F458038

General Info

Members Datasets Scaffolds Average Seq Length
516 284 1032 326

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0004374|Ga0495651_0004374_7313_8479
Length 388
Sequence LAPTSRRWIFGIVRAPNPPARRQRHKIFATSATLKPILEELGFDALRFVSFGGDGYNKGADLISQLKNMIIPAQIENVASLAHLDLEEEIARLKKEMNAVILAHYYQESEIQDVADFVGDSLQLSQQAATTKADVIVFAGVLFMAETAKILNPAKLVLLPDLKAGCSLADGCPAPLFKAFRERHPDHTSITYINCSAEVKALSDIICTSSNSEKIIRQIPLEKPILFAPDQHLGRFLIKKTGREMTLWPGSCIVHEMFSEKSLVQLKERHPKALVIAHPECPESVLRHADYVGSTTGILNFATHNPAMEFIVATESGILHQMIKACPEKTFISAPGEGGCSCSECPHMKLNTMEKLYLCMRDRKPEITLDEDLRQRALKPILRMLEMS

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
267 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
268 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
273 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
274 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
275 2831426010 Nostoc sp. 106C Isolate Unclassified
276 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
277 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
278 2849660919 Nostoc sp. T09 Isolate Unclassified
279 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
280 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
281 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
282 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
283 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
284 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.29
Metatranscriptomes 0.19
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 1.16
Rhizosphere 92.44
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0004374 3300046462 Bacteria 10816
2 JGI24739J22299_10023192 3300001989 Bacteria 2195
3 JGI24750J21931_1003621 3300002070 Bacteria 1855
4 JGI24748J21848_1006400 3300002074 Bacteria 1370
5 JGI24749J21850_1001483 3300002076 Bacteria 3316
6 JGI24744J21845_10010667 3300002077 Bacteria 1881
7 JGI24034J26672_10010755 3300002239 Bacteria 1365
8 JGI24751J29686_10002528 3300002459 Bacteria 3681
9 rootH2_10003346 3300003320 Bacteria 29041
10 rootH2_10046058 3300003320 Bacteria 16845
11 rootH2_10067616 3300003320 Bacteria 6643
12 Ga0065704_10073234 3300005289 Bacteria 7409
13 Ga0065712_10146915 3300005290 Bacteria 1401
14 Ga0065715_10154296 3300005293 Bacteria 1694
15 Ga0070658_10000164 3300005327 Bacteria 57701
16 Ga0070676_10000013 3300005328 Bacteria 56019
17 Ga0070676_10027122 3300005328 Bacteria 3246
18 Ga0070683_100002030 3300005329 Bacteria 15924
19 Ga0070683_100012719 3300005329 Bacteria 7319
20 Ga0070690_100000013 3300005330 Bacteria 89224
21 Ga0070690_100103975 3300005330 Bacteria 1886
22 Ga0070670_100001120 3300005331 Bacteria 21305
23 Ga0070677_10000233 3300005333 Bacteria 19293
24 Ga0068869_100001317 3300005334 Bacteria 14695
25 Ga0070666_10000499 3300005335 Bacteria 23607
26 Ga0070666_10000776 3300005335 Bacteria 19345
27 Ga0070666_10034379 3300005335 Bacteria 3359
28 Ga0068868_100000344 3300005338 Bacteria 31528
29 Ga0068868_100002099 3300005338 Bacteria 13726
30 Ga0070660_100000034 3300005339 Bacteria 78347
31 Ga0070689_100000082 3300005340 Bacteria 56097
32 Ga0070687_100000103 3300005343 Bacteria 28302
33 Ga0070661_100000576 3300005344 Bacteria 27899
34 Ga0070661_100000950 3300005344 Bacteria 20647
35 Ga0070668_100000023 3300005347 Bacteria 95415
36 Ga0070668_100000758 3300005347 Bacteria 22156
37 Ga0070669_100000182 3300005353 Bacteria 54933
38 Ga0070675_100000471 3300005354 Bacteria 27556
39 Ga0070671_100001476 3300005355 Bacteria 17566
40 Ga0070671_100011034 3300005355 Bacteria 7251
41 Ga0070674_100000097 3300005356 Bacteria 40603
42 Ga0070673_100000638 3300005364 Bacteria 19237
43 Ga0070673_100000723 3300005364 Bacteria 18243
44 Ga0070688_100000387 3300005365 Bacteria 22293
45 Ga0070659_100000171 3300005366 Bacteria 50036
46 Ga0070667_100000567 3300005367 Bacteria 36566
47 Ga0070667_100002253 3300005367 Bacteria 16975
48 Ga0070667_100007649 3300005367 Bacteria 8959
49 Ga0070709_10139870 3300005434 Bacteria 1662
50 Ga0070705_100000129 3300005440 Bacteria 44167
51 Ga0070700_100003358 3300005441 Bacteria 8256
52 Ga0070708_100000973 3300005445 Bacteria 21817
53 Ga0070708_100035170 3300005445 Bacteria 4363
54 Ga0070708_100068843 3300005445 Bacteria 3182
55 Ga0070663_100003542 3300005455 Bacteria 9016
56 Ga0070678_100000045 3300005456 Bacteria 42395
57 Ga0070662_100000461 3300005457 Bacteria 24106
58 Ga0070681_10032025 3300005458 Bacteria 5278
59 Ga0070681_10224996 3300005458 Bacteria 1791
60 Ga0068867_100001053 3300005459 Bacteria 18819
61 Ga0068867_100004752 3300005459 Bacteria 9563
62 Ga0070685_10000089 3300005466 Bacteria 55794
63 Ga0070706_100522806 3300005467 Bacteria 1104
64 Ga0070699_100006061 3300005518 Bacteria 10568
65 Ga0070699_100254594 3300005518 Bacteria 1569
66 Ga0070684_100011964 3300005535 Bacteria 6932
67 Ga0070684_100084601 3300005535 Bacteria 2812
68 Ga0070684_100100391 3300005535 Bacteria 2584
69 Ga0070697_100027233 3300005536 Bacteria 4572
70 Ga0068853_100000467 3300005539 Bacteria 27616
