F458045

General Info

Members Datasets Scaffolds Average Seq Length
516 321 1032 164

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0603285|Ga0495628_0603285_14_508
Length 147
Sequence VISRRTAGYLVWVVMMAIAFAKVEIQIEGAAGWAASLPTWRIEKHWLLDIFWGSRPLTGYHAWVFTFMALSFLAPLVLNGRWVARDLLLGLAGLMLFVQFDPAHVPWHKRWWCGAPVDYWLGLGGAGLLLWARRVSARKANALASSG

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
161 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
162 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
163 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
164 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
192 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
193 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
194 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
195 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
196 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
197 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
198 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
199 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
200 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
252 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
253 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
268 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
269 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
270 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
271 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
272 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
275 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
276 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
283 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
286 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
287 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
288 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
289 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
290 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
293 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
294 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
295 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
296 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
297 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
298 2643221658 Variovorax sp. Root411 Isolate Unclassified
299 2643221672 Variovorax sp. Root434 Isolate Unclassified
300 2738541277 Variovorax sp. GV051 Isolate Unclassified
301 2738541307 Variovorax sp. GV008 Isolate Unclassified
302 2738543019 Variovorax sp. GV040 Isolate Unclassified
303 2818991446 Variovorax sp. 1180 Isolate Unclassified
304 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
305 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
306 2842677519 Variovorax sp. R-72495 Isolate Unclassified
307 2885198086 Variovorax sp. 679 Isolate Unclassified
308 2885211737 Variovorax sp. 553 Isolate Unclassified
309 2899924645 Variovorax sp. 369 Isolate Unclassified
310 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
311 2928037797 Variovorax sp. 1126 Isolate Unclassified
312 2928044640 Variovorax sp. 1128 Isolate Unclassified
313 2928051484 Variovorax sp. 1133 Isolate Unclassified
314 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
315 2928070936 Variovorax gossypii 1167 Isolate Unclassified
316 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
317 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
318 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
319 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
320 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
321 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.19
Metatranscriptomes 0
Isolates 5.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.84
Nodule 0.97
Rhizoplane 1.55
Rhizosphere 55.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0603285 3300046516 Bacteria 784
2 JGI24740J21852_10013178 3300001979 Bacteria 3093
3 JGI25152J39213_1014527 3300002773 Bacteria 1593
4 JGI25152J39213_1024462 3300002773 Bacteria 1013
5 JGI25159J45721_1015804 3300002987 Bacteria 1638
6 JGI25159J45721_1036554 3300002987 Bacteria 743
7 JGI25151J46595_10001698 3300003187 Bacteria 14373
8 JGI25151J46595_10013687 3300003187 Bacteria 3641
9 JGI25153J46596_10023141 3300003215 Bacteria 2271
10 rootH1_10015356 3300003316 Bacteria 4423
11 rootH1_10231576 3300003323 Bacteria 2551
12 JGI25160J50197_1025738 3300003354 Bacteria 1638
13 JGI25160J50197_1029820 3300003354 Bacteria 1434
14 JGI25160J50197_1065329 3300003354 Bacteria 711
15 JGI25161J50226_1002818 3300003374 Bacteria 4269
16 JGI25161J50226_1007003 3300003374 Bacteria 1959
17 Ga0055532_1011549 3300003758 Bacteria 1038
18 Ga0055535_1000895 3300003761 Bacteria 20395
19 Ga0055542_1000317 3300003762 Bacteria 51979
20 Ga0055526_1025535 3300003771 Bacteria 1893
21 Ga0055526_1033618 3300003771 Bacteria 1419
22 Ga0055537_1000305 3300003773 Bacteria 33931
23 Ga0055537_1000512 3300003773 Bacteria 23014
24 Ga0055537_1010833 3300003773 Bacteria 1893
25 Ga0055537_1016582 3300003773 Bacteria 1241
26 Ga0055537_1016635 3300003773 Bacteria 1238
27 Ga0055524_1022612 3300003775 Bacteria 2049
