F458037

General Info

Members Datasets Scaffolds Average Seq Length
516 222 1032 119

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0492442|Ga0495638_0492442_181_576
Length 131
Sequence MFHEYSKQQGALMHLAAQIVTALVAVIHIYIVLLETVLFNSRGRRTFGLSKETAEIVQPAMSNQGCYNGFLVAALVVGLVHPDAAIASAFNVFGLACVAVAGIWGGVTVKRTILLIQTLPAVIGLALHFGA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
92 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
95 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
164 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
169 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
172 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
173 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
187 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
191 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
192 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
193 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
194 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
195 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
196 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
197 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
198 2643221583 Caulobacter sp. Root655 Isolate Unclassified
199 2643221584 Caulobacter sp. Root656 Isolate Unclassified
200 2643221645 Massilia sp. Root351 Isolate Unclassified
201 2643221664 Massilia sp. Root418 Isolate Unclassified
202 2738541280 Massilia sp. GV090 Isolate Unclassified
203 2738541297 Duganella sp. GV083 Isolate Unclassified
204 2738541300 Massilia sp. GV016 Isolate Unclassified
205 2738541357 Duganella sp. GV053 Isolate Unclassified
206 2738543003 Duganella sp. GV066 Isolate Unclassified
207 2738543018 Massilia sp. GV045 Isolate Unclassified
208 2738543026 Duganella sp. GV089 Isolate Unclassified
209 2738543029 Duganella sp. GV039 Isolate Unclassified
210 2738543030 Massilia sp. GV097 Isolate Unclassified
211 2818991435 Caulobacter henricii 536 Isolate Unclassified
212 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
213 2821131069 Duganella sp. 1224 Isolate Unclassified
214 2842711865 Duganella sp. R-73148 Isolate Unclassified
215 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
216 2857553236 Duganella sp. R-74557 Isolate Unclassified
217 2857558681 Duganella sp. R-74565 Isolate Unclassified
218 2857564685 Duganella sp. R-74599 Isolate Unclassified
219 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
220 2919476304 Duganella sp. 3397 Isolate Unclassified
221 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
222 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0
Isolates 6.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.71
Nodule 0.78
Rhizoplane 1.94
Rhizosphere 65.12
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0492442 3300046460 Bacteria 619
2 JGI25154J39366_1000716 3300002738 Bacteria 15035
3 JGI25152J39213_1000005 3300002773 Bacteria 160019
4 JGI25150J39212_1000571 3300002774 Bacteria 14701
5 JGI25150J39212_1011165 3300002774 Unclassified 1639
6 JGI25159J45721_1003493 3300002987 Bacteria 5539
7 JGI25159J45721_1004574 3300002987 Unclassified 4551
8 JGI25159J45721_1023617 3300002987 Unclassified 1110
9 JGI25151J46595_10065835 3300003187 Bacteria 1126
10 JGI25153J46596_10005856 3300003215 Bacteria 6369
11 JGI25153J46596_10079000 3300003215 Bacteria 826
12 JGI25153J46596_10100130 3300003215 Bacteria 683
13 rootL2_10079717 3300003322 Bacteria 4110
14 rootH1_10094760 3300003323 Bacteria 3192
15 rootH1_10246408 3300003323 Bacteria 1156
16 JGI25160J50197_1022198 3300003354 Unclassified 1865
17 JGI25161J50226_1006667 3300003374 Unclassified 2056
18 Ga0055529_1000068 3300003763 Bacteria 163911
19 Ga0055526_1000013 3300003771 Bacteria 233580
20 Ga0055526_1000048 3300003771 Bacteria 120076
21 Ga0055526_1000934 3300003771 Bacteria 21684
22 Ga0055526_1004533 3300003771 Bacteria 8305
23 Ga0055526_1005682 3300003771 Bacteria 7080
24 Ga0055526_1018641 3300003771 Bacteria 2579
25 Ga0055537_1000039 3300003773 Bacteria 92151
26 Ga0055537_1002487 3300003773 Bacteria 6146
27 Ga0055537_1025918 3300003773 Unclassified 804
28 Ga0055524_1000008 3300003775 Bacteria 297761
29 Ga0055524_1003496 3300003775 Bacteria 7605
30 Ga0055524_1003858 3300003775 Bacteria 7112
31 Ga0055524_1004427 3300003775 Bacteria 6483
32 Ga0055524_1007872 3300003775 Unclassified 4480
33 Ga0055534_1000174 3300003784 Bacteria 47983
34 Ga0055534_1001797 3300003784 Bacteria 8068
35 Ga0055528_1000066 3300003790 Bacteria 84724
36 Ga0055528_1009249 3300003790 Unclassified 4134
37 Ga0055528_1054680 3300003790 Bacteria 784
38 Ga0055530_10061291 3300003791 Unclassified 838
39 Ga0055531_10001853 3300003794 Bacteria 14867
40 Ga0055531_10005354 3300003794 Bacteria 7522
41 Ga0055543_1000112 3300004625 Bacteria 69589
42 Ga0055543_1004521 3300004625 Bacteria 3762
43 Ga0065165_1000005 3300005262 Bacteria 370361
44 Ga0065165_1001216 3300005262 Bacteria 29672
45 Ga0065165_1001578 3300005262 Bacteria 23475