71 Ga0068853_100000773 3300005539 Bacteria 22203
72 Ga0068853_100007817 3300005539 Bacteria 8577
73 Ga0068853_100305408 3300005539 Bacteria 1472
74 Ga0070672_100000387 3300005543 Bacteria 25517
75 Ga0070672_100008624 3300005543 Bacteria 6984
76 Ga0070686_100000930 3300005544 Bacteria 16829
77 Ga0070695_100001358 3300005545 Bacteria 13566
78 Ga0070696_100049689 3300005546 Bacteria 2914
79 Ga0070693_100003309 3300005547 Bacteria 7490
80 Ga0070665_100000047 3300005548 Bacteria 269702
81 Ga0070665_100003580 3300005548 Bacteria 16460
82 Ga0070665_100003853 3300005548 Bacteria 15872
83 Ga0070704_100024139 3300005549 Bacteria 3986
84 Ga0068855_100000081 3300005563 Bacteria 115707
85 Ga0068855_100000442 3300005563 Bacteria 51292
86 Ga0068855_100005540 3300005563 Bacteria 15410
87 Ga0068855_100068737 3300005563 Bacteria 4123
88 Ga0070664_100001690 3300005564 Bacteria 17680
89 Ga0070664_100002008 3300005564 Bacteria 16316
90 Ga0070664_100019859 3300005564 Bacteria 5530
91 Ga0068857_100000544 3300005577 Bacteria 27429
92 Ga0068857_100010117 3300005577 Bacteria 8195
93 Ga0068857_100030312 3300005577 Bacteria 4776
94 Ga0068854_100000792 3300005578 Bacteria 18799
95 Ga0068854_100019172 3300005578 Bacteria 4606
96 Ga0068854_100100978 3300005578 Bacteria 2163
97 Ga0068856_100006451 3300005614 Bacteria 11508
98 Ga0068856_100261999 3300005614 Bacteria 1744
99 Ga0068852_100000276 3300005616 Bacteria 34230
100 Ga0068852_100014638 3300005616 Bacteria 6048
101 Ga0068852_100131262 3300005616 Bacteria 2307
102 Ga0068852_100354434 3300005616 Bacteria 1434
103 Ga0068859_100001910 3300005617 Bacteria 21248
104 Ga0068864_100000202 3300005618 Bacteria 54004
105 Ga0068864_100002278 3300005618 Bacteria 15873
106 Ga0068866_10000240 3300005718 Bacteria 25801
107 Ga0068861_100000403 3300005719 Bacteria 25022
108 Ga0068861_100011085 3300005719 Bacteria 6263
109 Ga0068851_10000249 3300005834 Bacteria 25406
110 Ga0068851_10000443 3300005834 Bacteria 18499
111 Ga0068851_10078704 3300005834 Bacteria 1718
112 Ga0068870_10000019 3300005840 Bacteria 57495
113 Ga0068863_100022359 3300005841 Bacteria 6038
114 Ga0068858_100002400 3300005842 Bacteria 18946
115 Ga0068858_100003293 3300005842 Bacteria 16079
116 Ga0068860_100000024 3300005843 Bacteria 271902
117 Ga0068860_100002030 3300005843 Bacteria 21334
118 Ga0068860_100040302 3300005843 Bacteria 4464
119 Ga0068860_100042287 3300005843 Bacteria 4353
120 Ga0068862_100000136 3300005844 Bacteria 84924
121 Ga0081540_1000062 3300005983 Bacteria 119556
122 Ga0081540_1000369 3300005983 Bacteria 45088
123 Ga0081540_1002147 3300005983 Bacteria 16397
124 Ga0097621_100000324 3300006237 Bacteria 32347
125 Ga0097621_100007351 3300006237 Bacteria 7877
126 Ga0097621_100090480 3300006237 Bacteria 2561
127 Ga0097621_100118769 3300006237 Bacteria 2241
128 Ga0068871_100000123 3300006358 Bacteria 48789
129 Ga0068871_100002682 3300006358 Bacteria 12147
130 Ga0068871_100026426 3300006358 Bacteria 4529
131 Ga0068871_100027529 3300006358 Bacteria 4448
132 Ga0068865_100000339 3300006881 Bacteria 25938
133 Ga0068865_100005069 3300006881 Bacteria 7972
134 Ga0097620_100001910 3300006931 Bacteria 21248
135 Ga0099794_10000023 3300007265 Bacteria 65487
136 Ga0099794_10009742 3300007265 Bacteria 4054
137 Ga0099794_10023238 3300007265 Bacteria 2833
138 Ga0105250_10034654 3300009092 Bacteria 2026
139 Ga0105240_10000597 3300009093 Bacteria 67036
140 Ga0105240_10003084 3300009093 Bacteria 26189
141 Ga0105240_10003774 3300009093 Bacteria 23401
142 Ga0105240_10008074 3300009093 Bacteria 15126
143 Ga0105240_10046896 3300009093 Bacteria 5471
144 Ga0105240_10055754 3300009093 Bacteria 4947
145 Ga0105240_10112492 3300009093 Bacteria 3291
146 Ga0105240_10497148 3300009093 Bacteria 1357
147 Ga0111539_10141598 3300009094 Bacteria 2815
148 Ga0105245_10000080 3300009098 Bacteria 98140
149 Ga0105245_10053947 3300009098 Bacteria 3610
150 Ga0105247_10000071 3300009101 Bacteria 114212
151 Ga0105247_10032071 3300009101 Bacteria 3191
152 Ga0114129_10200758 3300009147 Bacteria 2701
153 Ga0105243_10082344 3300009148 Bacteria 2630
154 Ga0105241_10000180 3300009174 Bacteria 47089
155 Ga0105241_10001140 3300009174 Bacteria 20229
156 Ga0105241_10129365 3300009174 Bacteria 2042
157 Ga0105242_10001783 3300009176 Bacteria 16993
158 Ga0105242_10010687 3300009176 Bacteria 7047
159 Ga0105248_10001128 3300009177 Bacteria 29704
160 Ga0105248_10074274 3300009177 Bacteria 3822
161 Ga0105248_10130660 3300009177 Bacteria 2833
162 Ga0105248_10491114 3300009177 Bacteria 1384
163 Ga0105237_10000294 3300009545 Bacteria 69126
164 Ga0105237_10001089 3300009545 Bacteria 36353
165 Ga0105237_10014556 3300009545 Bacteria 8220
166 Ga0105237_10034587 3300009545 Bacteria 5116
167 Ga0105238_10004020 3300009551 Bacteria 14587
168 Ga0105238_10033455 3300009551 Bacteria 5233
169 Ga0105238_10090640 3300009551 Bacteria 3045
170 Ga0105249_10000140 3300009553 Bacteria 92898
171 Ga0105249_10003687 3300009553 Bacteria 13204
172 Ga0099796_10080654 3300010159 Bacteria 1192
173 Ga0099796_10084720 3300010159 Unclassified 1168