28 Ga0055524_1024775 3300003775 Bacteria 1893
29 Ga0055536_1009878 3300003781 Bacteria 3876
30 Ga0055536_1010793 3300003781 Bacteria 3577
31 Ga0055534_1000234 3300003784 Bacteria 39867
32 Ga0055534_1013481 3300003784 Bacteria 1569
33 Ga0055534_1032127 3300003784 Bacteria 804
34 Ga0055528_1001925 3300003790 Bacteria 11791
35 Ga0055528_1023319 3300003790 Bacteria 1893
36 Ga0055528_1034605 3300003790 Bacteria 1241
37 Ga0055528_1034660 3300003790 Bacteria 1238
38 Ga0055530_10001624 3300003791 Bacteria 16094
39 Ga0055530_10014855 3300003791 Bacteria 2572
40 Ga0055540_1002321 3300003792 Bacteria 10200
41 Ga0055531_10003359 3300003794 Bacteria 10230
42 Ga0055543_1009657 3300004625 Bacteria 2062
43 Ga0065165_1024959 3300005262 Bacteria 1997
44 Ga0065165_1092245 3300005262 Bacteria 769
45 Ga0065165_1092246 3300005262 Bacteria 769
46 Ga0065714_10070148 3300005288 Bacteria 3956
47 Ga0070658_10624181 3300005327 Bacteria 935
48 Ga0070670_100040244 3300005331 Bacteria 4020
49 Ga0070682_100003461 3300005337 Bacteria 8731
50 Ga0070682_100986333 3300005337 Bacteria 698
51 Ga0070682_101445756 3300005337 Bacteria 589
52 Ga0070689_100312177 3300005340 Bacteria 1311
53 Ga0070668_100297825 3300005347 Bacteria 1352
54 Ga0070668_100410914 3300005347 Bacteria 1157
55 Ga0070669_100128671 3300005353 Bacteria 1940
56 Ga0070674_100163722 3300005356 Bacteria 1690
57 Ga0070674_100472729 3300005356 Bacteria 1039
58 Ga0070667_100039301 3300005367 Bacteria 3965
59 Ga0070705_100251762 3300005440 Bacteria 1240
60 Ga0070700_100302020 3300005441 Bacteria 1169
61 Ga0070700_100781459 3300005441 Bacteria 767
62 Ga0070694_100502566 3300005444 Bacteria 965
63 Ga0070663_100013253 3300005455 Bacteria 5249
64 Ga0070663_100163907 3300005455 Bacteria 1713
65 Ga0070678_100055600 3300005456 Bacteria 2890
66 Ga0070678_100058194 3300005456 Bacteria 2836
67 Ga0070678_100619523 3300005456 Bacteria 968
68 Ga0070678_101327122 3300005456 Bacteria 670
69 Ga0070662_100002028 3300005457 Bacteria 12401
70 Ga0070662_100022823 3300005457 Bacteria 4290
71 Ga0070662_100478700 3300005457 Bacteria 1036
72 Ga0068853_100038758 3300005539 Bacteria 4060
73 Ga0068853_100230438 3300005539 Bacteria 1694
74 Ga0070665_100004316 3300005548 Bacteria 14946
75 Ga0070665_100031567 3300005548 Bacteria 5332
76 Ga0070665_100054604 3300005548 Bacteria 4007
77 Ga0068855_100086288 3300005563 Bacteria 3629
78 Ga0070664_100004528 3300005564 Bacteria 11153
79 Ga0068857_100691390 3300005577 Bacteria 969
80 Ga0068854_100010170 3300005578 Bacteria 6095
81 Ga0068854_100276805 3300005578 Bacteria 1349
82 Ga0068856_100420146 3300005614 Bacteria 1357
83 Ga0068852_100024409 3300005616 Bacteria 4885
84 Ga0068852_100764657 3300005616 Bacteria 979
85 Ga0068864_100099472 3300005618 Bacteria 2576
86 Ga0068851_10000894 3300005834 Bacteria 12874
87 Ga0068851_10014090 3300005834 Bacteria 3792
88 Ga0068863_100142317 3300005841 Bacteria 2293
89 Ga0068858_100001968 3300005842 Bacteria 20984
90 Ga0068858_100066860 3300005842 Bacteria 3328
91 Ga0068860_100065624 3300005843 Bacteria 3447
92 Ga0068862_100168798 3300005844 Bacteria 1958
93 Ga0068862_100998853 3300005844 Bacteria 827
94 Ga0075365_10078978 3300006038 Bacteria 2226
95 Ga0075368_10120448 3300006042 Bacteria 1086
96 Ga0075363_100028093 3300006048 Bacteria 2890
97 Ga0075363_100071047 3300006048 Bacteria 1891
98 Ga0075364_10016673 3300006051 Bacteria 4573
99 Ga0075364_10062242 3300006051 Bacteria 2449
100 Ga0075432_10019760 3300006058 Bacteria 2302
101 Ga0075362_10009991 3300006177 Bacteria 3690
102 Ga0075362_10022661 3300006177 Bacteria 2649
103 Ga0075369_10226024 3300006186 Bacteria 867
104 Ga0075366_10013471 3300006195 Bacteria 4657
105 Ga0075366_10042328 3300006195 Bacteria 2696
106 Ga0075366_10064152 3300006195 Bacteria 2184
107 Ga0075370_10000135 3300006353 Bacteria 24922
108 Ga0075370_10000956 3300006353 Bacteria 11897
109 Ga0075370_10009418 3300006353 Bacteria 5071
110 Ga0075428_100598843 3300006844 Bacteria 1177
111 Ga0075433_10001145 3300006852 Bacteria 19245
112 Ga0075434_100013125 3300006871 Bacteria 7869
113 Ga0068865_100059343 3300006881 Bacteria 2675
114 Ga0075436_100044128 3300006914 Bacteria 3073
115 Ga0099826_10000537 3300006948 Bacteria 18775
116 Ga0099826_10129619 3300006948 Bacteria 1473
117 Ga0099826_10328760 3300006948 Bacteria 769
118 Ga0075435_100063753 3300007076 Bacteria 2993
119 Ga0105244_10003971 3300009036 Bacteria 10370
120 Ga0105240_10037457 3300009093 Bacteria 6233
121 Ga0105240_10041493 3300009093 Bacteria 5873
122 Ga0105240_10137828 3300009093 Bacteria 2920
123 Ga0105240_10324561 3300009093 Bacteria 1753
124 Ga0105240_10879002 3300009093 Bacteria 965
125 Ga0111539_10086096 3300009094 Bacteria 3693
126 Ga0105245_11422434 3300009098 Bacteria 744
127 Ga0105243_10018431 3300009148 Bacteria 5288
128 Ga0105241_10133590 3300009174 Bacteria 2012
129 Ga0105241_10238706 3300009174 Bacteria 1535
130 Ga0105248_11234154 3300009177 Bacteria 845
131 Ga0105237_10000251 3300009545 Bacteria 76229
132 Ga0105237_10227563 3300009545 Bacteria 1865
133 Ga0105237_10630282 3300009545 Bacteria 1079
134 Ga0105238_10013352 3300009551 Bacteria 8286
135 Ga0105238_10038565 3300009551 Bacteria 4851
136 Ga0105238_10371514 3300009551 Bacteria 1420