46 Ga0065165_1013430 3300005262 Bacteria 3255
47 Ga0065165_1118482 3300005262 Bacteria 644
48 Ga0065714_10335023 3300005288 Unclassified 652
49 Ga0065715_10118162 3300005293 Bacteria 2324
50 Ga0070677_10716420 3300005333 Bacteria 565
51 Ga0070666_11325145 3300005335 Bacteria 537
52 Ga0068868_100138152 3300005338 Bacteria 1999
53 Ga0070671_100457356 3300005355 Bacteria 1095
54 Ga0070686_100165240 3300005544 Bacteria 1561
55 Ga0068861_100613493 3300005719 Bacteria 1000
56 Ga0068858_100264798 3300005842 Bacteria 1635
57 Ga0070717_10025687 3300006028 Bacteria 4689
58 Ga0075362_10126751 3300006177 Bacteria 1212
59 Ga0075366_10080296 3300006195 Bacteria 1948
60 Ga0068865_100313571 3300006881 Bacteria 1259
61 Ga0099826_10000001 3300006948 Bacteria 1155201
62 Ga0105244_10002659 3300009036 Bacteria 13391
63 Ga0105244_10018702 3300009036 Bacteria 3880
64 Ga0105245_10139938 3300009098 Bacteria 2278
65 Ga0105242_10140458 3300009176 Bacteria 2095
66 Ga0105248_10495731 3300009177 Bacteria 1377
67 Ga0105237_10960857 3300009545 Bacteria 861
68 Ga0105238_10298680 3300009551 Bacteria 1594
69 Ga0105239_11221890 3300010375 Bacteria 866
70 Ga0182008_10004711 3300014497 Bacteria 7910
71 Ga0182008_10308150 3300014497 Bacteria 830
72 Ga0182006_1000002 3300015261 Bacteria 887990
73 Ga0182007_10000997 3300015262 Bacteria 15535
74 Ga0182007_10086640 3300015262 Bacteria 1030
75 Ga0182005_1000002 3300015265 Bacteria 908499
76 Ga0182005_1000012 3300015265 Bacteria 396944
77 Ga0163161_11550267 3300017792 Bacteria 583
78 Ga0163161_12097926 3300017792 Bacteria 502
79 Ga0213872_10000032 3300021361 Bacteria 138939
80 Ga0213872_10003798 3300021361 Bacteria 8235
81 Ga0213872_10005831 3300021361 Bacteria 6253
82 Ga0213872_10017689 3300021361 Bacteria 3291
83 Ga0213872_10019146 3300021361 Unclassified 3153
84 Ga0213872_10259215 3300021361 Bacteria 730
85 Ga0209437_105566 3300025233 Bacteria 2139
86 Ga0207425_1000001 3300025245 Bacteria 2525432
87 Ga0207425_1000130 3300025245 Bacteria 70791
88 Ga0207425_1000132 3300025245 Bacteria 68018
89 Ga0209646_1000007 3300025246 Bacteria 670994
90 Ga0209129_1000003 3300025258 Bacteria 903689
91 Ga0209129_1028701 3300025258 Bacteria 943
92 Ga0209565_1000003 3300025263 Bacteria 1099648
93 Ga0209565_1002141 3300025263 Bacteria 7464
94 Ga0209565_1008265 3300025263 Bacteria 2734
95 Ga0209565_1017592 3300025263 Bacteria 1564
96 Ga0209565_1025098 3300025263 Bacteria 1207
97 Ga0209455_1000026 3300025272 Bacteria 653778
98 Ga0209673_1000003 3300025273 Bacteria 980859
99 Ga0209673_1030493 3300025273 Bacteria 1697
100 Ga0209673_1047843 3300025273 Bacteria 1156
101 Ga0209130_1000084 3300025284 Bacteria 160070
102 Ga0209130_1000237 3300025284 Bacteria 70739
103 Ga0209675_1000003 3300025291 Bacteria 1003982
104 Ga0209675_1043659 3300025291 Bacteria 963
105 Ga0209025_1006230 3300025294 Bacteria 9350
106 Ga0209564_1000002 3300025295 Bacteria 1636803
107 Ga0209564_1000007 3300025295 Bacteria 1028582
108 Ga0209564_1000012 3300025295 Bacteria 792078
109 Ga0209564_1000311 3300025295 Bacteria 95587
110 Ga0209564_1005699 3300025295 Bacteria 6983
111 Ga0209564_1007305 3300025295 Bacteria 5732
112 Ga0209564_1009926 3300025295 Bacteria 4455
113 Ga0209564_1010971 3300025295 Bacteria 4112
114 Ga0209758_1000041 3300025297 Bacteria 410328
115 Ga0209758_1000757 3300025297 Bacteria 46825
116 Ga0209758_1000919 3300025297 Bacteria 39837
117 Ga0209050_1000011 3300025298 Bacteria 914037
118 Ga0209050_1000164 3300025298 Bacteria 154628
119 Ga0209050_1000664 3300025298 Bacteria 52795
120 Ga0209256_1000005 3300025299 Bacteria 1315082
121 Ga0209256_1000068 3300025299 Bacteria 246064
122 Ga0209256_1000395 3300025299 Bacteria 69343
123 Ga0209256_1000952 3300025299 Bacteria 35118
124 Ga0209256_1003000 3300025299 Bacteria 12538
125 Ga0209256_1072913 3300025299 Bacteria 768
126 Ga0207426_1011742 3300025302 Bacteria 3318
127 Ga0209051_1104371 3300025303 Bacteria 754
128 Ga0209257_1000003 3300025304 Bacteria 1702593
129 Ga0209257_1000187 3300025304 Bacteria 154077
130 Ga0207655_1004019 3300025728 Bacteria 10620
131 Ga0207655_1020403 3300025728 Bacteria 3407
132 Ga0207694_10558959 3300025924 Bacteria 961
133 Ga0207687_10114815 3300025927 Bacteria 2005
134 Ga0207686_11816504 3300025934 Bacteria 505
135 Ga0207711_11565774 3300025941 Bacteria 602
136 Ga0207658_10214930 3300025986 Bacteria 1614
137 Ga0207703_10782430 3300026035 Bacteria 910
138 Ga0207675_100344375 3300026118 Bacteria 1459
139 Ga0209281_1003014 3300027111 Bacteria 5967
140 Ga0209281_1005961 3300027111 Bacteria 3257
141 Ga0209282_1000001 3300027666 Bacteria 2450367
142 Ga0307515_10049411 3300028794 Bacteria 6329
143 Ga0307515_10132054 3300028794 Bacteria 2742
144 Ga0307515_10142342 3300028794 Bacteria 2564
145 Ga0265320_10385501 3300031240 Bacteria 619
146 Ga0307513_10497343 3300031456 Bacteria 937
147 Ga0307408_100001129 3300031548 Bacteria 20315
148 Ga0307408_100001185 3300031548 Bacteria 19736
149 Ga0307408_100003316 3300031548 Bacteria 11066