174 Ga0105239_10000763 3300010375 Bacteria 45441
175 Ga0105239_10015716 3300010375 Bacteria 8378
176 Ga0105239_10046601 3300010375 Bacteria 4750
177 Ga0105239_10055267 3300010375 Bacteria 4354
178 Ga0105239_10116238 3300010375 Bacteria 2968
179 Ga0105239_10752765 3300010375 Bacteria 1115
180 Ga0105246_10000245 3300011119 Bacteria 27947
181 Ga0157373_10010419 3300013100 Bacteria 6838
182 Ga0157373_10062892 3300013100 Bacteria 2629
183 Ga0157371_10000182 3300013102 Bacteria 92464
184 Ga0157370_10008189 3300013104 Bacteria 11297
185 Ga0157369_10000331 3300013105 Bacteria 63157
186 Ga0157369_10016403 3300013105 Bacteria 8332
187 Ga0157374_10000027 3300013296 Bacteria 233444
188 Ga0157374_10000198 3300013296 Bacteria 55701
189 Ga0157374_10001051 3300013296 Bacteria 23998
190 Ga0157374_10076347 3300013296 Bacteria 3168
191 Ga0157374_10272286 3300013296 Bacteria 1670
192 Ga0157374_10631665 3300013296 Bacteria 1082
193 Ga0157378_10000376 3300013297 Bacteria 44193
194 Ga0157378_10002556 3300013297 Bacteria 16179
195 Ga0157378_10024140 3300013297 Bacteria 5349
196 Ga0157378_10125242 3300013297 Bacteria 2373
197 Ga0163162_10000096 3300013306 Bacteria 80090
198 Ga0163162_10000237 3300013306 Bacteria 50279
199 Ga0163162_10000319 3300013306 Bacteria 44269
200 Ga0163162_10003261 3300013306 Bacteria 15526
201 Ga0163162_10045121 3300013306 Bacteria 4415
202 Ga0163162_10761518 3300013306 Bacteria 1087
203 Ga0157372_10001014 3300013307 Bacteria 30731
204 Ga0157372_10041822 3300013307 Bacteria 5067
205 Ga0157372_10061457 3300013307 Bacteria 4207
206 Ga0157372_10494141 3300013307 Bacteria 1427
207 Ga0157375_10000622 3300013308 Bacteria 31461
208 Ga0157375_10030551 3300013308 Bacteria 5081
209 Ga0157375_10052281 3300013308 Bacteria 4015
210 Ga0157375_10059664 3300013308 Bacteria 3780
211 Ga0163163_10000251 3300014325 Bacteria 54526
212 Ga0163163_10005158 3300014325 Bacteria 11266
213 Ga0163163_10378964 3300014325 Bacteria 1472
214 Ga0157380_10066816 3300014326 Bacteria 2893
215 Ga0157377_10001578 3300014745 Bacteria 9913
216 Ga0157379_10000081 3300014968 Bacteria 62822
217 Ga0157379_10000128 3300014968 Bacteria 53403
218 Ga0157379_10002064 3300014968 Bacteria 16687
219 Ga0157379_10085596 3300014968 Bacteria 2825
220 Ga0157376_10000165 3300014969 Bacteria 46348
221 Ga0157376_10000334 3300014969 Bacteria 31383
222 Ga0157376_10001989 3300014969 Bacteria 13679
223 Ga0157376_10037017 3300014969 Bacteria 3956
224 Ga0157376_10120685 3300014969 Bacteria 2322
225 Ga0157376_10179624 3300014969 Bacteria 1933
226 Ga0157376_10213824 3300014969 Bacteria 1782
227 Ga0182005_1000097 3300015265 Bacteria 66720
228 Ga0163161_10006338 3300017792 Bacteria 8189
229 Ga0163161_10026432 3300017792 Bacteria 4111
230 Ga0163161_10205302 3300017792 Unclassified 1520
231 Ga0206352_11216719 3300020078 Bacteria 1217
232 Ga0209436_102701 3300025208 Bacteria 5125
233 Ga0207697_10002709 3300025315 Bacteria 9054
234 Ga0207656_10000254 3300025321 Bacteria 18527
235 Ga0207656_10006738 3300025321 Bacteria 4150
236 Ga0207656_10057327 3300025321 Bacteria 1699
237 Ga0207682_10000014 3300025893 Bacteria 82425
238 Ga0207642_10000305 3300025899 Bacteria 14737
239 Ga0207710_10001120 3300025900 Bacteria 13671
240 Ga0207688_10000005 3300025901 Bacteria 63715
241 Ga0207680_10000066 3300025903 Bacteria 47477
242 Ga0207680_10001638 3300025903 Bacteria 10590
243 Ga0207680_10025781 3300025903 Bacteria 3247
244 Ga0207647_10001952 3300025904 Bacteria 15741
245 Ga0207647_10011828 3300025904 Bacteria 6100
246 Ga0207699_10011335 3300025906 Bacteria 4498
247 Ga0207645_10000008 3300025907 Bacteria 158682
248 Ga0207645_10002042 3300025907 Bacteria 16200
249 Ga0207643_10000008 3300025908 Bacteria 163521
250 Ga0207705_10030006 3300025909 Bacteria 3879
251 Ga0207705_10080519 3300025909 Bacteria 2373
252 Ga0207654_10005936 3300025911 Bacteria 6146
253 Ga0207654_10011226 3300025911 Bacteria 4566
254 Ga0207654_10054822 3300025911 Bacteria 2305
255 Ga0207654_10082278 3300025911 Unclassified 1941
256 Ga0207707_10024010 3300025912 Bacteria 5331
257 Ga0207695_10000087 3300025913 Bacteria 276412
258 Ga0207695_10000299 3300025913 Bacteria 122118
259 Ga0207695_10000676 3300025913 Bacteria 67018
260 Ga0207695_10001116 3300025913 Bacteria 46659
261 Ga0207695_10017055 3300025913 Bacteria 8469
262 Ga0207695_10033494 3300025913 Bacteria 5601
263 Ga0207695_10039641 3300025913 Bacteria 5061
264 Ga0207695_10040923 3300025913 Bacteria 4964
265 Ga0207671_10000533 3300025914 Bacteria 51330
266 Ga0207671_10001227 3300025914 Bacteria 30346
267 Ga0207671_10002751 3300025914 Bacteria 18363
268 Ga0207671_10010807 3300025914 Bacteria 7489
269 Ga0207662_10000012 3300025918 Bacteria 90502
270 Ga0207662_10028104 3300025918 Bacteria 3249
271 Ga0207657_10000069 3300025919 Bacteria 95262
272 Ga0207649_10000703 3300025920 Bacteria 21942
273 Ga0207649_10011623 3300025920 Bacteria 4861
274 Ga0207681_10000622 3300025923 Bacteria 23679
275 Ga0207694_10001824 3300025924 Bacteria 17737