137 Ga0105238_10922524 3300009551 Bacteria 892
138 Ga0105238_11387991 3300009551 Bacteria 729
139 Ga0105249_10004435 3300009553 Bacteria 12144
140 Ga0105249_10488110 3300009553 Bacteria 1275
141 Ga0105239_10002122 3300010375 Bacteria 25587
142 Ga0105239_10309452 3300010375 Bacteria 1780
143 Ga0105239_11263375 3300010375 Bacteria 851
144 Ga0105239_11419364 3300010375 Bacteria 802
145 Ga0105246_10109319 3300011119 Bacteria 2028
146 Ga0105246_10358450 3300011119 Bacteria 1197
147 Ga0157347_1032080 3300012502 Bacteria 662
148 Ga0157339_1008177 3300012505 Bacteria 896
149 Ga0157373_10023673 3300013100 Bacteria 4451
150 Ga0157373_10331604 3300013100 Bacteria 1083
151 Ga0157371_10000018 3300013102 Bacteria 310522
152 Ga0157371_10066303 3300013102 Bacteria 2556
153 Ga0157370_10000627 3300013104 Bacteria 44044
154 Ga0157370_10113396 3300013104 Bacteria 2533
155 Ga0157370_10226234 3300013104 Bacteria 1732
156 Ga0157369_10025395 3300013105 Bacteria 6578
157 Ga0157369_10207547 3300013105 Bacteria 2054
158 Ga0157374_10058285 3300013296 Bacteria 3608
159 Ga0163162_10203220 3300013306 Bacteria 2110
160 Ga0163162_10827998 3300013306 Bacteria 1042
161 Ga0163162_12294126 3300013306 Bacteria 620
162 Ga0157372_10253805 3300013307 Bacteria 2042
163 Ga0157375_10039427 3300013308 Bacteria 4547
164 Ga0157375_11293711 3300013308 Bacteria 857
165 Ga0163163_10272047 3300014325 Bacteria 1745
166 Ga0163163_11262536 3300014325 Bacteria 801
167 Ga0182008_10009033 3300014497 Bacteria 5398
168 Ga0182008_10033432 3300014497 Bacteria 2580
169 Ga0182008_10069194 3300014497 Bacteria 1737
170 Ga0157379_10147675 3300014968 Bacteria 2120
171 Ga0157376_10059127 3300014969 Bacteria 3213
172 Ga0182006_1007489 3300015261 Bacteria 4993
173 Ga0182007_10000420 3300015262 Bacteria 25957
174 Ga0163161_10000142 3300017792 Bacteria 66331
175 Ga0163161_10268933 3300017792 Bacteria 1333
176 Ga0209436_110891 3300025208 Bacteria 1634
177 Ga0209672_102008 3300025228 Bacteria 5625
178 Ga0209147_100929 3300025229 Bacteria 13081
179 Ga0209258_100015 3300025242 Bacteria 706310
180 Ga0207425_1001209 3300025245 Bacteria 11384
181 Ga0209148_1000183 3300025254 Bacteria 122620
182 Ga0209129_1000049 3300025258 Bacteria 268086
183 Ga0209129_1002892 3300025258 Bacteria 7901
184 Ga0209129_1003300 3300025258 Bacteria 7124
185 Ga0209565_1000108 3300025263 Bacteria 120719
186 Ga0209565_1000356 3300025263 Bacteria 39995
187 Ga0209565_1003377 3300025263 Bacteria 5200
188 Ga0209565_1003599 3300025263 Bacteria 4953
189 Ga0209673_1000386 3300025273 Bacteria 79438
190 Ga0209673_1000766 3300025273 Bacteria 43583
191 Ga0209673_1000842 3300025273 Bacteria 39995
192 Ga0209130_1000200 3300025284 Bacteria 81072
193 Ga0209130_1002167 3300025284 Bacteria 10347
194 Ga0209130_1005894 3300025284 Bacteria 4123
195 Ga0209675_1000163 3300025291 Bacteria 81884
196 Ga0209675_1000320 3300025291 Bacteria 43027
197 Ga0209675_1039721 3300025291 Bacteria 1040
198 Ga0209675_1041156 3300025291 Bacteria 1010
199 Ga0209675_1063094 3300025291 Bacteria 726
200 Ga0209676_1000137 3300025292 Bacteria 179437
201 Ga0209676_1000385 3300025292 Bacteria 81044
202 Ga0209676_1024262 3300025292 Bacteria 1969
203 Ga0209025_1000290 3300025294 Bacteria 113067
204 Ga0209025_1000313 3300025294 Bacteria 107850
205 Ga0209025_1009050 3300025294 Bacteria 7023
206 Ga0209025_1018533 3300025294 Bacteria 3934
207 Ga0209025_1065953 3300025294 Bacteria 1318
208 Ga0209564_1000232 3300025295 Bacteria 122080
209 Ga0209564_1000303 3300025295 Bacteria 97431
210 Ga0209758_1000135 3300025297 Bacteria 177753
211 Ga0209758_1009181 3300025297 Bacteria 6217
212 Ga0209758_1068661 3300025297 Bacteria 1127
213 Ga0209050_1000015 3300025298 Bacteria 759102
214 Ga0209050_1000681 3300025298 Bacteria 51157
215 Ga0209050_1002997 3300025298 Bacteria 13122
216 Ga0209256_1000129 3300025299 Bacteria 163766
217 Ga0209256_1000224 3300025299 Bacteria 104436
218 Ga0207426_1000171 3300025302 Bacteria 163766
219 Ga0207426_1000185 3300025302 Bacteria 154146
220 Ga0209051_1000010 3300025303 Bacteria 641298
221 Ga0209051_1000137 3300025303 Bacteria 137784
222 Ga0209257_1000026 3300025304 Bacteria 723225
223 Ga0209257_1000205 3300025304 Bacteria 143735
224 Ga0209257_1000643 3300025304 Bacteria 55819
225 Ga0207656_10001194 3300025321 Bacteria 8556
226 Ga0207655_1016249 3300025728 Bacteria 4083
227 Ga0207655_1088807 3300025728 Bacteria 1093
228 Ga0207680_10080406 3300025903 Bacteria 2046
229 Ga0207647_10000163 3300025904 Bacteria 52372
230 Ga0207645_10478314 3300025907 Bacteria 842
231 Ga0207705_10181409 3300025909 Bacteria 1589
232 Ga0207654_10018982 3300025911 Bacteria 3618
233 Ga0207695_10007966 3300025913 Bacteria 13365
234 Ga0207695_10024742 3300025913 Bacteria 6743
235 Ga0207695_10024768 3300025913 Bacteria 6739
236 Ga0207695_10520464 3300025913 Bacteria 1071
237 Ga0207671_10007713 3300025914 Bacteria 9283
238 Ga0207671_10014185 3300025914 Bacteria 6309
239 Ga0207671_10399784 3300025914 Bacteria 1093
240 Ga0207671_10419426 3300025914 Bacteria 1065
241 Ga0207649_10018321 3300025920 Bacteria 3980
242 Ga0207649_10066262 3300025920 Bacteria 2289
243 Ga0207681_10377821 3300025923 Bacteria 1140