150 Ga0307408_100004137 3300031548 Bacteria 9880
151 Ga0307408_101723167 3300031548 Bacteria 597
152 Ga0307416_100618853 3300032002 Bacteria 1164
153 Ga0307414_10003286 3300032004 Bacteria 8617
154 Ga0373939_0041605 3300035114 Bacteria 1386
155 Ga0395899_0004163 3300037312 Bacteria 11362
156 Ga0395899_0016120 3300037312 Bacteria 5697
157 Ga0395899_0264455 3300037312 Bacteria 1175
158 Ga0395900_0208607 3300037418 Bacteria 1973
159 Ga0395898_0008173 3300037466 Bacteria 11075
160 Ga0395905_1189806 3300037471 Bacteria 666
161 Ga0395901_0089498 3300038443 Bacteria 3221
162 Ga0395901_0212832 3300038443 Bacteria 2022
163 Ga0395901_2071292 3300038443 Unclassified 514
164 Ga0436361_0036409 3300039447 Bacteria 23805
165 Ga0436361_0139111 3300039447 Bacteria 16913
166 Ga0436361_0168778 3300039447 Bacteria 51987
167 Ga0436361_0204163 3300039447 Bacteria 16983
168 Ga0436361_0710706 3300039447 Bacteria 6343
169 Ga0436361_0993359 3300039447 Bacteria 43823
170 Ga0451845_0428513 3300041501 Bacteria 879
171 Ga0451853_3716941 3300041512 Bacteria 645
172 Ga0439443_029825 3300042003 Bacteria 895
173 Ga0450890_025283 3300042127 Bacteria 823
174 Ga0439435_0012340 3300042436 Bacteria 2068
175 Ga0439459_0015016 3300042438 Bacteria 1415
176 Ga0450893_0085820 3300042532 Bacteria 627
177 Ga0466972_0403413 3300044658 Unclassified 641
178 Ga0466968_0019279 3300044735 Bacteria 2746
179 Ga0466968_0398633 3300044735 Bacteria 674
180 Ga0495617_000042 3300046452 Bacteria 122225
181 Ga0495617_006001 3300046452 Bacteria 4282
182 Ga0495617_133613 3300046452 Bacteria 794
183 Ga0495617_145135 3300046452 Bacteria 756
184 Ga0495627_000057 3300046453 Bacteria 144773
185 Ga0495627_002244 3300046453 Bacteria 9569
186 Ga0495590_0000010 3300046457 Bacteria 317890
187 Ga0495590_0000733 3300046457 Bacteria 14963
188 Ga0495590_0030334 3300046457 Bacteria 1894
189 Ga0495638_0000027 3300046460 Bacteria 337569
190 Ga0495638_0002687 3300046460 Bacteria 14323
191 Ga0495638_0005797 3300046460 Bacteria 9090
192 Ga0495638_0020825 3300046460 Bacteria 4331
193 Ga0495638_0056006 3300046460 Bacteria 2447
194 Ga0495638_0088249 3300046460 Bacteria 1872
195 Ga0495638_0255562 3300046460 Bacteria 964
196 Ga0495638_0325111 3300046460 Bacteria 820
197 Ga0495653_0000010 3300046463 Bacteria 274131
198 Ga0495653_0266060 3300046463 Bacteria 1131
199 Ga0495650_0000044 3300046471 Bacteria 355139
200 Ga0495650_0000066 3300046471 Bacteria 272883
201 Ga0495650_0001129 3300046471 Bacteria 29018
202 Ga0495650_0003132 3300046471 Bacteria 12383
203 Ga0495650_0030602 3300046471 Bacteria 2435
204 Ga0495650_0061959 3300046471 Bacteria 1496
205 Ga0495605_0000027 3300046474 Bacteria 220680
206 Ga0495605_0001915 3300046474 Bacteria 13247
207 Ga0495639_0013547 3300046475 Bacteria 3524
208 Ga0495584_0051603 3300046491 Bacteria 2070
209 Ga0495585_0002878 3300046492 Bacteria 11968
210 Ga0495585_0006877 3300046492 Bacteria 7010
211 Ga0495585_0025346 3300046492 Bacteria 3398
212 Ga0495585_0114066 3300046492 Bacteria 1434
213 Ga0495607_0005509 3300046501 Bacteria 9041
214 Ga0495607_0006835 3300046501 Bacteria 7961
215 Ga0495607_0009712 3300046501 Bacteria 6496
216 Ga0495607_0078044 3300046501 Bacteria 1828
217 Ga0495607_0113418 3300046501 Bacteria 1433
218 Ga0495607_0124648 3300046501 Bacteria 1348
219 Ga0495583_0000002 3300046506 Bacteria 782521
220 Ga0495583_0000006 3300046506 Bacteria 436893
221 Ga0495583_0000021 3300046506 Bacteria 287046
222 Ga0495583_0000117 3300046506 Bacteria 135061
223 Ga0495583_0028047 3300046506 Bacteria 2772
224 Ga0495606_0000015 3300046507 Bacteria 288808
225 Ga0495606_0000125 3300046507 Bacteria 130102
226 Ga0495606_0000128 3300046507 Bacteria 128179
227 Ga0495606_0000557 3300046507 Bacteria 59505
228 Ga0495606_0001352 3300046507 Bacteria 33283
229 Ga0495606_0004948 3300046507 Bacteria 13007
230 Ga0495606_0005861 3300046507 Bacteria 11582
231 Ga0495606_0007239 3300046507 Bacteria 9999
232 Ga0495606_0080822 3300046507 Bacteria 2022
233 Ga0495606_0158869 3300046507 Bacteria 1320
234 Ga0495606_0201391 3300046507 Bacteria 1134
235 Ga0495610_0000008 3300046512 Bacteria 622732
236 Ga0495610_0002638 3300046512 Bacteria 14832
237 Ga0495610_0005058 3300046512 Bacteria 9508
238 Ga0495610_0008136 3300046512 Bacteria 6848
239 Ga0495610_0009097 3300046512 Bacteria 6328
240 Ga0495610_0009298 3300046512 Bacteria 6230
241 Ga0495610_0011098 3300046512 Bacteria 5533
242 Ga0495610_0014019 3300046512 Bacteria 4734
243 Ga0495610_0017960 3300046512 Bacteria 4012
244 Ga0495610_0022093 3300046512 Bacteria 3485
245 Ga0495616_0000206 3300046513 Bacteria 49005
246 Ga0495616_0002340 3300046513 Bacteria 12645
247 Ga0495616_0005858 3300046513 Bacteria 7500
248 Ga0495616_0008471 3300046513 Bacteria 6090
249 Ga0495631_0002493 3300046518 Bacteria 10362
250 Ga0495632_0000727 3300046519 Bacteria 29842
251 Ga0495632_0034763 3300046519 Bacteria 2576
252 Ga0495637_0000067 3300046520 Bacteria 86002
253 Ga0495637_0011788 3300046520 Bacteria 4192
254 Ga0495637_0048526 3300046520 Bacteria 1787
