0075364_10260865
597 Ga0075364_10444776
598 Ga0075362_10012577
599 Ga0075367_10205983
600 Ga0075369_10024462
601 Ga0075366_10021910
602 Ga0097621_100092319
603 Ga0097621_101130468
604 Ga0075370_10055016
605 Ga0075370_10159158
606 Ga0068871_100075709
607 Ga0075430_100202313
608 Ga0075431_100018750
609 Ga0075429_100000294
610 Ga0075429_100020879
611 Ga0068865_101291042
612 Ga0075436_100569324
613 Ga0105251_10001210
614 Ga0105244_10128297
615 Ga0105240_10069966
616 Ga0105240_10095788
617 Ga0105240_10096638
618 Ga0114129_11225266
619 Ga0105248_10037595
620 Ga0105248_11060135
621 Ga0105237_10079024
622 Ga0105238_10169272
623 Ga0105238_10283723
624 Ga0105239_10008632
625 Ga0105239_10418444
626 Ga0105246_11177647
627 Ga0157371_10000001
628 Ga0157370_10455738
629 Ga0157369_10218107
630 Ga0157369_11572772
631 Ga0157369_11983714
632 Ga0163162_11324280
633 Ga0157375_10061759
634 Ga0157375_10315722
635 Ga0163163_10069193
636 Ga0157380_10419371
637 Ga0157380_12131862
638 Ga0182008_10015292
639 Ga0182008_10020248
640 Ga0157376_10106764
641 Ga0182006_1085684
642 Ga0182006_1109467
643 Ga0182007_10002268
644 Ga0182007_10006994
645 Ga0182005_1032789
646 Ga0183362_10003
647 Ga0183361_10009
648 Ga0163161_10086155
649 Ga0213872_10000147
650 Ga0213872_10000232
651 Ga0213872_10109261
652 Ga0209435_100015
653 Ga0209435_100443
654 Ga0209435_102903
655 Ga0209566_100843
656 Ga0209674_101439
657 Ga0209674_116364
658 Ga0209672_100033
659 Ga0209672_100034
660 Ga0209147_100004
661 Ga0209147_100089
662 Ga0209147_100628
663 Ga0209563_100005
664 Ga0207427_100718
665 Ga0209258_100023
666 Ga0209258_100242
667 Ga0209258_100523
668 Ga0209646_1000020
669 Ga0209646_1000040
670 Ga0209026_1000034
671 Ga0209026_1001823
672 Ga0209148_1000029
673 Ga0209148_1003502
674 Ga0209148_1012762
675 Ga0209759_1000049
676 Ga0209759_1000656
677 Ga0209455_1000123
678 Ga0209673_1000075
679 Ga0209130_1026653
680 Ga0209675_1035364
681 Ga0209676_1001036
682 Ga0209025_1004201
683 Ga0209564_1014545
684 Ga0209564_1035084
685 Ga0209050_1064264
686 Ga0207426_1000326
687 Ga0207426_1006086
688 Ga0209051_1005682
689 Ga0209257_1016007
690 Ga0209257_1016909
691 Ga0207697_10079401
692 Ga0207656_10059814
693 Ga0207696_1053246
694 Ga0207713_1003216
695 Ga0207682_10004972
696 Ga0207688_10052635
697 Ga0207680_10161009
698 Ga0207647_10003550
699 Ga0207647_10063243
700 Ga0207645_10210231
701 Ga0207705_10080115
702 Ga0207695_10002948
703 Ga0207695_10018474
704 Ga0207695_10083561
705 Ga0207695_10313487
706 Ga0207671_10028629
707 Ga0207662_10120016
708 Ga0207657_10000098
709 Ga0207657_10366743
710 Ga0207646_10614104
711 Ga0207681_10384804
712 Ga0207694_10386482
713 Ga0207650_10002051
714 Ga0207650_10073515
715 Ga0207659_10005314
716 Ga0207659_10735814
717 Ga0207644_10001988
718 Ga0207690_10000055
719 Ga0207709_10005490
720 Ga0207709_10033765
721 Ga0207670_10391012
722 Ga0207691_10000361
723 Ga0207691_10046489
724 Ga0207691_10531794
725 Ga0207711_10248049
726 Ga0207711_10664146
727 Ga0207711_11145057
728 Ga0207689_10832452
729 Ga0207679_10040210
730 Ga0207679_10504436
731 Ga0207651_10039281
732 Ga0207651_10372707
733 Ga0207668_10065332
734 Ga0207658_10000319
735 Ga0207658_10098944
736 Ga0207677_10005131
737 Ga0207677_10028107
738 Ga0207703_10331552
739 Ga0207678_10002325
740 Ga0207678_10445964
741 Ga0207702_10485699
742 Ga0207641_10522938
743 Ga0207648_10007787
744 Ga0207648_11331613
745 Ga0207674_10138110
746 Ga0207683_10253689
747 Ga0207683_10585374
748 Ga0207683_12046828
749 Ga0207698_10015048
750 Ga0207698_10474589
751 Ga0209371_1000676
752 Ga0209969_1021074
753 Ga0209984_1002498
754 Ga0209970_1000679
755 Ga0209971_1009117
756 Ga0307515_10000152
757 Ga0265324_10065087
758 Ga0268256_1004071
759 Ga0265331_10009839
760 Ga0265327_10000144
761 Ga0265327_10005755
762 Ga0265327_10028374
763 Ga0265327_10049683
764 Ga0307513_10000004
765 Ga0307408_100140697