244 Ga0207694_10003428 3300025924 Bacteria 12616
245 Ga0207650_10092330 3300025925 Bacteria 2315
246 Ga0207706_10000524 3300025933 Bacteria 40739
247 Ga0207706_10024537 3300025933 Bacteria 5405
248 Ga0207706_10419629 3300025933 Bacteria 1159
249 Ga0207709_10002961 3300025935 Bacteria 10354
250 Ga0207670_10357695 3300025936 Bacteria 1158
251 Ga0207669_10075315 3300025937 Bacteria 2138
252 Ga0207669_10161544 3300025937 Bacteria 1583
253 Ga0207669_10494063 3300025937 Bacteria 978
254 Ga0207704_10031751 3300025938 Bacteria 2979
255 Ga0207665_11002871 3300025939 Bacteria 664
256 Ga0207689_10136499 3300025942 Bacteria 2020
257 Ga0207679_10119818 3300025945 Bacteria 2093
258 Ga0207712_10001887 3300025961 Bacteria 13776
259 Ga0207712_10980928 3300025961 Bacteria 749
260 Ga0207640_10047236 3300025981 Bacteria 2775
261 Ga0207640_10261706 3300025981 Bacteria 1348
262 Ga0207658_10017807 3300025986 Bacteria 4894
263 Ga0207677_10338993 3300026023 Bacteria 1255
264 Ga0207703_10001755 3300026035 Bacteria 19387
265 Ga0207703_10839723 3300026035 Bacteria 878
266 Ga0207639_10000149 3300026041 Bacteria 52591
267 Ga0207639_10089675 3300026041 Bacteria 2458
268 Ga0207639_10110927 3300026041 Bacteria 2235
269 Ga0207678_10000322 3300026067 Bacteria 43160
270 Ga0207708_11756238 3300026075 Bacteria 545
271 Ga0207702_10013540 3300026078 Bacteria 6774
272 Ga0207702_10295594 3300026078 Bacteria 1535
273 Ga0207702_10795055 3300026078 Bacteria 935
274 Ga0207648_10121241 3300026089 Bacteria 2299
275 Ga0207676_10069733 3300026095 Bacteria 2816
276 Ga0207674_10053706 3300026116 Bacteria 4105
277 Ga0207674_10188175 3300026116 Bacteria 2014
278 Ga0207674_10437604 3300026116 Bacteria 1264
279 Ga0207683_10289412 3300026121 Bacteria 1498
280 Ga0207683_11218201 3300026121 Bacteria 698
281 Ga0207698_10215362 3300026142 Bacteria 1731
282 Ga0207698_10612718 3300026142 Bacteria 1074
283 Ga0207698_11176132 3300026142 Bacteria 781
284 Ga0207698_11591649 3300026142 Bacteria 669
285 Ga0209282_1000396 3300027666 Bacteria 21285
286 Ga0268266_10000008 3300028379 Bacteria 1161875
287 Ga0268266_10092561 3300028379 Bacteria 2653
288 Ga0268265_10100866 3300028380 Bacteria 2331
289 Ga0268265_10997023 3300028380 Bacteria 827
290 Ga0268264_10121503 3300028381 Bacteria 2302
291 Ga0307517_10003456 3300028786 Bacteria 24568
292 Ga0307517_10010725 3300028786 Bacteria 12781
293 Ga0307512_10183025 3300030522 Bacteria 1173
294 Ga0316177_1071078 3300030731 Bacteria 696
295 Ga0316177_1176124 3300030731 Bacteria 1322
296 Ga0316176_1209518 3300030732 Bacteria 546
297 Ga0314311_1033180 3300030733 Bacteria 5167
298 Ga0316179_1023673 3300030734 Bacteria 1949
299 Ga0316183_1018963 3300030742 Bacteria 1925
300 Ga0316182_1042700 3300030745 Bacteria 3058
301 Ga0316182_1117144 3300030745 Bacteria 598
302 Ga0265316_10107431 3300031344 Bacteria 2116
303 Ga0307513_10071529 3300031456 Bacteria 3619
304 Ga0307513_10183162 3300031456 Bacteria 1955
305 Ga0307513_10416545 3300031456 Bacteria 1074
306 Ga0307408_100061926 3300031548 Bacteria 2732
307 Ga0307408_100318426 3300031548 Bacteria 1309
308 Ga0307508_10001470 3300031616 Bacteria 26429
309 Ga0307508_10133118 3300031616 Bacteria 2089
310 Ga0307508_10484120 3300031616 Bacteria 831
311 Ga0307514_10002998 3300031649 Bacteria 16712
312 Ga0307516_10217238 3300031730 Bacteria 1623
313 Ga0307516_10230895 3300031730 Bacteria 1554
314 Ga0307405_10018065 3300031731 Bacteria 3882
315 Ga0307405_10179809 3300031731 Bacteria 1517
316 Ga0307406_10059303 3300031901 Bacteria 2463
317 Ga0307412_10013139 3300031911 Bacteria 4845
318 Ga0307412_10075473 3300031911 Bacteria 2312
319 Ga0307409_100363494 3300031995 Bacteria 1370
320 Ga0307416_100030371 3300032002 Bacteria 4054
321 Ga0307510_10012669 3300033180 Bacteria 10004
322 Ga0307510_10153580 3300033180 Bacteria 1914
323 Ga0307510_10246632 3300033180 Bacteria 1276
324 Ga0373932_0002640 3300035112 Bacteria 4467
325 Ga0373931_0001535 3300035691 Bacteria 9955
326 Ga0395905_0000493 3300037471 Bacteria 54325
327 Ga0395905_1751640 3300037471 Bacteria 527
328 Ga0439436_0007020 3300041404 Bacteria 3466
329 Ga0439466_0056395 3300041411 Bacteria 1274
330 Ga0439465_0330405 3300041413 Bacteria 574
331 Ga0451791_0180970 3300041451 Bacteria 1039
332 Ga0451793_1390022 3300041452 Bacteria 645
333 Ga0451795_1079425 3300041456 Bacteria 631
334 Ga0451839_0052803 3300041496 Bacteria 566
335 Ga0451839_1043122 3300041496 Bacteria 548
336 Ga0451841_0321725 3300041498 Bacteria 590
337 Ga0439449_0047423 3300042007 Bacteria 1591
338 Ga0439455_0023457 3300042012 Bacteria 1485
339 Ga0450920_009735 3300042122 Bacteria 1772
340 Ga0450921_000031 3300042123 Bacteria 3607
341 Ga0450923_000996 3300042125 Bacteria 3526
342 Ga0450897_002505 3300042128 Bacteria 1385
343 Ga0450896_035280 3300042133 Bacteria 767
344 Ga0450906_002945 3300042145 Bacteria 3699
345 Ga0450907_029923 3300042146 Bacteria 925
346 Ga0450910_000740 3300042147 Bacteria 3921
347 Ga0450908_002965 3300042184 Bacteria 3307
348 Ga0450909_002035 3300042185 Bacteria 2855
349 Ga0439434_0007945 3300042435 Bacteria 3110
350 Ga0450918_001418 3300042531 Bacteria 4761
351 Ga0466972_0139897 3300044658 Bacteria 1139
352 Ga0466965_0019588 3300044683 Bacteria 3249