255 Ga0495637_0067378 3300046520 Bacteria 1453
256 Ga0495643_0000022 3300046522 Bacteria 289691
257 Ga0495643_0000065 3300046522 Bacteria 179031
258 Ga0495643_0073832 3300046522 Bacteria 1787
259 Ga0495643_0255865 3300046522 Bacteria 815
260 Ga0495643_0352547 3300046522 Bacteria 659
261 Ga0495643_0403802 3300046522 Bacteria 602
262 Ga0495644_0000729 3300046523 Bacteria 13643
263 Ga0495644_0032412 3300046523 Bacteria 1974
264 Ga0495644_0139790 3300046523 Bacteria 924
265 Ga0495648_0000078 3300046524 Bacteria 127397
266 Ga0495648_0000223 3300046524 Bacteria 64966
267 Ga0495648_0002119 3300046524 Bacteria 18687
268 Ga0495648_0002624 3300046524 Bacteria 16378
269 Ga0495648_0021870 3300046524 Bacteria 4417
270 Ga0495648_0063607 3300046524 Bacteria 2177
271 Ga0495648_0095649 3300046524 Bacteria 1652
272 Ga0495648_0466085 3300046524 Bacteria 549
273 Ga0495663_0002360 3300046525 Bacteria 5701
274 Ga0495663_0006083 3300046525 Bacteria 3337
275 Ga0495663_0062727 3300046525 Bacteria 1171
276 Ga0495642_0000919 3300046528 Bacteria 13828
277 Ga0495642_0064643 3300046528 Bacteria 1522
278 Ga0495642_0071136 3300046528 Bacteria 1455
279 Ga0495654_0000002 3300046530 Bacteria 1021205
280 Ga0495609_0001345 3300046538 Bacteria 16585
281 Ga0495609_0003504 3300046538 Bacteria 8967
282 Ga0495609_0004160 3300046538 Bacteria 8036
283 Ga0495609_0055969 3300046538 Bacteria 1748
284 Ga0495609_0196103 3300046538 Bacteria 845
285 Ga0495609_0283953 3300046538 Bacteria 676
286 Ga0495609_0416348 3300046538 Bacteria 536
287 Ga0495597_0000107 3300046542 Bacteria 73749
288 Ga0495597_0000466 3300046542 Bacteria 34350
289 Ga0495597_0057702 3300046542 Bacteria 1698
290 Ga0495597_0145439 3300046542 Bacteria 975
291 Ga0495597_0321862 3300046542 Bacteria 597
292 Ga0495622_0000009 3300046557 Bacteria 224622
293 Ga0495622_0000043 3300046557 Bacteria 115796
294 Ga0495622_0058507 3300046557 Bacteria 1785
295 Ga0495622_0132981 3300046557 Bacteria 1132
296 Ga0495622_0160908 3300046557 Bacteria 1012
297 Ga0495633_0000381 3300046558 Bacteria 47007
298 Ga0495633_0001071 3300046558 Bacteria 22118
299 Ga0495633_0001381 3300046558 Bacteria 18966
300 Ga0495633_0006010 3300046558 Bacteria 7293
301 Ga0495633_0011906 3300046558 Bacteria 4656
302 Ga0495633_0017835 3300046558 Bacteria 3616
303 Ga0495633_0038540 3300046558 Bacteria 2282
304 Ga0495633_0041795 3300046558 Bacteria 2179
305 Ga0495633_0058009 3300046558 Bacteria 1817
306 Ga0495633_0080110 3300046558 Unclassified 1520
307 Ga0495656_0027465 3300046615 Bacteria 2273
308 Ga0495656_0134972 3300046615 Bacteria 1178
309 Ga0495656_0237660 3300046615 Bacteria 916
310 Ga0495656_0547965 3300046615 Bacteria 616
311 Ga0495668_0000006 3300046616 Bacteria 553404
312 Ga0495668_0000027 3300046616 Bacteria 297194
313 Ga0495668_0000096 3300046616 Bacteria 139693
314 Ga0495668_0001010 3300046616 Bacteria 30202
315 Ga0495668_0002945 3300046616 Bacteria 13432
316 Ga0495668_0006316 3300046616 Bacteria 7797
317 Ga0495668_0009642 3300046616 Bacteria 5908
318 Ga0495668_0024144 3300046616 Bacteria 3459
319 Ga0495668_0047397 3300046616 Bacteria 2386
320 Ga0495668_0162294 3300046616 Bacteria 1224
321 Ga0495668_0571079 3300046616 Bacteria 624
322 Ga0495611_0000739 3300046648 Bacteria 18411
323 Ga0495611_0001112 3300046648 Bacteria 14159
324 Ga0495611_0027310 3300046648 Bacteria 2494
325 Ga0495625_0000053 3300046660 Bacteria 190575
326 Ga0495625_0000058 3300046660 Bacteria 180863
327 Ga0495625_0002139 3300046660 Bacteria 21993
328 Ga0495625_0008285 3300046660 Bacteria 8884
329 Ga0495625_0008684 3300046660 Bacteria 8631
330 Ga0495625_0009909 3300046660 Bacteria 7924
331 Ga0495625_0040469 3300046660 Bacteria 3399
332 Ga0495625_0054292 3300046660 Bacteria 2862
333 Ga0495625_0098052 3300046660 Bacteria 2016
334 Ga0495625_0170284 3300046660 Bacteria 1454
335 Ga0495625_0831638 3300046660 Bacteria 534
336 Ga0495659_0000001 3300046664 Bacteria 325846
337 Ga0495659_0000826 3300046664 Bacteria 11000
338 Ga0495659_0042167 3300046664 Bacteria 1633
339 Ga0495659_0067585 3300046664 Bacteria 1333
340 Ga0495659_0253127 3300046664 Bacteria 734
341 Ga0495661_0008008 3300046665 Bacteria 7338
342 Ga0495661_0055022 3300046665 Bacteria 2387
343 Ga0495661_0085283 3300046665 Bacteria 1810
344 Ga0495669_0000429 3300046684 Bacteria 19950
345 Ga0495670_0036802 3300046691 Bacteria 2439
346 Ga0495670_0042045 3300046691 Bacteria 2280
347 Ga0495670_0280515 3300046691 Bacteria 891
348 Ga0495670_0688516 3300046691 Bacteria 557
349 Ga0495670_0720954 3300046691 Bacteria 544
350 Ga0495671_0000002 3300046692 Bacteria 1136189
351 Ga0495671_0000035 3300046692 Bacteria 188543
352 Ga0495671_0002321 3300046692 Bacteria 12087
353 Ga0495671_0028825 3300046692 Bacteria 2856
354 Ga0495671_0048524 3300046692 Bacteria 2118
355 Ga0495671_0073374 3300046692 Bacteria 1680
356 Ga0495671_0282428 3300046692 Bacteria 799
357 Ga0495649_0002789 3300046694 Bacteria 12166
358 Ga0495649_0023726 3300046694 Bacteria 3426
359 Ga0495649_0348901 3300046694 Bacteria 748