276 Ga0207650_10000599 3300025925 Bacteria 28869
277 Ga0207659_10000053 3300025926 Bacteria 78612
278 Ga0207687_10004318 3300025927 Bacteria 9489
279 Ga0207644_10000349 3300025931 Bacteria 29986
280 Ga0207644_10002466 3300025931 Bacteria 11934
281 Ga0207690_10001515 3300025932 Bacteria 14536
282 Ga0207706_10000087 3300025933 Bacteria 95262
283 Ga0207706_10008833 3300025933 Bacteria 9273
284 Ga0207686_10058957 3300025934 Bacteria 2423
285 Ga0207709_10020162 3300025935 Bacteria 3758
286 Ga0207670_10000151 3300025936 Bacteria 45835
287 Ga0207669_10000094 3300025937 Bacteria 45389
288 Ga0207704_10000170 3300025938 Bacteria 34383
289 Ga0207704_10003892 3300025938 Bacteria 6787
290 Ga0207691_10000048 3300025940 Bacteria 95495
291 Ga0207691_10000057 3300025940 Bacteria 89823
292 Ga0207711_10000280 3300025941 Bacteria 55024
293 Ga0207711_10088039 3300025941 Bacteria 2726
294 Ga0207689_10000035 3300025942 Bacteria 95241
295 Ga0207689_10127068 3300025942 Bacteria 2097
296 Ga0207661_10001638 3300025944 Bacteria 15253
297 Ga0207661_10070942 3300025944 Bacteria 2845
298 Ga0207679_10000219 3300025945 Bacteria 45129
299 Ga0207679_10001423 3300025945 Bacteria 15053
300 Ga0207667_10000172 3300025949 Bacteria 95455
301 Ga0207667_10012663 3300025949 Bacteria 9692
302 Ga0207667_10024315 3300025949 Bacteria 6652
303 Ga0207667_10323803 3300025949 Bacteria 1574
304 Ga0207651_10000039 3300025960 Bacteria 62741
305 Ga0207651_10002355 3300025960 Bacteria 9016
306 Ga0207712_10000385 3300025961 Bacteria 38366
307 Ga0207712_10068894 3300025961 Bacteria 2537
308 Ga0207668_10000549 3300025972 Bacteria 23585
309 Ga0207668_10000736 3300025972 Bacteria 20067
310 Ga0207640_10000180 3300025981 Bacteria 45856
311 Ga0207658_10000259 3300025986 Bacteria 55319
312 Ga0207658_10047654 3300025986 Bacteria 3137
313 Ga0207677_10000068 3300026023 Bacteria 86534
314 Ga0207677_10001248 3300026023 Bacteria 13696
315 Ga0207677_10275815 3300026023 Bacteria 1378
316 Ga0207703_10000106 3300026035 Bacteria 99033
317 Ga0207703_10008189 3300026035 Bacteria 8259
318 Ga0207639_10000268 3300026041 Bacteria 37276
319 Ga0207639_10028088 3300026041 Bacteria 4104
320 Ga0207639_10171618 3300026041 Bacteria 1837
321 Ga0207678_10003807 3300026067 Bacteria 13574
322 Ga0207708_10004366 3300026075 Bacteria 10418
323 Ga0207702_10001628 3300026078 Bacteria 22210
324 Ga0207641_10000528 3300026088 Bacteria 42770
325 Ga0207641_10026227 3300026088 Bacteria 4808
326 Ga0207648_10000070 3300026089 Bacteria 95262
327 Ga0207648_10006154 3300026089 Bacteria 11957
328 Ga0207676_10000158 3300026095 Bacteria 59247
329 Ga0207676_10003529 3300026095 Bacteria 11071
330 Ga0207674_10000377 3300026116 Bacteria 58008
331 Ga0207674_10002816 3300026116 Bacteria 21618
332 Ga0207674_10301601 3300026116 Bacteria 1551
333 Ga0207675_100000008 3300026118 Bacteria 182355
334 Ga0207675_100061332 3300026118 Bacteria 3511
335 Ga0207683_10000094 3300026121 Bacteria 72088
336 Ga0207698_10001120 3300026142 Bacteria 15608
337 Ga0207698_10010755 3300026142 Bacteria 5904
338 Ga0207698_10171953 3300026142 Bacteria 1909
339 Ga0209588_1000007 3300027671 Bacteria 183924
340 Ga0209588_1004490 3300027671 Bacteria 3941
341 Ga0268266_10000048 3300028379 Bacteria 310336
342 Ga0268266_10000223 3300028379 Bacteria 98692
343 Ga0268266_10041316 3300028379 Bacteria 3934
344 Ga0268265_10000130 3300028380 Bacteria 95720
345 Ga0268264_10000028 3300028381 Bacteria 426662
346 Ga0268264_10000460 3300028381 Bacteria 55265
347 Ga0268264_10009031 3300028381 Bacteria 8270
348 Ga0268264_10033050 3300028381 Bacteria 4247
349 Ga0265337_1011124 3300028556 Bacteria 3116
350 Ga0265326_10033099 3300028558 Bacteria 1472
351 Ga0265319_1007536 3300028563 Bacteria 4879
352 Ga0265319_1020370 3300028563 Bacteria 2460
353 Ga0265334_10013585 3300028573 Bacteria 3407
354 Ga0265318_10000420 3300028577 Bacteria 32662
355 Ga0265318_10021615 3300028577 Bacteria 2581
356 Ga0265322_10001006 3300028654 Bacteria 9795
357 Ga0265322_10031801 3300028654 Bacteria 1506
358 Ga0265336_10000361 3300028666 Bacteria 29382
359 Ga0265338_10000236 3300028800 Bacteria 102289
360 Ga0265338_10012938 3300028800 Bacteria 9472
361 Ga0265338_10021556 3300028800 Bacteria 6712
362 Ga0265338_10144743 3300028800 Bacteria 1856
363 Ga0265324_10013100 3300029957 Bacteria 3103
364 Ga0307511_10000002 3300030521 Bacteria 199923
365 Ga0265330_10011813 3300031235 Bacteria 4090
366 Ga0265320_10001344 3300031240 Bacteria 17925
367 Ga0265320_10019284 3300031240 Bacteria 3733
368 Ga0265325_10010159 3300031241 Bacteria 5464
369 Ga0265329_10000405 3300031242 Bacteria 22560
370 Ga0265340_10005907 3300031247 Bacteria 6767
371 Ga0265340_10006829 3300031247 Bacteria 6244
372 Ga0265339_10015401 3300031249 Bacteria 4583
373 Ga0265331_10000317 3300031250 Bacteria 52403
374 Ga0265331_10022701 3300031250 Bacteria 3199
375 Ga0265316_10002192 3300031344 Bacteria 20520
376 Ga0265313_10002537 3300031595 Bacteria 15655
377 Ga0265313_10005256 3300031595 Bacteria 9587
378 Ga0265313_10017313 3300031595 Bacteria 4101