353 Ga0466966_0021397 3300044684 Bacteria 4246
354 Ga0453684_0115286 3300044712 Bacteria 3255
355 Ga0466959_0046788 3300045049 Bacteria 3184
356 Ga0495627_017527 3300046453 Bacteria 2432
357 Ga0495627_072170 3300046453 Bacteria 1007
358 Ga0495592_0566156 3300046454 Bacteria 697
359 Ga0495638_0293189 3300046460 Bacteria 879
360 Ga0495650_0000552 3300046471 Bacteria 53435
361 Ga0495605_0025330 3300046474 Bacteria 3092
362 Ga0495596_0000761 3300046500 Bacteria 19650
363 Ga0495616_0000779 3300046513 Bacteria 23301
364 Ga0495620_0047243 3300046515 Bacteria 1854
365 Ga0495620_0076277 3300046515 Bacteria 1363
366 Ga0495631_0000541 3300046518 Bacteria 25406
367 Ga0495632_0000052 3300046519 Bacteria 132992
368 Ga0495637_0007191 3300046520 Bacteria 5542
369 Ga0495637_0018601 3300046520 Bacteria 3221
370 Ga0495643_0019267 3300046522 Bacteria 3951
371 Ga0495643_0044717 3300046522 Bacteria 2405
372 Ga0495654_0001438 3300046530 Bacteria 16353
373 Ga0495654_0114076 3300046530 Bacteria 1230
374 Ga0495609_0000877 3300046538 Bacteria 22038
375 Ga0495609_0405894 3300046538 Bacteria 545
376 Ga0495621_0010792 3300046539 Bacteria 2807
377 Ga0495622_0075617 3300046557 Bacteria 1552
378 Ga0495622_0314671 3300046557 Bacteria 681
379 Ga0495625_0000360 3300046660 Bacteria 69587
380 Ga0495625_0023660 3300046660 Bacteria 4688
381 Ga0495625_0106933 3300046660 Bacteria 1915
382 Ga0495625_0316913 3300046660 Bacteria 994
383 Ga0495635_0778623 3300046663 Bacteria 617
384 Ga0495661_0003121 3300046665 Bacteria 12417
385 Ga0495670_0058666 3300046691 Bacteria 1932
386 Ga0495671_0029634 3300046692 Bacteria 2809
387 Ga0495649_0191037 3300046694 Bacteria 1066
388 Ga0495589_0005651 3300046794 Bacteria 6592
389 Ga0495660_0034725 3300046810 Bacteria 2820
390 Ga0495660_0054694 3300046810 Bacteria 2162
391 Ga0495676_0047130 3300047321 Bacteria 3489
392 Ga0495676_0070732 3300047321 Bacteria 2685
393 Ga0495676_0076736 3300047321 Bacteria 2550
394 Ga0495683_0006326 3300047323 Bacteria 6474
395 Ga0495673_0062730 3300047469 Bacteria 1587
396 Ga0495593_0022029 3300047673 Bacteria 3555
397 Ga0495593_0054522 3300047673 Bacteria 2107
398 Ga0495614_0014605 3300048089 Bacteria 3434
399 Ga0495626_0074800 3300048091 Bacteria 1515
400 Ga0496101_0004592 3300048904 Bacteria 8724
401 Ga0496102_0127532 3300048905 Bacteria 2379
402 Ga0496116_0008418 3300048919 Bacteria 8954
403 Ga0496116_0016028 3300048919 Bacteria 5889
404 Ga0496117_0011303 3300048920 Bacteria 8005
405 Ga0496117_0020139 3300048920 Bacteria 5450
406 Ga0496117_0094531 3300048920 Bacteria 1913
407 Ga0496117_0187156 3300048920 Bacteria 1183
408 Ga0496118_0031024 3300048921 Bacteria 4444
409 Ga0496118_0034038 3300048921 Bacteria 4167
410 Ga0496119_0080799 3300048922 Bacteria 1874
411 Ga0496119_0364351 3300048922 Bacteria 697
412 Ga0496121_0060263 3300048924 Bacteria 3122
413 Ga0496121_0063217 3300048924 Bacteria 3026
414 Ga0496121_0122188 3300048924 Bacteria 1964
415 Ga0496122_0069134 3300048925 Bacteria 2531
416 Ga0496122_0171565 3300048925 Bacteria 1306
417 Ga0496123_0022751 3300048926 Bacteria 4820
418 Ga0496123_0219327 3300048926 Bacteria 960
419 Ga0496124_0033305 3300048927 Bacteria 4533
420 Ga0496124_0034571 3300048927 Bacteria 4434
421 Ga0496124_0104194 3300048927 Bacteria 2294
422 Ga0496124_0146591 3300048927 Bacteria 1857
423 Ga0496124_0607378 3300048927 Bacteria 710
424 Ga0496125_0018296 3300048928 Bacteria 6658
425 Ga0496125_0032876 3300048928 Bacteria 4600
426 Ga0496125_0129981 3300048928 Bacteria 1775
427 Ga0496125_0206601 3300048928 Bacteria 1280
428 Ga0496125_0290235 3300048928 Bacteria 1008
429 Ga0496125_0393542 3300048928 Bacteria 812
430 Ga0495678_068583 3300049459 Bacteria 1307
431 Ga0501249_008325 3300049679 Bacteria 2153
432 Ga0501257_055813 3300049686 Bacteria 992
433 Ga0501221_012600 3300049704 Bacteria 1541
434 Ga0501262_003325 3300049759 Bacteria 1838
435 nmdc:mga03683_54525_c1 3300050489 Bacteria 1677
436 nmdc:mga03683_8775_c1 3300050489 Bacteria 3567
437 nmdc:mga03n38_58895_c1 3300050490 Bacteria 1742
438 nmdc:mga03n38_70268_c1 3300050490 Bacteria 1619
439 nmdc:mga00v17_4332_c2 3300050491 Bacteria 5751
440 nmdc:mga00v17_71967_c1 3300050491 Bacteria 2144
441 nmdc:mga0k408_17956_c1 3300050493 Bacteria 3943
442 nmdc:mga0k408_23136_c1 3300050493 Bacteria 3502
443 nmdc:mga0k408_69806_c1 3300050493 Bacteria 2051
444 nmdc:mga0k408_98069_c1 3300050493 Bacteria 1727
445 nmdc:mga06z11_30545_c1 3300050494 Bacteria 2608
446 nmdc:mga06z11_35027_c1 3300050494 Bacteria 2468
447 nmdc:mga04h51_65321_c1 3300050495 Bacteria 1257
448 nmdc:mga07m45_2246_c1 3300050496 Bacteria 9018
449 nmdc:mga07m45_323548_c1 3300050496 Bacteria 896
450 nmdc:mga07m45_3872_c1 3300050496 Bacteria 7259
451 nmdc:mga07m45_65411_c1 3300050496 Bacteria 2065
452 nmdc:mga07m45_9332_c1 3300050496 Bacteria 5085
453 nmdc:mga08y16_67816_c1 3300050511 Bacteria 3721
454 nmdc:mga0rr50_501_c1 3300050513 Bacteria 20883
455 nmdc:mga0a205_635_c1 3300050515 Bacteria 25355
456 nmdc:mga0sz30_133106_c1 3300050516 Bacteria 1096
457 Ga0500643_059056 3300053087 Bacteria 1080
458 Ga0500651_0000234 3300053093 Bacteria 34517
459 Ga0500566_0026342 3300053094 Bacteria 3404
460 Ga0500641_0178334 3300053096 Bacteria 913