360 Ga0495660_0000069 3300046810 Bacteria 115654
361 Ga0495660_0001231 3300046810 Bacteria 17853
362 Ga0495660_0009064 3300046810 Bacteria 5810
363 Ga0495660_0018729 3300046810 Bacteria 3976
364 Ga0495660_0025019 3300046810 Bacteria 3393
365 Ga0495660_0050374 3300046810 Bacteria 2269
366 Ga0495660_0066348 3300046810 Bacteria 1925
367 Ga0495660_0080596 3300046810 Bacteria 1708
368 Ga0495660_0235097 3300046810 Bacteria 857
369 Ga0495636_0004270 3300047318 Bacteria 5605
370 Ga0495636_0014845 3300047318 Bacteria 3099
371 Ga0495636_0015425 3300047318 Bacteria 3046
372 Ga0495636_0036446 3300047318 Bacteria 2028
373 Ga0495636_0091306 3300047318 Bacteria 1322
374 Ga0495636_0629542 3300047318 Bacteria 526
375 Ga0495672_0000066 3300047320 Bacteria 193318
376 Ga0495672_0000095 3300047320 Bacteria 143883
377 Ga0495672_0047244 3300047320 Bacteria 2561
378 Ga0495672_0092513 3300047320 Bacteria 1657
379 Ga0495683_0016696 3300047323 Bacteria 3809
380 Ga0495687_001158 3300047443 Bacteria 25533
381 Ga0495687_004020 3300047443 Bacteria 10212
382 Ga0495687_051886 3300047443 Bacteria 1737
383 Ga0495677_0025554 3300047445 Bacteria 2142
384 Ga0495677_0307758 3300047445 Bacteria 623
385 Ga0495679_005149 3300047446 Bacteria 5856
386 Ga0495679_021023 3300047446 Bacteria 2263
387 Ga0495679_067817 3300047446 Bacteria 1033
388 Ga0495685_000332 3300047447 Bacteria 15267
389 Ga0495685_005026 3300047447 Bacteria 4304
390 Ga0495673_0000005 3300047469 Bacteria 943364
391 Ga0495673_0000059 3300047469 Bacteria 233234
392 Ga0495673_0000064 3300047469 Bacteria 225793
393 Ga0495673_0000225 3300047469 Bacteria 83589
394 Ga0495673_0004384 3300047469 Bacteria 8851
395 Ga0495673_0006534 3300047469 Bacteria 6840
396 Ga0495673_0033705 3300047469 Bacteria 2374
397 Ga0495681_0003868 3300047470 Bacteria 10347
398 Ga0495681_0009347 3300047470 Bacteria 6047
399 Ga0495681_0025458 3300047470 Bacteria 3095
400 Ga0495686_0000462 3300047472 Bacteria 61070
401 Ga0495686_0001427 3300047472 Bacteria 26117
402 Ga0495686_0003346 3300047472 Bacteria 13989
403 Ga0495686_0007226 3300047472 Bacteria 8362
404 Ga0495686_0036829 3300047472 Bacteria 3138
405 Ga0495686_0043025 3300047472 Bacteria 2867
406 Ga0495686_0084708 3300047472 Bacteria 1931
407 Ga0495686_0240022 3300047472 Bacteria 1022
408 Ga0495686_0395909 3300047472 Bacteria 742
409 Ga0495615_0000340 3300048090 Bacteria 7684
410 Ga0496102_0000182 3300048905 Bacteria 84891
411 Ga0496102_0050177 3300048905 Bacteria 3799
412 Ga0496102_0061923 3300048905 Bacteria 3426
413 Ga0496102_0792193 3300048905 Bacteria 870
414 Ga0496103_0069924 3300048906 Bacteria 2196
415 Ga0496106_0008622 3300048909 Bacteria 7545
416 Ga0496107_0000058 3300048910 Bacteria 54924
417 Ga0496108_0953565 3300048911 Bacteria 734
418 Ga0496111_0154702 3300048914 Bacteria 1701
419 Ga0496116_0015645 3300048919 Bacteria 5989
420 Ga0496116_0074770 3300048919 Bacteria 2129
421 Ga0496117_0000001 3300048920 Bacteria 2526244
422 Ga0496118_0000002 3300048921 Bacteria 1690764
423 Ga0496121_0007795 3300048924 Bacteria 12820
424 Ga0496121_0008882 3300048924 Bacteria 11682
425 Ga0496121_0011077 3300048924 Bacteria 10062
426 Ga0496121_0204706 3300048924 Bacteria 1403
427 Ga0496121_0281271 3300048924 Bacteria 1138
428 Ga0496121_0502829 3300048924 Bacteria 769
429 Ga0496121_0649218 3300048924 Bacteria 643
430 Ga0496122_0013372 3300048925 Bacteria 8035
431 Ga0496122_0075194 3300048925 Bacteria 2385
432 Ga0496122_0460610 3300048925 Bacteria 628
433 Ga0496123_0012122 3300048926 Bacteria 7385
434 Ga0496124_0012443 3300048927 Bacteria 8400
435 Ga0496124_0029879 3300048927 Bacteria 4848
436 Ga0496124_0065386 3300048927 Bacteria 3033
437 Ga0496125_0034021 3300048928 Bacteria 4498
438 Ga0496125_0086440 3300048928 Bacteria 2371
439 Ga0495678_000588 3300049459 Bacteria 34196
440 Ga0495678_002236 3300049459 Bacteria 13490
441 Ga0495678_007047 3300049459 Bacteria 5890
442 Ga0495678_008805 3300049459 Bacteria 5052
443 Ga0495678_017062 3300049459 Bacteria 3300
444 Ga0495678_026830 3300049459 Bacteria 2451
445 Ga0495682_0000302 3300049460 Bacteria 37440
446 Ga0495682_0000965 3300049460 Bacteria 17295
447 Ga0495682_0012517 3300049460 Bacteria 3250
448 Ga0501207_146034 3300049654 Bacteria 507
449 Ga0501222_006577 3300049662 Bacteria 1561
450 Ga0501227_002037 3300049665 Bacteria 4484
451 Ga0501233_281042 3300049668 Bacteria 509
452 Ga0501235_172503 3300049669 Bacteria 572
453 Ga0501238_045365 3300049671 Bacteria 652
454 Ga0501250_080279 3300049680 Bacteria 553
455 Ga0501221_241331 3300049704 Bacteria 516
456 Ga0501241_026866 3300049758 Bacteria 1075
457 Ga0501269_000423 3300049766 Bacteria 9533
458 Ga0501269_007654 3300049766 Bacteria 1305
459 Ga0501279_003529 3300049775 Bacteria 2040
460 Ga0501279_004382 3300049775 Bacteria 1851
461 nmdc:mga03n38_26634_c1 3300050490 Bacteria 2389
462 nmdc:mga0k408_87260_c1 3300050493 Bacteria 1832
463 Ga0500578_0001551 3300053086 Bacteria 22505
464 Ga0500643_039930 3300053087 Bacteria 1384