766 Ga0307408_100158087
767 Ga0307408_100387198
768 Ga0316575_10062853
769 Ga0307516_10094111
770 Ga0307516_10449662
771 Ga0307405_10012250
772 Ga0307405_10234871
773 Ga0307413_10653376
774 Ga0307410_10089256
775 Ga0307406_10353794
776 Ga0307412_10287940
777 Ga0307416_100085777
778 Ga0307416_101337452
779 Ga0307411_10030605
780 Ga0307411_10462404
781 Ga0307411_10719569
782 Ga0316574_0339027
783 Ga0395899_0000054
784 Ga0395899_0005159
785 Ga0395900_0000220
786 Ga0395900_0016002
787 Ga0395898_0000510
788 Ga0395898_0057480
789 Ga0395898_1507936
790 Ga0395905_0007060
791 Ga0395905_0024865
792 Ga0395905_0198592
793 Ga0395905_0329011
794 Ga0395905_0516901
795 Ga0395901_0002022
796 Ga0395901_0006544
797 Ga0395901_0229644
798 Ga0436365_1170741
799 Ga0436361_0061503
800 Ga0436361_0292464
801 Ga0436361_0481389
802 Ga0436361_0777699
803 Ga0436361_0848343
804 Ga0451793_0387167
805 Ga0451795_0239490
806 Ga0451798_0112165
807 Ga0451837_0266051
808 Ga0451847_0818075
809 Ga0439431_0067820
810 Ga0439432_007117
811 Ga0439449_0002109
812 Ga0439449_0007819
813 Ga0439452_014679
814 Ga0439457_008633
815 Ga0450911_000542
816 Ga0450914_049551
817 Ga0450921_014837
818 Ga0450897_000200
819 Ga0450894_003837
820 Ga0450895_012740
821 Ga0450899_002285
822 Ga0450899_039162
823 Ga0450908_021483
824 Ga0450909_005365
825 Ga0439434_0004361
826 Ga0439434_0021460
827 Ga0439464_0078516
828 Ga0451577_0000142
829 Ga0451577_0000879
830 Ga0451577_0003831
831 Ga0451577_1033168
832 Ga0466969_0029637
833 Ga0466969_0037105
834 Ga0466972_0000111
835 Ga0453683_0013236
836 Ga0466965_0000099
837 Ga0466965_0004051
838 Ga0466965_0120408
839 Ga0466966_0000087
840 Ga0466966_0001623
841 Ga0466966_0892031
842 Ga0466961_0000724
843 Ga0466961_0022051
844 Ga0466963_0036933
845 Ga0466963_0266552
846 Ga0466964_0000850
847 Ga0466964_0015718
848 Ga0453684_0000126
849 Ga0466971_0079058
850 Ga0466968_0026539
851 Ga0466968_0087190
852 Ga0466968_0169681
853 Ga0466968_0422769
854 Ga0466970_0035821
855 Ga0466957_0025046
856 Ga0466959_0006559
857 Ga0466959_0017642
858 Ga0451576_0023432
859 Ga0466958_0006352
860 Ga0466958_0021076
861 Ga0495592_0042768
862 Ga0495592_0438802
863 Ga0495590_0000630
864 Ga0495651_0101433
865 Ga0495651_0396110
866 Ga0495653_0003931
867 Ga0495653_0179559
868 Ga0495653_0274026
869 Ga0495650_0126883
870 Ga0495580_0911067
871 Ga0495582_0521925
872 Ga0495605_0393043
873 Ga0495664_0060226
874 Ga0495584_0037588
875 Ga0495585_0007791
876 Ga0495596_0112653
877 Ga0495583_0003698
878 Ga0495616_0049273
879 Ga0495618_0182184
880 Ga0495620_0018493
881 Ga0495620_0264397
882 Ga0495628_0008227
883 Ga0495628_0018646
884 Ga0495628_0072664
885 Ga0495630_0378752
886 Ga0495631_0057978
887 Ga0495632_0153200
888 Ga0495643_0010464
889 Ga0495642_0030532
890 Ga0495652_0013479
891 Ga0495652_0071319
892 Ga0495652_0126467
893 Ga0495654_0169692
894 Ga0495654_0404347
895 Ga0495586_0100845
896 Ga0495609_0005408
897 Ga0495597_0005314
898 Ga0495597_0007513
899 Ga0495645_0017116
900 Ga0495633_0006804
901 Ga0495667_0135696
902 Ga0495634_0152637
903 Ga0495611_0206269
904 Ga0495635_0111045
905 Ga0495635_0375383
906 Ga0495661_0037408
907 Ga0495599_0004516
908 Ga0495623_0024279
909 Ga0495646_0001683
910 Ga0495646_0166690
911 Ga0495669_0408131
912 Ga0495624_0094865
913 Ga0495624_0121941
914 Ga0495649_0021009
915 Ga0495589_0031647
916 Ga0495589_0451914
917 Ga0495600_0001160
918 Ga0495604_0003928
919 Ga0495604_0138900
920 Ga0495604_0142882
921 Ga0495674_0374312
922 Ga0495674_0886187
923 Ga0495672_0108737
924 Ga0495680_0135838
925 Ga0495683_0001407
926 Ga0495683_0038828
927 Ga0495683_0118914
928 Ga0495687_000169
929 Ga0495687_028428
930 Ga0495687_037500
931 Ga0495675_0537110
932 Ga0495686_0000002
933 Ga0495686_0046812
934 Ga0495686_0350164
935 Ga0495593_0124416
936 Ga0495602_0016723
937 Ga0495602_0064434
938 Ga0495602_0234091
939 Ga0496100_0043465
940 Ga0496101_0014626
941 Ga0496102_0001320