461 Ga0500571_000076 3300053110 Bacteria 30903
462 Ga0500572_147837 3300053111 Bacteria 767
463 Ga0500593_000376 3300053117 Bacteria 17913
464 Ga0500607_000797 3300053121 Bacteria 30420
465 Ga0500607_042257 3300053121 Bacteria 2461
466 Ga0500607_224223 3300053121 Bacteria 779
467 Ga0500608_005472 3300053122 Bacteria 5052
468 Ga0500626_010324 3300053128 Bacteria 3918
469 Ga0500652_022136 3300053131 Bacteria 2403
470 Ga0500655_007758 3300053133 Bacteria 1931
471 Ga0500658_0000096 3300053134 Bacteria 40172
472 Ga0500658_0000100 3300053134 Bacteria 39487
473 Ga0500659_0277033 3300053135 Bacteria 765
474 Ga0500559_0428128 3300053136 Bacteria 613
475 Ga0500564_050343 3300053138 Bacteria 1906
476 Ga0500568_0015435 3300053139 Bacteria 3420
477 Ga0500574_047681 3300053141 Bacteria 1215
478 Ga0500590_008884 3300053148 Bacteria 5032
479 Ga0500616_0014229 3300053153 Bacteria 4578
480 Ga0500624_032042 3300053157 Bacteria 908
481 Ga0500627_0002295 3300053158 Bacteria 5626
482 Ga0500634_0008482 3300053161 Bacteria 5142
483 Ga0500638_106603 3300053162 Bacteria 1299
484 Ga0500625_146997 3300053729 Bacteria 895
485 Ga0500596_014953 3300053735 Bacteria 1166
486 Ga0466962_0064675 3300061719 Bacteria 1746
487 2513231506 2513020051 Bacteria 6053213
488 2599627018 2599185214 Bacteria 8209958
489 2599676621 2599185226 Bacteria 8233575
490 2599684889 2599185227 Bacteria 8246414
491 2599696675 2599185229 Bacteria 8216126
492 2644161575 2643221628 Bacteria 5745828
493 2644326933 2643221658 Bacteria 6064537
494 2644401097 2643221672 Bacteria 6322190
495 2738723537 2738541277 Bacteria 7458140
496 2738882165 2738541307 Bacteria 8606193
497 2739284268 2738543019 Bacteria 7459457
498 2819598093 2818991446 Bacteria 7757362
499 2831269084 2831265667 Bacteria 7184833
500 2838058510 2838054893 Bacteria 7451788
501 2842682193 2842677519 Bacteria 5615038
502 2885200106 2885198086 Bacteria 7212419
503 2885213663 2885211737 Bacteria 7212420
504 2899929513 2899924645 Bacteria 7487985
505 2904543411 2904541872 Bacteria 8915136
506 2928040041 2928037797 Bacteria 7273642
507 2928047210 2928044640 Bacteria 7271509
508 2928057590 2928051484 Bacteria 7773759
509 2928068027 2928064002 Bacteria 7419480
510 2928072607 2928070936 Bacteria 8062541
511 2928085778 2928084124 Bacteria 7159212
512 2929160644 2929160207 Bacteria 9075316
513 2945914885 2945909444 Bacteria 7065066
514 2945951071 2945945610 Bacteria 5951079
515 2945989715 2945984333 Bacteria 7358892
516 2954769526 2954767861 Bacteria 5535784
517 Ga0495628_0603285
518 JGI24740J21852_10013178
519 JGI25152J39213_1014527
520 JGI25152J39213_1024462
521 JGI25159J45721_1015804
522 JGI25159J45721_1036554
523 JGI25151J46595_10001698
524 JGI25151J46595_10013687
525 JGI25153J46596_10023141
526 rootH1_10015356
527 rootH1_10231576
528 JGI25160J50197_1025738
529 JGI25160J50197_1029820
530 JGI25160J50197_1065329
531 JGI25161J50226_1002818
532 JGI25161J50226_1007003
533 Ga0055532_1011549
534 Ga0055535_1000895
535 Ga0055542_1000317
536 Ga0055526_1025535
537 Ga0055526_1033618
538 Ga0055537_1000305
539 Ga0055537_1000512
540 Ga0055537_1010833
541 Ga0055537_1016582
542 Ga0055537_1016635
543 Ga0055524_1022612
544 Ga0055524_1024775
545 Ga0055536_1009878
546 Ga0055536_1010793
547 Ga0055534_1000234
548 Ga0055534_1013481
549 Ga0055534_1032127
550 Ga0055528_1001925
551 Ga0055528_1023319
552 Ga0055528_1034605
553 Ga0055528_1034660
554 Ga0055530_10001624
555 Ga0055530_10014855
556 Ga0055540_1002321
557 Ga0055531_10003359
558 Ga0055543_1009657
559 Ga0065165_1024959
560 Ga0065165_1092245
561 Ga0065165_1092246
562 Ga0065714_10070148
563 Ga0070658_10624181
564 Ga0070670_100040244
565 Ga0070682_100003461
566 Ga0070682_100986333
567 Ga0070682_101445756
568 Ga0070689_100312177
569 Ga0070668_100297825
570 Ga0070668_100410914
571 Ga0070669_100128671
572 Ga0070674_100163722
573 Ga0070674_100472729
574 Ga0070667_100039301
575 Ga0070705_100251762
576 Ga0070700_100302020
577 Ga0070700_100781459
578 Ga0070694_100502566
579 Ga0070663_100013253
580 Ga0070663_100163907
581 Ga0070678_100055600
582 Ga0070678_100058194
583 Ga0070678_100619523
584 Ga0070678_101327122
585 Ga0070662_100002028
586 Ga0070662_100022823
587 Ga0070662_100478700
588 Ga0068853_100038758
589 Ga0068853_100230438
590 Ga0070665_100004316
591 Ga0070665_100031567
592 Ga0070665_100054604
593 Ga0068855_100086288
594 Ga0070664_100004528
595 Ga0068857_100691390
596 Ga0068854_100010170
597 Ga0068854_100276805
598 Ga0068856_100420146
599 Ga0068852_100024409
600 Ga0068852_100764657
601 Ga0068864_100099472
602 Ga0068851_10000894
603 Ga0068851_10014090
604 Ga0068863_100142317
605 Ga0068858_100001968
606 Ga0068858_100066860
607 Ga0068860_100065624
608 Ga0068862_100168798
609 Ga0068862_100998853
610 Ga0075365_10078978
611 Ga0075368_10120448
612 Ga0075363_100028093
613 Ga0075363_100071047
614 Ga0075364_10016673
615 Ga0075364_10062242
616 Ga0075432_10019760
617 Ga0075362_10009991
618 Ga0075362_10022661
619 Ga0075369_10226024
620 Ga0075366_10013471
621 Ga0075366_10042328
622 Ga0075366_10064152
623 Ga0075370_10000135
624 Ga0075370_10000956
625 Ga0075370_10009418
626 Ga0075428_100598843
627 Ga0075433_10001145
628 Ga0075434_100013125
629 Ga0068865_100059343