465 Ga0500643_108048 3300053087 Bacteria 752
466 Ga0500644_0004985 3300053088 Bacteria 3340
467 Ga0500641_0250129 3300053096 Bacteria 743
468 Ga0500562_010250 3300053108 Bacteria 2373
469 Ga0500594_0000389 3300053118 Bacteria 9821
470 Ga0500594_0002295 3300053118 Bacteria 4147
471 Ga0500594_0004222 3300053118 Bacteria 3168
472 Ga0500614_037674 3300053123 Bacteria 1215
473 Ga0500618_000064 3300053125 Bacteria 91120
474 Ga0500618_000137 3300053125 Bacteria 61561
475 Ga0500559_0000056 3300053136 Bacteria 88545
476 Ga0500559_0002417 3300053136 Bacteria 9667
477 Ga0500564_001125 3300053138 Bacteria 8907
478 Ga0500577_0014764 3300053142 Bacteria 2423
479 Ga0500586_000227 3300053145 Bacteria 11155
480 Ga0500586_001150 3300053145 Bacteria 5489
481 Ga0500616_0364918 3300053153 Bacteria 584
482 Ga0500622_0005232 3300053156 Bacteria 7841
483 Ga0500622_0036983 3300053156 Bacteria 2551
484 Ga0500609_000278 3300053731 Bacteria 7501
485 2511123490 2510917020 Bacteria 5657507
486 2585148316 2582581279 Bacteria 4980720
487 2585151447 2582581280 Bacteria 5994497
488 2585196161 2582581293 Bacteria 5907401
489 2601667867 2600255292 Bacteria 6300551
490 2643782268 2643221552 Bacteria 5708754
491 2643792132 2643221554 Bacteria 6603920
492 2643926508 2643221583 Bacteria 5218014
493 2643928943 2643221584 Bacteria 5511711
494 2644251531 2643221645 Bacteria 7207331
495 2644357400 2643221664 Bacteria 7272945
496 2738739992 2738541280 Bacteria 6630198
497 2738828590 2738541297 Bacteria 6549566
498 2738844253 2738541300 Bacteria 6675882
499 2739152386 2738541357 Bacteria 6549408
500 2739194306 2738543003 Bacteria 6549560
501 2739274187 2738543018 Bacteria 6718814
502 2739320782 2738543026 Bacteria 6549408
503 2739339023 2738543029 Bacteria 6549249
504 2739343231 2738543030 Bacteria 6719714
505 2819536961 2818991435 Bacteria 5433759
506 2819645373 2818991454 Bacteria 5563326
507 2821132835 2821131069 Bacteria 6108407
508 2842717563 2842711865 Bacteria 7155354
509 2857550100 2857547612 Bacteria 6179999
510 2857558216 2857553236 Bacteria 6166726
511 2857564515 2857558681 Bacteria 6617694
512 2857568748 2857564685 Bacteria 6290584
513 2885084752 2885080285 Bacteria 6355622
514 2919480199 2919476304 Bacteria 5888696
515 2932411483 2932410948 Bacteria 6312192
516 2932418950 2932416698 Bacteria 6315112
517 Ga0495638_0492442
518 JGI25154J39366_1000716
519 JGI25152J39213_1000005
520 JGI25150J39212_1000571
521 JGI25150J39212_1011165
522 JGI25159J45721_1003493
523 JGI25159J45721_1004574
524 JGI25159J45721_1023617
525 JGI25151J46595_10065835
526 JGI25153J46596_10005856
527 JGI25153J46596_10079000
528 JGI25153J46596_10100130
529 rootL2_10079717
530 rootH1_10094760
531 rootH1_10246408
532 JGI25160J50197_1022198
533 JGI25161J50226_1006667
534 Ga0055529_1000068
535 Ga0055526_1000013
536 Ga0055526_1000048
537 Ga0055526_1000934
538 Ga0055526_1004533
539 Ga0055526_1005682
540 Ga0055526_1018641
541 Ga0055537_1000039
542 Ga0055537_1002487
543 Ga0055537_1025918
544 Ga0055524_1000008
545 Ga0055524_1003496
546 Ga0055524_1003858
547 Ga0055524_1004427
548 Ga0055524_1007872
549 Ga0055534_1000174
550 Ga0055534_1001797
551 Ga0055528_1000066
552 Ga0055528_1009249
553 Ga0055528_1054680
554 Ga0055530_10061291
555 Ga0055531_10001853
556 Ga0055531_10005354
557 Ga0055543_1000112
558 Ga0055543_1004521
559 Ga0065165_1000005
560 Ga0065165_1001216
561 Ga0065165_1001578
562 Ga0065165_1013430
563 Ga0065165_1118482
564 Ga0065714_10335023
565 Ga0065715_10118162
566 Ga0070677_10716420
567 Ga0070666_11325145
568 Ga0068868_100138152
569 Ga0070671_100457356
570 Ga0070686_100165240
571 Ga0068861_100613493
572 Ga0068858_100264798
573 Ga0070717_10025687
574 Ga0075362_10126751
575 Ga0075366_10080296
576 Ga0068865_100313571
577 Ga0099826_10000001
578 Ga0105244_10002659
579 Ga0105244_10018702
580 Ga0105245_10139938
581 Ga0105242_10140458
582 Ga0105248_10495731
583 Ga0105237_10960857
584 Ga0105238_10298680
585 Ga0105239_11221890
586 Ga0182008_10004711
587 Ga0182008_10308150
588 Ga0182006_1000002
589 Ga0182007_10000997
590 Ga0182007_10086640
591 Ga0182005_1000002
592 Ga0182005_1000012
593 Ga0163161_11550267
594 Ga0163161_12097926
595 Ga0213872_10000032
596 Ga0213872_10003798
597 Ga0213872_10005831
598 Ga0213872_10017689
599 Ga0213872_10019146
600 Ga0213872_10259215
601 Ga0209437_105566
602 Ga0207425_1000001
603 Ga0207425_1000130
604 Ga0207425_1000132
605 Ga0209646_1000007
606 Ga0209129_1000003
607 Ga0209129_1028701
608 Ga0209565_1000003
609 Ga0209565_1002141
610 Ga0209565_1008265
611 Ga0209565_1017592
612 Ga0209565_1025098
613 Ga0209455_1000026
614 Ga0209673_1000003
615 Ga0209673_1030493
616 Ga0209673_1047843
617 Ga0209130_1000084
618 Ga0209130_1000237
619 Ga0209675_1000003
620 Ga0209675_1043659
621 Ga0209025_1006230
622 Ga0209564_1000002
623 Ga0209564_1000007
624 Ga0209564_1000012
625 Ga0209564_1000311
626 Ga0209564_1005699
627 Ga0209564_1007305
628 Ga0209564_1009926
629 Ga0209564_1010971
630 Ga0209758_1000041
631 Ga0209758_1000757
632 Ga0209758_1000919