942 Ga0496103_0007295
943 Ga0496104_0900794
944 Ga0496106_0017418
945 Ga0496107_0010544
946 Ga0496109_0427176
947 Ga0496110_0029250
948 Ga0496110_0225286
949 Ga0496111_0840342
950 Ga0496112_0387745
951 Ga0496113_0017346
952 Ga0496114_0413596
953 Ga0496116_0012240
954 Ga0496116_0025650
955 Ga0496116_0056147
956 Ga0496116_0083790
957 Ga0496117_0109676
958 Ga0496117_0157305
959 Ga0496117_0391254
960 Ga0496118_0041267
961 Ga0496118_0085353
962 Ga0496118_0107942
963 Ga0496119_0150913
964 Ga0496119_0202098
965 Ga0496121_0026672
966 Ga0496121_0055225
967 Ga0496121_0095542
968 Ga0496121_0149288
969 Ga0496121_0155932
970 Ga0496121_0376782
971 Ga0496121_0388081
972 Ga0496122_0007506
973 Ga0496122_0016989
974 Ga0496122_0201623
975 Ga0496123_0013377
976 Ga0496123_0164858
977 Ga0496123_0316224
978 Ga0496124_0016661
979 Ga0496124_0147198
980 Ga0496124_0151704
981 Ga0496124_0216033
982 Ga0496124_0220722
983 Ga0496125_0001986
984 Ga0496125_0005041
985 Ga0496125_0009210
986 Ga0496125_0017768
987 Ga0496125_0034310
988 Ga0496125_0041736
989 Ga0496125_0291771
990 Ga0496126_0053155
991 Ga0496126_0096964
992 Ga0496126_0474798
993 Ga0496126_0503168
994 Ga0496126_0722132
995 Ga0496126_0815518
996 Ga0495678_135378
997 Ga0501034_0094658
998 Ga0501036_1022829
999 Ga0501075_0224535
1000 Ga0501076_0130489
1001 Ga0501235_116457
1002 Ga0501266_005385
1003 Ga0501035_0025767
1004 Ga0501044_0012767
1005 nmdc:mga03683_27162_c1
1006 nmdc:mga03683_42933_c1
1007 nmdc:mga03n38_250905_c1
1008 nmdc:mga0yw44_442496_c1
1009 nmdc:mga0yw44_716466_c1
1010 nmdc:mga0k408_46528_c1
1011 nmdc:mga0k408_5292_c2
1012 nmdc:mga06z11_526962_c1
1013 nmdc:mga06z11_61447_c1
1014 nmdc:mga07m45_40490_c1
1015 nmdc:mga07m45_531332_c1
1016 nmdc:mga07m45_76695_c1
1017 nmdc:mga05p37_929765_c1
1018 nmdc:mga09592_214556_c1
1019 nmdc:mga09592_32207_c1
1020 nmdc:mga0qj67_15201_c1
1021 nmdc:mga0qj67_194524_c1
1022 nmdc:mga06r32_26118_c1
1023 nmdc:mga08x19_112619_c1
1024 Ga0495601_0005804
1025 Ga0500578_0044292
1026 Ga0500643_212325
1027 Ga0500651_0039631
1028 Ga0500573_0202152
1029 Ga0500574_000304
1030 Ga0500619_000795
1031 Ga0500645_006109
1032 Ga0466962_0394874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

46

180

0.95

PF22769

DCD

dCTP deaminase-like

54

154

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3km3-assembly1.cif.gz_A crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.9006 35 118
3km3-assembly1.cif.gz_B crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.8776 35 118
2v9x-assembly2.cif.gz_G e138d variant of escherichia coli dctp deaminase in complex with dutp 0.8608 34 123
4lhr-assembly1.cif.gz_A crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis 0.8607 1 132
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.8603 4 124
ID Description Score Start End Superfamily
3km3A00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9006 35 118 2.70.40.10
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8432 20 121 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8309 1 132 2.70.40.10
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8282 2 134 2.70.40.10
1ducA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8254 19 132 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A447TSH8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9232 26 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A661CKF5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.8987 2 123 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A447QL67-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.8987 2 119 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A259EVG0-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.8973 1 115 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A259EVG0-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.89 1 115 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map