630 Ga0075436_100044128
631 Ga0099826_10000537
632 Ga0099826_10129619
633 Ga0099826_10328760
634 Ga0075435_100063753
635 Ga0105244_10003971
636 Ga0105240_10037457
637 Ga0105240_10041493
638 Ga0105240_10137828
639 Ga0105240_10324561
640 Ga0105240_10879002
641 Ga0111539_10086096
642 Ga0105245_11422434
643 Ga0105243_10018431
644 Ga0105241_10133590
645 Ga0105241_10238706
646 Ga0105248_11234154
647 Ga0105237_10000251
648 Ga0105237_10227563
649 Ga0105237_10630282
650 Ga0105238_10013352
651 Ga0105238_10038565
652 Ga0105238_10371514
653 Ga0105238_10922524
654 Ga0105238_11387991
655 Ga0105249_10004435
656 Ga0105249_10488110
657 Ga0105239_10002122
658 Ga0105239_10309452
659 Ga0105239_11263375
660 Ga0105239_11419364
661 Ga0105246_10109319
662 Ga0105246_10358450
663 Ga0157347_1032080
664 Ga0157339_1008177
665 Ga0157373_10023673
666 Ga0157373_10331604
667 Ga0157371_10000018
668 Ga0157371_10066303
669 Ga0157370_10000627
670 Ga0157370_10113396
671 Ga0157370_10226234
672 Ga0157369_10025395
673 Ga0157369_10207547
674 Ga0157374_10058285
675 Ga0163162_10203220
676 Ga0163162_10827998
677 Ga0163162_12294126
678 Ga0157372_10253805
679 Ga0157375_10039427
680 Ga0157375_11293711
681 Ga0163163_10272047
682 Ga0163163_11262536
683 Ga0182008_10009033
684 Ga0182008_10033432
685 Ga0182008_10069194
686 Ga0157379_10147675
687 Ga0157376_10059127
688 Ga0182006_1007489
689 Ga0182007_10000420
690 Ga0163161_10000142
691 Ga0163161_10268933
692 Ga0209436_110891
693 Ga0209672_102008
694 Ga0209147_100929
695 Ga0209258_100015
696 Ga0207425_1001209
697 Ga0209148_1000183
698 Ga0209129_1000049
699 Ga0209129_1002892
700 Ga0209129_1003300
701 Ga0209565_1000108
702 Ga0209565_1000356
703 Ga0209565_1003377
704 Ga0209565_1003599
705 Ga0209673_1000386
706 Ga0209673_1000766
707 Ga0209673_1000842
708 Ga0209130_1000200
709 Ga0209130_1002167
710 Ga0209130_1005894
711 Ga0209675_1000163
712 Ga0209675_1000320
713 Ga0209675_1039721
714 Ga0209675_1041156
715 Ga0209675_1063094
716 Ga0209676_1000137
717 Ga0209676_1000385
718 Ga0209676_1024262
719 Ga0209025_1000290
720 Ga0209025_1000313
721 Ga0209025_1009050
722 Ga0209025_1018533
723 Ga0209025_1065953
724 Ga0209564_1000232
725 Ga0209564_1000303
726 Ga0209758_1000135
727 Ga0209758_1009181
728 Ga0209758_1068661
729 Ga0209050_1000015
730 Ga0209050_1000681
731 Ga0209050_1002997
732 Ga0209256_1000129
733 Ga0209256_1000224
734 Ga0207426_1000171
735 Ga0207426_1000185
736 Ga0209051_1000010
737 Ga0209051_1000137
738 Ga0209257_1000026
739 Ga0209257_1000205
740 Ga0209257_1000643
741 Ga0207656_10001194
742 Ga0207655_1016249
743 Ga0207655_1088807
744 Ga0207680_10080406
745 Ga0207647_10000163
746 Ga0207645_10478314
747 Ga0207705_10181409
748 Ga0207654_10018982
749 Ga0207695_10007966
750 Ga0207695_10024742
751 Ga0207695_10024768
752 Ga0207695_10520464
753 Ga0207671_10007713
754 Ga0207671_10014185
755 Ga0207671_10399784
756 Ga0207671_10419426
757 Ga0207649_10018321
758 Ga0207649_10066262
759 Ga0207681_10377821
760 Ga0207694_10003428
761 Ga0207650_10092330
762 Ga0207706_10000524
763 Ga0207706_10024537
764 Ga0207706_10419629
765 Ga0207709_10002961
766 Ga0207670_10357695
767 Ga0207669_10075315
768 Ga0207669_10161544
769 Ga0207669_10494063
770 Ga0207704_10031751
771 Ga0207665_11002871
772 Ga0207689_10136499
773 Ga0207679_10119818
774 Ga0207712_10001887
775 Ga0207712_10980928
776 Ga0207640_10047236
777 Ga0207640_10261706
778 Ga0207658_10017807
779 Ga0207677_10338993
780 Ga0207703_10001755
781 Ga0207703_10839723
782 Ga0207639_10000149
783 Ga0207639_10089675
784 Ga0207639_10110927
785 Ga0207678_10000322
786 Ga0207708_11756238
787 Ga0207702_10013540
788 Ga0207702_10295594
789 Ga0207702_10795055
790 Ga0207648_10121241
791 Ga0207676_10069733
792 Ga0207674_10053706
793 Ga0207674_10188175
794 Ga0207674_10437604
795 Ga0207683_10289412
796 Ga0207683_11218201
797 Ga0207698_10215362
798 Ga0207698_10612718
799 Ga0207698_11176132
800 Ga0207698_11591649
801 Ga0209282_1000396
802 Ga0268266_10000008
803 Ga0268266_10092561
804 Ga0268265_10100866
805 Ga0268265_10997023
806 Ga0268264_10121503
807 Ga0307517_10003456
808 Ga0307517_10010725
809 Ga0307512_10183025
810 Ga0316177_1071078
811 Ga0316177_1176124
812 Ga0316176_1209518
813 Ga0314311_1033180
814 Ga0316179_1023673
815 Ga0316183_1018963
816 Ga0316182_1042700
817 Ga0316182_1117144
818 Ga0265316_10107431
819 Ga0307513_10071529
820 Ga0307513_10183162
821 Ga0307513_10416545
822 Ga0307408_100061926
823 Ga0307408_100318426
824 Ga0307508_10001470
825 Ga0307508_10133118
826 Ga0307508_10484120
827 Ga0307514_10002998
828 Ga0307516_10217238
829 Ga0307516_10230895
830 Ga0307405_10018065
831 Ga0307405_10179809
832 Ga0307406_10059303
833 Ga0307412_10013139
834 Ga0307412_10075473
835 Ga0307409_100363494
836 Ga0307416_100030371
837 Ga0307510_10012669
838 Ga0307510_10153580
839 Ga0307510_10246632
840 Ga0373932_0002640
841 Ga0373931_0001535
842 Ga0395905_0000493
843 Ga0395905_1751640
844 Ga0439436_0007020
845 Ga0439466_0056395
846 Ga0439465_0330405
847 Ga0451791_0180970
848 Ga0451793_1390022
849 Ga0451795_1079425
850 Ga0451839_0052803
851 Ga0451839_1043122
852 Ga0451841_0321725
853 Ga0439449_0047423
854 Ga0439455_0023457
855 Ga0450920_009735
856 Ga0450921_000031
857 Ga0450923_000996
858 Ga0450897_002505