633 Ga0209050_1000011
634 Ga0209050_1000164
635 Ga0209050_1000664
636 Ga0209256_1000005
637 Ga0209256_1000068
638 Ga0209256_1000395
639 Ga0209256_1000952
640 Ga0209256_1003000
641 Ga0209256_1072913
642 Ga0207426_1011742
643 Ga0209051_1104371
644 Ga0209257_1000003
645 Ga0209257_1000187
646 Ga0207655_1004019
647 Ga0207655_1020403
648 Ga0207694_10558959
649 Ga0207687_10114815
650 Ga0207686_11816504
651 Ga0207711_11565774
652 Ga0207658_10214930
653 Ga0207703_10782430
654 Ga0207675_100344375
655 Ga0209281_1003014
656 Ga0209281_1005961
657 Ga0209282_1000001
658 Ga0307515_10049411
659 Ga0307515_10132054
660 Ga0307515_10142342
661 Ga0265320_10385501
662 Ga0307513_10497343
663 Ga0307408_100001129
664 Ga0307408_100001185
665 Ga0307408_100003316
666 Ga0307408_100004137
667 Ga0307408_101723167
668 Ga0307416_100618853
669 Ga0307414_10003286
670 Ga0373939_0041605
671 Ga0395899_0004163
672 Ga0395899_0016120
673 Ga0395899_0264455
674 Ga0395900_0208607
675 Ga0395898_0008173
676 Ga0395905_1189806
677 Ga0395901_0089498
678 Ga0395901_0212832
679 Ga0395901_2071292
680 Ga0436361_0036409
681 Ga0436361_0139111
682 Ga0436361_0168778
683 Ga0436361_0204163
684 Ga0436361_0710706
685 Ga0436361_0993359
686 Ga0451845_0428513
687 Ga0451853_3716941
688 Ga0439443_029825
689 Ga0450890_025283
690 Ga0439435_0012340
691 Ga0439459_0015016
692 Ga0450893_0085820
693 Ga0466972_0403413
694 Ga0466968_0019279
695 Ga0466968_0398633
696 Ga0495617_000042
697 Ga0495617_006001
698 Ga0495617_133613
699 Ga0495617_145135
700 Ga0495627_000057
701 Ga0495627_002244
702 Ga0495590_0000010
703 Ga0495590_0000733
704 Ga0495590_0030334
705 Ga0495638_0000027
706 Ga0495638_0002687
707 Ga0495638_0005797
708 Ga0495638_0020825
709 Ga0495638_0056006
710 Ga0495638_0088249
711 Ga0495638_0255562
712 Ga0495638_0325111
713 Ga0495653_0000010
714 Ga0495653_0266060
715 Ga0495650_0000044
716 Ga0495650_0000066
717 Ga0495650_0001129
718 Ga0495650_0003132
719 Ga0495650_0030602
720 Ga0495650_0061959
721 Ga0495605_0000027
722 Ga0495605_0001915
723 Ga0495639_0013547
724 Ga0495584_0051603
725 Ga0495585_0002878
726 Ga0495585_0006877
727 Ga0495585_0025346
728 Ga0495585_0114066
729 Ga0495607_0005509
730 Ga0495607_0006835
731 Ga0495607_0009712
732 Ga0495607_0078044
733 Ga0495607_0113418
734 Ga0495607_0124648
735 Ga0495583_0000002
736 Ga0495583_0000006
737 Ga0495583_0000021
738 Ga0495583_0000117
739 Ga0495583_0028047
740 Ga0495606_0000015
741 Ga0495606_0000125
742 Ga0495606_0000128
743 Ga0495606_0000557
744 Ga0495606_0001352
745 Ga0495606_0004948
746 Ga0495606_0005861
747 Ga0495606_0007239
748 Ga0495606_0080822
749 Ga0495606_0158869
750 Ga0495606_0201391
751 Ga0495610_0000008
752 Ga0495610_0002638
753 Ga0495610_0005058
754 Ga0495610_0008136
755 Ga0495610_0009097
756 Ga0495610_0009298
757 Ga0495610_0011098
758 Ga0495610_0014019
759 Ga0495610_0017960
760 Ga0495610_0022093
761 Ga0495616_0000206
762 Ga0495616_0002340
763 Ga0495616_0005858
764 Ga0495616_0008471
765 Ga0495631_0002493
766 Ga0495632_0000727
767 Ga0495632_0034763
768 Ga0495637_0000067
769 Ga0495637_0011788
770 Ga0495637_0048526
771 Ga0495637_0067378
772 Ga0495643_0000022
773 Ga0495643_0000065
774 Ga0495643_0073832
775 Ga0495643_0255865
776 Ga0495643_0352547
777 Ga0495643_0403802
778 Ga0495644_0000729
779 Ga0495644_0032412
780 Ga0495644_0139790
781 Ga0495648_0000078
782 Ga0495648_0000223
783 Ga0495648_0002119
784 Ga0495648_0002624
785 Ga0495648_0021870
786 Ga0495648_0063607
787 Ga0495648_0095649
788 Ga0495648_0466085
789 Ga0495663_0002360
790 Ga0495663_0006083
791 Ga0495663_0062727
792 Ga0495642_0000919
793 Ga0495642_0064643
794 Ga0495642_0071136
795 Ga0495654_0000002
796 Ga0495609_0001345
797 Ga0495609_0003504
798 Ga0495609_0004160
799 Ga0495609_0055969
800 Ga0495609_0196103
801 Ga0495609_0283953
802 Ga0495609_0416348
803 Ga0495597_0000107
804 Ga0495597_0000466
805 Ga0495597_0057702
806 Ga0495597_0145439
807 Ga0495597_0321862
808 Ga0495622_0000009
809 Ga0495622_0000043
810 Ga0495622_0058507
811 Ga0495622_0132981
812 Ga0495622_0160908
813 Ga0495633_0000381
814 Ga0495633_0001071
815 Ga0495633_0001381
816 Ga0495633_0006010
817 Ga0495633_0011906
818 Ga0495633_0017835
819 Ga0495633_0038540
820 Ga0495633_0041795
821 Ga0495633_0058009
822 Ga0495633_0080110
823 Ga0495656_0027465
824 Ga0495656_0134972
825 Ga0495656_0237660
826 Ga0495656_0547965
827 Ga0495668_0000006
828 Ga0495668_0000027
829 Ga0495668_0000096
830 Ga0495668_0001010
831 Ga0495668_0002945
832 Ga0495668_0006316
833 Ga0495668_0009642
834 Ga0495668_0024144
835 Ga0495668_0047397
836 Ga0495668_0162294
837 Ga0495668_0571079
838 Ga0495611_0000739
839 Ga0495611_0001112
840 Ga0495611_0027310
841 Ga0495625_0000053
842 Ga0495625_0000058
843 Ga0495625_0002139
844 Ga0495625_0008285
845 Ga0495625_0008684
846 Ga0495625_0009909
847 Ga0495625_0040469
848 Ga0495625_0054292
849 Ga0495625_0098052
850 Ga0495625_0170284
851 Ga0495625_0831638
852 Ga0495659_0000001
853 Ga0495659_0000826
854 Ga0495659_0042167
855 Ga0495659_0067585
856 Ga0495659_0253127
857 Ga0495661_0008008