379 Ga0265314_10020043 3300031711 Bacteria 5168
380 Ga0265314_10078757 3300031711 Bacteria 2181
381 Ga0265342_10001004 3300031712 Bacteria 27819
382 Ga0265342_10002665 3300031712 Bacteria 15227
383 Ga0316578_10021223 3300031728 Bacteria 3602
384 Ga0316583_10022967 3300032133 Bacteria 2231
385 Ga0316583_10045271 3300032133 Bacteria 1554
386 Ga0307510_10012045 3300033180 Bacteria 10250
387 Ga0373923_0046943 3300035111 Bacteria 1798
388 Ga0373954_0013229 3300035118 Bacteria 3676
389 Ga0373955_0059977 3300035172 Bacteria 2097
390 Ga0373935_0001403 3300035692 Bacteria 13340
391 Ga0373927_0002514 3300035695 Bacteria 13368
392 Ga0373947_0016689 3300035725 Bacteria 4219
393 Ga0316584_0010433 3300036712 Bacteria 6490
394 Ga0316584_0084400 3300036712 Bacteria 2379
395 Ga0316584_0151052 3300036712 Bacteria 1729
396 Ga0395899_0095408 3300037312 Bacteria 2152
397 Ga0395900_0035714 3300037418 Bacteria 5121
398 Ga0436364_1286780 3300037853 Bacteria 1878
399 Ga0400489_36227 3300039093 Bacteria 7843
400 Ga0400489_37216 3300039093 Bacteria 1914
401 Ga0436363_0229258 3300039450 Bacteria 1523
402 Ga0436363_1514370 3300039450 Bacteria 1379
403 Ga0439448_0003668 3300042005 Bacteria 4273
404 Ga0451577_0004211 3300042876 Bacteria 15341
405 Ga0451577_0082310 3300042876 Bacteria 2871
406 Ga0451577_0152394 3300042876 Bacteria 2080
407 Ga0451577_0314673 3300042876 Bacteria 1419
408 Ga0466972_0002341 3300044658 Bacteria 9336
409 Ga0453683_0003721 3300044673 Bacteria 11134
410 Ga0453683_0041748 3300044673 Bacteria 2880
411 Ga0453683_0196571 3300044673 Bacteria 1280
412 Ga0453683_0225236 3300044673 Bacteria 1193
413 Ga0453684_0009317 3300044712 Bacteria 17227
414 Ga0453684_0017590 3300044712 Bacteria 11057
415 Ga0453684_0048503 3300044712 Bacteria 5614
416 Ga0453684_0180049 3300044712 Bacteria 2482
417 Ga0453684_0197238 3300044712 Bacteria 2349
418 Ga0466957_0070575 3300044842 Bacteria 2159
419 Ga0451576_0000002 3300045051 Bacteria 1670975
420 Ga0451576_0002178 3300045051 Bacteria 30301
421 Ga0451576_0048211 3300045051 Bacteria 4476
422 Ga0451576_0431050 3300045051 Bacteria 1384
423 Ga0451576_0534849 3300045051 Bacteria 1231
424 Ga0451576_0576875 3300045051 Bacteria 1182
425 Ga0495592_0100758 3300046454 Bacteria 2059
426 Ga0495651_0000127 3300046462 Bacteria 56328
427 Ga0495651_0005211 3300046462 Bacteria 9909
428 Ga0495653_0030027 3300046463 Bacteria 4333
429 Ga0495653_0060640 3300046463 Bacteria 2865
430 Ga0495580_0001662 3300046472 Bacteria 19545
431 Ga0495580_0027062 3300046472 Bacteria 4176
432 Ga0495580_0114380 3300046472 Bacteria 1874
433 Ga0495664_0088017 3300046477 Bacteria 1866
434 Ga0495606_0004864 3300046507 Bacteria 13165
435 Ga0495608_0001877 3300046511 Bacteria 15029
436 Ga0495608_0069366 3300046511 Bacteria 2303
437 Ga0495618_0027527 3300046514 Bacteria 3538
438 Ga0495628_0001109 3300046516 Bacteria 24593
439 Ga0495628_0012391 3300046516 Bacteria 7192
440 Ga0495628_0025257 3300046516 Bacteria 4854
441 Ga0495630_0023205 3300046517 Bacteria 4585
442 Ga0495648_0000701 3300046524 Bacteria 35793
443 Ga0495652_0007654 3300046529 Bacteria 9950
444 Ga0495665_0093934 3300046531 Bacteria 1576
445 Ga0495586_0101946 3300046535 Bacteria 1593
446 Ga0495587_0003590 3300046536 Bacteria 10328
447 Ga0495587_0053048 3300046536 Bacteria 2391
448 Ga0495633_0017512 3300046558 Bacteria 3661
449 Ga0495667_0000451 3300046559 Bacteria 26238
450 Ga0495667_0001930 3300046559 Bacteria 13712
451 Ga0495667_0066565 3300046559 Bacteria 2355
452 Ga0495611_0000065 3300046648 Bacteria 74332
453 Ga0495635_0005842 3300046663 Bacteria 8575
454 Ga0495599_0012506 3300046678 Bacteria 5234
455 Ga0495599_0111920 3300046678 Bacteria 1700
456 Ga0495623_0002676 3300046679 Bacteria 11754
457 Ga0495646_0000751 3300046680 Bacteria 18090
458 Ga0495646_0015244 3300046680 Bacteria 4881
459 Ga0495613_0044237 3300046689 Bacteria 3295
460 Ga0495624_0004561 3300046690 Bacteria 10113
461 Ga0495624_0146556 3300046690 Bacteria 1445
462 Ga0495600_0000959 3300046809 Bacteria 15517
463 Ga0495600_0028503 3300046809 Bacteria 3613
464 Ga0495600_0138583 3300046809 Bacteria 1579
465 Ga0495604_0000857 3300047317 Bacteria 25393
466 Ga0495604_0002268 3300047317 Bacteria 15394
467 Ga0495674_0011501 3300047319 Bacteria 8348
468 Ga0495672_0037062 3300047320 Bacteria 2988
469 Ga0495676_0164235 3300047321 Bacteria 1568
470 Ga0495680_0002221 3300047322 Bacteria 20023
471 Ga0495680_0015197 3300047322 Bacteria 6648
472 Ga0495687_000129 3300047443 Bacteria 116030
473 Ga0495675_0000313 3300047444 Bacteria 34765
474 Ga0495675_0000790 3300047444 Bacteria 19549
475 Ga0495684_0032315 3300047471 Bacteria 4017
476 Ga0495686_0000005 3300047472 Bacteria 827143
477 Ga0495593_0010020 3300047673 Bacteria 5492
478 Ga0495602_0032510 3300048088 Unclassified 4910
479 Ga0495602_0151002 3300048088 Bacteria 1826
480 Ga0495614_0007340 3300048089 Bacteria 4908
481 Ga0496101_0008727 3300048904 Bacteria 6628
482 Ga0496106_0002399 3300048909 Bacteria 13958
483 Ga0496108_0058499 3300048911 Bacteria 3240