859 Ga0450896_035280
860 Ga0450906_002945
861 Ga0450907_029923
862 Ga0450910_000740
863 Ga0450908_002965
864 Ga0450909_002035
865 Ga0439434_0007945
866 Ga0450918_001418
867 Ga0466972_0139897
868 Ga0466965_0019588
869 Ga0466966_0021397
870 Ga0453684_0115286
871 Ga0466959_0046788
872 Ga0495627_017527
873 Ga0495627_072170
874 Ga0495592_0566156
875 Ga0495638_0293189
876 Ga0495650_0000552
877 Ga0495605_0025330
878 Ga0495596_0000761
879 Ga0495616_0000779
880 Ga0495620_0047243
881 Ga0495620_0076277
882 Ga0495631_0000541
883 Ga0495632_0000052
884 Ga0495637_0007191
885 Ga0495637_0018601
886 Ga0495643_0019267
887 Ga0495643_0044717
888 Ga0495654_0001438
889 Ga0495654_0114076
890 Ga0495609_0000877
891 Ga0495609_0405894
892 Ga0495621_0010792
893 Ga0495622_0075617
894 Ga0495622_0314671
895 Ga0495625_0000360
896 Ga0495625_0023660
897 Ga0495625_0106933
898 Ga0495625_0316913
899 Ga0495635_0778623
900 Ga0495661_0003121
901 Ga0495670_0058666
902 Ga0495671_0029634
903 Ga0495649_0191037
904 Ga0495589_0005651
905 Ga0495660_0034725
906 Ga0495660_0054694
907 Ga0495676_0047130
908 Ga0495676_0070732
909 Ga0495676_0076736
910 Ga0495683_0006326
911 Ga0495673_0062730
912 Ga0495593_0022029
913 Ga0495593_0054522
914 Ga0495614_0014605
915 Ga0495626_0074800
916 Ga0496101_0004592
917 Ga0496102_0127532
918 Ga0496116_0008418
919 Ga0496116_0016028
920 Ga0496117_0011303
921 Ga0496117_0020139
922 Ga0496117_0094531
923 Ga0496117_0187156
924 Ga0496118_0031024
925 Ga0496118_0034038
926 Ga0496119_0080799
927 Ga0496119_0364351
928 Ga0496121_0060263
929 Ga0496121_0063217
930 Ga0496121_0122188
931 Ga0496122_0069134
932 Ga0496122_0171565
933 Ga0496123_0022751
934 Ga0496123_0219327
935 Ga0496124_0033305
936 Ga0496124_0034571
937 Ga0496124_0104194
938 Ga0496124_0146591
939 Ga0496124_0607378
940 Ga0496125_0018296
941 Ga0496125_0032876
942 Ga0496125_0129981
943 Ga0496125_0206601
944 Ga0496125_0290235
945 Ga0496125_0393542
946 Ga0495678_068583
947 Ga0501249_008325
948 Ga0501257_055813
949 Ga0501221_012600
950 Ga0501262_003325
951 nmdc:mga03683_54525_c1
952 nmdc:mga03683_8775_c1
953 nmdc:mga03n38_58895_c1
954 nmdc:mga03n38_70268_c1
955 nmdc:mga00v17_4332_c2
956 nmdc:mga00v17_71967_c1
957 nmdc:mga0k408_17956_c1
958 nmdc:mga0k408_23136_c1
959 nmdc:mga0k408_69806_c1
960 nmdc:mga0k408_98069_c1
961 nmdc:mga06z11_30545_c1
962 nmdc:mga06z11_35027_c1
963 nmdc:mga04h51_65321_c1
964 nmdc:mga07m45_2246_c1
965 nmdc:mga07m45_323548_c1
966 nmdc:mga07m45_3872_c1
967 nmdc:mga07m45_65411_c1
968 nmdc:mga07m45_9332_c1
969 nmdc:mga08y16_67816_c1
970 nmdc:mga0rr50_501_c1
971 nmdc:mga0a205_635_c1
972 nmdc:mga0sz30_133106_c1
973 Ga0500643_059056
974 Ga0500651_0000234
975 Ga0500566_0026342
976 Ga0500641_0178334
977 Ga0500571_000076
978 Ga0500572_147837
979 Ga0500593_000376
980 Ga0500607_000797
981 Ga0500607_042257
982 Ga0500607_224223
983 Ga0500608_005472
984 Ga0500626_010324
985 Ga0500652_022136
986 Ga0500655_007758
987 Ga0500658_0000096
988 Ga0500658_0000100
989 Ga0500659_0277033
990 Ga0500559_0428128
991 Ga0500564_050343
992 Ga0500568_0015435
993 Ga0500574_047681
994 Ga0500590_008884
995 Ga0500616_0014229
996 Ga0500624_032042
997 Ga0500627_0002295
998 Ga0500634_0008482
999 Ga0500638_106603
1000 Ga0500625_146997
1001 Ga0500596_014953
1002 Ga0466962_0064675
1003 2513231506
1004 2599627018
1005 2599676621
1006 2599684889
1007 2599696675
1008 2644161575
1009 2644326933
1010 2644401097
1011 2738723537
1012 2738882165
1013 2739284268
1014 2819598093
1015 2831269084
1016 2838058510
1017 2842682193
1018 2885200106
1019 2885213663
1020 2899929513
1021 2904543411
1022 2928040041
1023 2928047210
1024 2928057590
1025 2928068027
1026 2928072607
1027 2928085778
1028 2929160644
1029 2945914885
1030 2945951071
1031 2945989715
1032 2954769526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sjr-assembly2.cif.gz_C crystal structure of conserved unkown function protein cv_1783 from chromobacterium violaceum atcc 12472 0.4099 64 160
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.3981 16 161
2d29-assembly1.cif.gz_A structural study on project id tt0172 from thermus thermophilus hb8 0.3609 13 157
6wy9-assembly1.cif.gz_A-2 tcur3481-tcur3483 steroid acad g363a variant 0.3607 12 161
7y0a-assembly1.cif.gz_B crystal structure of human short-chain acyl-coa dehydrogenase 0.3606 13 156
ID Description Score Start End Superfamily
af_C3JXE0_33_145_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5641 67 157 1.20.1070.10
af_Q5VW38_215_438_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5446 67 157 1.20.1070.10
af_I1N7G8_11_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.529 72 160 1.20.140.40
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4724 11 156 1.10.357.20
af_D4ADC8_207_336_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4669 51 162 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A840FUP0-F1-model_v4 DUF2809 domain-containing protein 0.9199 1 165 GO:0016020
AF-A0A2W5Q3N6-F1-model_v4 Uncharacterized protein 0.9005 11 157 GO:0016020
AF-A0A7V9G8Z3-F1-model_v4 Uncharacterized protein 0.8973 8 160 GO:0016020
AF-A0A4R5W6N1-F1-model_v4 Uncharacterized protein 0.8969 16 161 GO:0016020
AF-A0A7U3C7Q4-F1-model_v4 deleted 0.8967 1 161

Map