858 Ga0495661_0055022
859 Ga0495661_0085283
860 Ga0495669_0000429
861 Ga0495670_0036802
862 Ga0495670_0042045
863 Ga0495670_0280515
864 Ga0495670_0688516
865 Ga0495670_0720954
866 Ga0495671_0000002
867 Ga0495671_0000035
868 Ga0495671_0002321
869 Ga0495671_0028825
870 Ga0495671_0048524
871 Ga0495671_0073374
872 Ga0495671_0282428
873 Ga0495649_0002789
874 Ga0495649_0023726
875 Ga0495649_0348901
876 Ga0495660_0000069
877 Ga0495660_0001231
878 Ga0495660_0009064
879 Ga0495660_0018729
880 Ga0495660_0025019
881 Ga0495660_0050374
882 Ga0495660_0066348
883 Ga0495660_0080596
884 Ga0495660_0235097
885 Ga0495636_0004270
886 Ga0495636_0014845
887 Ga0495636_0015425
888 Ga0495636_0036446
889 Ga0495636_0091306
890 Ga0495636_0629542
891 Ga0495672_0000066
892 Ga0495672_0000095
893 Ga0495672_0047244
894 Ga0495672_0092513
895 Ga0495683_0016696
896 Ga0495687_001158
897 Ga0495687_004020
898 Ga0495687_051886
899 Ga0495677_0025554
900 Ga0495677_0307758
901 Ga0495679_005149
902 Ga0495679_021023
903 Ga0495679_067817
904 Ga0495685_000332
905 Ga0495685_005026
906 Ga0495673_0000005
907 Ga0495673_0000059
908 Ga0495673_0000064
909 Ga0495673_0000225
910 Ga0495673_0004384
911 Ga0495673_0006534
912 Ga0495673_0033705
913 Ga0495681_0003868
914 Ga0495681_0009347
915 Ga0495681_0025458
916 Ga0495686_0000462
917 Ga0495686_0001427
918 Ga0495686_0003346
919 Ga0495686_0007226
920 Ga0495686_0036829
921 Ga0495686_0043025
922 Ga0495686_0084708
923 Ga0495686_0240022
924 Ga0495686_0395909
925 Ga0495615_0000340
926 Ga0496102_0000182
927 Ga0496102_0050177
928 Ga0496102_0061923
929 Ga0496102_0792193
930 Ga0496103_0069924
931 Ga0496106_0008622
932 Ga0496107_0000058
933 Ga0496108_0953565
934 Ga0496111_0154702
935 Ga0496116_0015645
936 Ga0496116_0074770
937 Ga0496117_0000001
938 Ga0496118_0000002
939 Ga0496121_0007795
940 Ga0496121_0008882
941 Ga0496121_0011077
942 Ga0496121_0204706
943 Ga0496121_0281271
944 Ga0496121_0502829
945 Ga0496121_0649218
946 Ga0496122_0013372
947 Ga0496122_0075194
948 Ga0496122_0460610
949 Ga0496123_0012122
950 Ga0496124_0012443
951 Ga0496124_0029879
952 Ga0496124_0065386
953 Ga0496125_0034021
954 Ga0496125_0086440
955 Ga0495678_000588
956 Ga0495678_002236
957 Ga0495678_007047
958 Ga0495678_008805
959 Ga0495678_017062
960 Ga0495678_026830
961 Ga0495682_0000302
962 Ga0495682_0000965
963 Ga0495682_0012517
964 Ga0501207_146034
965 Ga0501222_006577
966 Ga0501227_002037
967 Ga0501233_281042
968 Ga0501235_172503
969 Ga0501238_045365
970 Ga0501250_080279
971 Ga0501221_241331
972 Ga0501241_026866
973 Ga0501269_000423
974 Ga0501269_007654
975 Ga0501279_003529
976 Ga0501279_004382
977 nmdc:mga03n38_26634_c1
978 nmdc:mga0k408_87260_c1
979 Ga0500578_0001551
980 Ga0500643_039930
981 Ga0500643_108048
982 Ga0500644_0004985
983 Ga0500641_0250129
984 Ga0500562_010250
985 Ga0500594_0000389
986 Ga0500594_0002295
987 Ga0500594_0004222
988 Ga0500614_037674
989 Ga0500618_000064
990 Ga0500618_000137
991 Ga0500559_0000056
992 Ga0500559_0002417
993 Ga0500564_001125
994 Ga0500577_0014764
995 Ga0500586_000227
996 Ga0500586_001150
997 Ga0500616_0364918
998 Ga0500622_0005232
999 Ga0500622_0036983
1000 Ga0500609_000278
1001 2511123490
1002 2585148316
1003 2585151447
1004 2585196161
1005 2601667867
1006 2643782268
1007 2643792132
1008 2643926508
1009 2643928943
1010 2644251531
1011 2644357400
1012 2738739992
1013 2738828590
1014 2738844253
1015 2739152386
1016 2739194306
1017 2739274187
1018 2739320782
1019 2739339023
1020 2739343231
1021 2819536961
1022 2819645373
1023 2821132835
1024 2842717563
1025 2857550100
1026 2857558216
1027 2857564515
1028 2857568748
1029 2885084752
1030 2919480199
1031 2932411483
1032 2932418950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06993

DUF1304

Protein of unknown function (DUF1304)

22

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5522 5 117
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5428 8 117
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5225 5 117
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5172 8 117
7jpv-assembly1.cif.gz_E rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution 0.4348 6 116
ID Description Score Start End Superfamily
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7202 5 117 1.20.120.550
af_F6NXK9_9_185_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6895 5 117 1.20.120.550
af_F4HWQ8_22_164_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.675 4 118 1.20.140.40
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6639 5 118 1.20.1280.290
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6506 5 118 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A1I3YXW7-F1-model_v4 Putative membrane protein 0.9789 1 117 GO:0016020
AF-A0A0Q8FQ75-F1-model_v4 Epimerase 0.977 1 117 GO:0016020
AF-A0A1I0VN24-F1-model_v4 Putative membrane protein 0.9733 1 118 GO:0016020
AF-A0A255HK25-F1-model_v4 DUF1304 domain-containing protein 0.9722 1 118 GO:0016020
AF-A0A1S1UAN9-F1-model_v4 Membrane protein 0.9718 3 118 GO:0016020

Map