484 Ga0496109_0003584 3300048912 Bacteria 12961
485 Ga0496109_0064707 3300048912 Bacteria 3347
486 Ga0496112_0000116 3300048915 Bacteria 49388
487 Ga0496120_0126022 3300048923 Bacteria 1318
488 Ga0496121_0000081 3300048924 Bacteria 229506
489 Ga0501034_0029989 3300049571 Bacteria 5529
490 Ga0501038_0140248 3300049574 Bacteria 1978
491 nmdc:mga0k408_114746_c1 3300050493 Bacteria 1593
492 nmdc:mga05p37_10231_c1 3300050507 Bacteria 11139
493 nmdc:mga05p37_172801_c1 3300050507 Bacteria 2634
494 nmdc:mga08y16_112477_c1 3300050511 Bacteria 2834
495 nmdc:mga0rr50_252009_c1 3300050513 Bacteria 1466
496 Ga0495612_0066308 3300053078 Bacteria 1500
497 Ga0500643_015402 3300053087 Bacteria 2624
498 Ga0500646_0004054 3300053090 Bacteria 3720
499 Ga0500583_0003120 3300053092 Bacteria 5135
500 Ga0500568_0008557 3300053139 Bacteria 4922
501 Ga0500616_0008355 3300053153 Bacteria 6442
502 Ga0500622_0000904 3300053156 Bacteria 25254
503 Ga0500622_0006015 3300053156 Bacteria 7129
504 2617917613 2617270889 Bacteria 9064343
505 2819574955 2818991442 Bacteria 8318214
506 2821141051 2821136567 Bacteria 8080116
507 2831429118 2831426010 Bacteria 8662725
508 2840678841 2840677318 Bacteria 2664183
509 2848696241 2848694841 Bacteria 9205737
510 2849664938 2849660919 Bacteria 8251853
511 2896086658 2896085136 Bacteria 6129793
512 2896113027 2896109856 Bacteria 7140722
513 2904471552 2904467357 Bacteria 8057758
514 2913851900 2913844669 Bacteria 8381711
515 2913940377 2913939268 Bacteria 8559644
516 642605353 642555144 Bacteria 9059191
517 Ga0495651_0004374
518 JGI24739J22299_10023192
519 JGI24750J21931_1003621
520 JGI24748J21848_1006400
521 JGI24749J21850_1001483
522 JGI24744J21845_10010667
523 JGI24034J26672_10010755
524 JGI24751J29686_10002528
525 rootH2_10003346
526 rootH2_10046058
527 rootH2_10067616
528 Ga0065704_10073234
529 Ga0065712_10146915
530 Ga0065715_10154296
531 Ga0070658_10000164
532 Ga0070676_10000013
533 Ga0070676_10027122
534 Ga0070683_100002030
535 Ga0070683_100012719
536 Ga0070690_100000013
537 Ga0070690_100103975
538 Ga0070670_100001120
539 Ga0070677_10000233
540 Ga0068869_100001317
541 Ga0070666_10000499
542 Ga0070666_10000776
543 Ga0070666_10034379
544 Ga0068868_100000344
545 Ga0068868_100002099
546 Ga0070660_100000034
547 Ga0070689_100000082
548 Ga0070687_100000103
549 Ga0070661_100000576
550 Ga0070661_100000950
551 Ga0070668_100000023
552 Ga0070668_100000758
553 Ga0070669_100000182
554 Ga0070675_100000471
555 Ga0070671_100001476
556 Ga0070671_100011034
557 Ga0070674_100000097
558 Ga0070673_100000638
559 Ga0070673_100000723
560 Ga0070688_100000387
561 Ga0070659_100000171
562 Ga0070667_100000567
563 Ga0070667_100002253
564 Ga0070667_100007649
565 Ga0070709_10139870
566 Ga0070705_100000129
567 Ga0070700_100003358
568 Ga0070708_100000973
569 Ga0070708_100035170
570 Ga0070708_100068843
571 Ga0070663_100003542
572 Ga0070678_100000045
573 Ga0070662_100000461
574 Ga0070681_10032025
575 Ga0070681_10224996
576 Ga0068867_100001053
577 Ga0068867_100004752
578 Ga0070685_10000089
579 Ga0070706_100522806
580 Ga0070699_100006061
581 Ga0070699_100254594
582 Ga0070684_100011964
583 Ga0070684_100084601
584 Ga0070684_100100391
585 Ga0070697_100027233
586 Ga0068853_100000467
587 Ga0068853_100000773
588 Ga0068853_100007817
589 Ga0068853_100305408
590 Ga0070672_100000387
591 Ga0070672_100008624
592 Ga0070686_100000930
593 Ga0070695_100001358
594 Ga0070696_100049689
595 Ga0070693_100003309
596 Ga0070665_100000047
597 Ga0070665_100003580
598 Ga0070665_100003853
599 Ga0070704_100024139
600 Ga0068855_100000081
601 Ga0068855_100000442
602 Ga0068855_100005540
603 Ga0068855_100068737
604 Ga0070664_100001690
605 Ga0070664_100002008
606 Ga0070664_100019859
607 Ga0068857_100000544
608 Ga0068857_100010117
609 Ga0068857_100030312
610 Ga0068854_100000792
611 Ga0068854_100019172
612 Ga0068854_100100978
613 Ga0068856_100006451
614 Ga0068856_100261999
615 Ga0068852_100000276
616 Ga0068852_100014638
617 Ga0068852_100131262
618 Ga0068852_100354434
619 Ga0068859_100001910
620 Ga0068864_100000202
621 Ga0068864_100002278
622 Ga0068866_10000240
623 Ga0068861_100000403
624 Ga0068861_100011085
625 Ga0068851_10000249
626 Ga0068851_10000443
627 Ga0068851_10078704
628 Ga0068870_10000019
629 Ga0068863_100022359
630 Ga0068858_100002400
631 Ga0068858_100003293
632 Ga0068860_100000024
633 Ga0068860_100002030
634 Ga0068860_100040302
635 Ga0068860_100042287
636 Ga0068862_100000136
637 Ga0081540_1000062
638 Ga0081540_1000369
639 Ga0081540_1002147
640 Ga0097621_100000324
641 Ga0097621_100007351
642 Ga0097621_100090480
643 Ga0097621_100118769
644 Ga0068871_100000123
645 Ga0068871_100002682
646 Ga0068871_100026426
647 Ga0068871_100027529
648 Ga0068865_100000339
649 Ga0068865_100005069
650 Ga0097620_100001910
651 Ga0099794_10000023
652 Ga0099794_10009742
653 Ga0099794_10023238
654 Ga0105250_10034654
655 Ga0105240_10000597
656 Ga0105240_10003084
657 Ga0105240_10003774
658 Ga0105240_10008074
659 Ga0105240_10046896
660 Ga0105240_10055754
661 Ga0105240_10112492
662 Ga0105240_10497148
663 Ga0111539_10141598
664 Ga0105245_10000080
665 Ga0105245_10053947
666 Ga0105247_10000071
667 Ga0105247_10032071
668 Ga0114129_10200758
669 Ga0105243_10082344
670 Ga0105241_10000180
671 Ga0105241_10001140
672 Ga0105241_10129365
673 Ga0105242_10001783
674 Ga0105242_10010687
675 Ga0105248_10001128
676 Ga0105248_10074274
677 Ga0105248_10130660
678 Ga0105248_10491114
679 Ga0105237_10000294
680 Ga0105237_10001089
681 Ga0105237_10014556
682 Ga0105237_10034587
683 Ga0105238_10004020
684 Ga0105238_10033455
685 Ga0105238_10090640
686 Ga0105249_10000140
687 Ga0105249_10003687
688 Ga0099796_10080654
689 Ga0099796_10084720
690 Ga0105239_10000763
691 Ga0105239_10015716
692 Ga0105239_10046601
693 Ga0105239_10055267
694 Ga0105239_10116238
695 Ga0105239_10752765
696 Ga0105246_10000245
697 Ga0157373_10010419
698 Ga0157373_10062892
699 Ga0157371_10000182
700 Ga0157370_10008189
701 Ga0157369_10000331
702 Ga0157369_10016403
703 Ga0157374_10000027
704 Ga0157374_10000198
705 Ga0157374_10001051
706 Ga0157374_10076347
707 Ga0157374_10272286
708 Ga0157374_10631665
709 Ga0157378_10000376
710 Ga0157378_10002556
711 Ga0157378_10024140
712 Ga0157378_10125242
713 Ga0163162_10000096
714 Ga0163162_10000237
715 Ga0163162_10000319
716 Ga0163162_10003261
717 Ga0163162_10045121
718 Ga0163162_10761518
719 Ga0157372_10001014
720 Ga0157372_10041822
721 Ga0157372_10061457
722 Ga0157372_10494141
723 Ga0157375_10000622
724 Ga0157375_10030551
725 Ga0157375_10052281
726 Ga0157375_10059664
727 Ga0163163_10000251
728 Ga0163163_10005158
729 Ga0163163_10378964
730 Ga0157380_10066816
731 Ga0157377_10001578
732 Ga0157379_10000081
733 Ga0157379_10000128
734 Ga0157379_10002064
735 Ga0157379_10085596
736 Ga0157376_10000165
737 Ga0157376_10000334
738 Ga0157376_10001989
739 Ga0157376_10037017
740 Ga0157376_10120685
741 Ga0157376_10179624
742 Ga0157376_10213824
743 Ga0182005_1000097
744 Ga0163161_10006338
745 Ga0163161_10026432
746 Ga0163161_10205302
747 Ga0206352_11216719
748 Ga0209436_102701
749 Ga0207697_10002709
750 Ga0207656_10000254
751 Ga0207656_10006738
752 Ga0207656_10057327
753 Ga0207682_10000014
754 Ga0207642_10000305
755 Ga0207710_10001120
756 Ga0207688_10000005
757 Ga0207680_10000066
758 Ga0207680_10001638
759 Ga0207680_10025781
760 Ga0207647_10001952
761 Ga0207647_10011828
762 Ga0207699_10011335
763 Ga0207645_10000008
764 Ga0207645_10002042
765 Ga0207643_10000008
766 Ga0207705_10030006
767 Ga0207705_10080519
768 Ga0207654_10005936
769 Ga0207654_10011226
770 Ga0207654_10054822
771 Ga0207654_10082278
772 Ga0207707_10024010
773 Ga0207695_10000087
774 Ga0207695_10000299
775 Ga0207695_10000676
776 Ga0207695_10001116
777 Ga0207695_10017055
778 Ga0207695_10033494
779 Ga0207695_10039641
780 Ga0207695_10040923
781 Ga0207671_10000533
782 Ga0207671_10001227
783 Ga0207671_10002751
784 Ga0207671_10010807
785 Ga0207662_10000012
786 Ga0207662_10028104
787 Ga0207657_10000069
788 Ga0207649_10000703
789 Ga0207649_10011623
790 Ga0207681_10000622
791 Ga0207694_10001824
792 Ga0207650_10000599
793 Ga0207659_10000053
794 Ga0207687_10004318
795 Ga0207644_10000349
796 Ga0207644_10002466
797 Ga0207690_10001515
798 Ga0207706_10000087
799 Ga0207706_10008833
800 Ga0207686_10058957
801 Ga0207709_10020162
802 Ga0207670_10000151
803 Ga0207669_10000094
804 Ga0207704_10000170
805 Ga0207704_10003892
806 Ga0207691_10000048
807 Ga0207691_10000057
808 Ga0207711_10000280
809 Ga0207711_10088039
810 Ga0207689_10000035
811 Ga0207689_10127068
812 Ga0207661_10001638
813 Ga0207661_10070942
814 Ga0207679_10000219
815 Ga0207679_10001423
816 Ga0207667_10000172
817 Ga0207667_10012663
818 Ga0207667_10024315
819 Ga0207667_10323803
820 Ga0207651_10000039
821 Ga0207651_10002355
822 Ga0207712_10000385
823 Ga0207712_10068894
824 Ga0207668_10000549
825 Ga0207668_10000736
826 Ga0207640_10000180
827 Ga0207658_10000259
828 Ga0207658_10047654
829 Ga0207677_10000068
830 Ga0207677_10001248
831 Ga0207677_10275815
832 Ga0207703_10000106
833 Ga0207703_10008189
834 Ga0207639_10000268
835 Ga0207639_10028088
836 Ga0207639_10171618
837 Ga0207678_10003807
838 Ga0207708_10004366
839 Ga0207702_10001628
840 Ga0207641_10000528
841 Ga0207641_10026227
842 Ga0207648_10000070
843 Ga0207648_10006154
844 Ga0207676_10000158
845 Ga0207676_10003529
846 Ga0207674_10000377
847 Ga0207674_10002816
848 Ga0207674_10301601
849 Ga0207675_100000008
850 Ga0207675_100061332
851 Ga0207683_10000094
852 Ga0207698_10001120
853 Ga0207698_10010755
854 Ga0207698_10171953
855 Ga0209588_1000007
856 Ga0209588_1004490
857 Ga0268266_10000048
858 Ga0268266_10000223
859 Ga0268266_10041316
860 Ga0268265_10000130
861 Ga0268264_10000028
862 Ga0268264_10000460
863 Ga0268264_10009031
864 Ga0268264_10033050
865 Ga0265337_1011124
866 Ga0265326_10033099
867 Ga0265319_1007536
868 Ga0265319_1020370
869 Ga0265334_10013585
870 Ga0265318_10000420
871 Ga0265318_10021615
872 Ga0265322_10001006
873 Ga0265322_10031801
874 Ga0265336_10000361
875 Ga0265338_10000236
876 Ga0265338_10012938
877 Ga0265338_10021556
878 Ga0265338_10144743
879 Ga0265324_10013100
880 Ga0307511_10000002
881 Ga0265330_10011813
882 Ga0265320_10001344
883 Ga0265320_10019284
884 Ga0265325_10010159
885 Ga0265329_10000405
886 Ga0265340_10005907
887 Ga0265340_10006829
888 Ga0265339_10015401
889 Ga0265331_10000317
890 Ga0265331_10022701
891 Ga0265316_10002192
892 Ga0265313_10002537
893 Ga0265313_10005256
894 Ga0265313_10017313
895 Ga0265314_10020043
896 Ga0265314_10078757
897 Ga0265342_10001004
898 Ga0265342_10002665
899 Ga0316578_10021223
900 Ga0316583_10022967
901 Ga0316583_10045271
902 Ga0307510_10012045
903 Ga0373923_0046943
904 Ga0373954_0013229
905 Ga0373955_0059977
906 Ga0373935_0001403
907 Ga0373927_0002514
908 Ga0373947_0016689
909 Ga0316584_0010433
910 Ga0316584_0084400
911 Ga0316584_0151052
912 Ga0395899_0095408
913 Ga0395900_0035714
914 Ga0436364_1286780
915 Ga0400489_36227
916 Ga0400489_37216
917 Ga0436363_0229258
918 Ga0436363_1514370
919 Ga0439448_0003668
920 Ga0451577_0004211
921 Ga0451577_0082310
922 Ga0451577_0152394
923 Ga0451577_0314673
924 Ga0466972_0002341
925 Ga0453683_0003721
926 Ga0453683_0041748
927 Ga0453683_0196571
928 Ga0453683_0225236
929 Ga0453684_0009317
930 Ga0453684_0017590
931 Ga0453684_0048503
932 Ga0453684_0180049
933 Ga0453684_0197238
934 Ga0466957_0070575
935 Ga0451576_0000002
936 Ga0451576_0002178
937 Ga0451576_0048211
938 Ga0451576_0431050
939 Ga0451576_0534849
940 Ga0451576_0576875
941 Ga0495592_0100758
942 Ga0495651_0000127
943 Ga0495651_0005211
944 Ga0495653_0030027
945 Ga0495653_0060640
946 Ga0495580_0001662
947 Ga0495580_0027062
948 Ga0495580_0114380
949 Ga0495664_0088017
950 Ga0495606_0004864
951 Ga0495608_0001877
952 Ga0495608_0069366
953 Ga0495618_0027527
954 Ga0495628_0001109
955 Ga0495628_0012391
956 Ga0495628_0025257
957 Ga0495630_0023205
958 Ga0495648_0000701
959 Ga0495652_0007654
960 Ga0495665_0093934
961 Ga0495586_0101946
962 Ga0495587_0003590
963 Ga0495587_0053048
964 Ga0495633_0017512
965 Ga0495667_0000451
966 Ga0495667_0001930
967 Ga0495667_0066565
968 Ga0495611_0000065
969 Ga0495635_0005842
970 Ga0495599_0012506
971 Ga0495599_0111920
972 Ga0495623_0002676
973 Ga0495646_0000751
974 Ga0495646_0015244
975 Ga0495613_0044237
976 Ga0495624_0004561
977 Ga0495624_0146556
978 Ga0495600_0000959
979 Ga0495600_0028503
980 Ga0495600_0138583
981 Ga0495604_0000857
982 Ga0495604_0002268
983 Ga0495674_0011501
984 Ga0495672_0037062
985 Ga0495676_0164235
986 Ga0495680_0002221
987 Ga0495680_0015197
988 Ga0495687_000129
989 Ga0495675_0000313
990 Ga0495675_0000790
991 Ga0495684_0032315
992 Ga0495686_0000005
993 Ga0495593_0010020
994 Ga0495602_0032510
995 Ga0495602_0151002
996 Ga0495614_0007340
997 Ga0496101_0008727
998 Ga0496106_0002399
999 Ga0496108_0058499
1000 Ga0496109_0003584
1001 Ga0496109_0064707
1002 Ga0496112_0000116
1003 Ga0496120_0126022
1004 Ga0496121_0000081
1005 Ga0501034_0029989
1006 Ga0501038_0140248
1007 nmdc:mga0k408_114746_c1
1008 nmdc:mga05p37_10231_c1
1009 nmdc:mga05p37_172801_c1
1010 nmdc:mga08y16_112477_c1
1011 nmdc:mga0rr50_252009_c1
1012 Ga0495612_0066308
1013 Ga0500643_015402
1014 Ga0500646_0004054
1015 Ga0500583_0003120
1016 Ga0500568_0008557
1017 Ga0500616_0008355
1018 Ga0500622_0000904
1019 Ga0500622_0006015
1020 2617917613
1021 2819574955
1022 2821141051
1023 2831429118
1024 2840678841
1025 2848696241
1026 2849664938
1027 2896086658
1028 2896113027
1029 2904471552
1030 2913851900
1031 2913940377
1032 642605353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02445

NadA

Quinolinate synthetase A protein

88

386

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9614 9 312
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9582 9 312
7p4p-assembly1.cif.gz_A structure of the quinolinate synthase a84l variant complexed with citrate 0.9562 10 311
5lqm-assembly1.cif.gz_A structure of quinolinate synthase y21f mutant in complex with citrate 0.9538 10 311
1wzu-assembly1.cif.gz_A crystal structure of quinolinate synthase (nada) 0.948 9 310
ID Description Score Start End Superfamily
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9927 11 84 3.40.50.10800
af_P11458_25_111_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9815 11 88 3.40.50.10800
af_P9WJK1_121_190_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9713 97 166 3.40.50.10800
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9668 11 84 3.40.50.10800
af_P9WJK1_121_190_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.958 97 166 3.40.50.10800
ID Description Score Start End GO Terms
AF-A0A496RG29-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.006 10 90 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A7K0XRE9-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.001 11 91 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A257AE05-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1 11 86 GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A7C1C7R2-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 0.9959 10 94 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A354D7E3-F1-model_v4 deleted 0.9958 10 218

Map