F458056

General Info

Members Datasets Scaffolds Average Seq Length
516 430 1032 277

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0050445|Ga0496121_0050445_307_1203
Length 298
Sequence MSTANQHHRGTLAAAESAARNGTSXXXTAGSARDAGSTRFPLPRIDAAHAATLITILALLAGWWLASHLQWVPAVLLPPPETVIGKLAQLSTEGFDDATLGQHLFASLSRIALAFALALVTAIPAGLLIATNRIARGVLDPVIEFYRPIPPLAYLPLMVIWFGIGELSKVLLIYLTIFAPLTIATAAGASRVAKSRLLAAASLGATRYKLLRYVVLPSALPDILTGLRIALGAGWSTLVAAELIAATRGLGFMVYSASRFLVTDVVIAGILVIGAIALILELGLRWLQRKLTPWHAGH

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
44 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
158 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
159 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
162 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
163 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
164 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
165 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
166 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
167 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
168 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
169 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
170 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
171 2512875024
172 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
173 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
174 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
175 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
176 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
177 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
178 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
179 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
180 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
181 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
182 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
183 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
184 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
185 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
186 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
187 2643221557 Ensifer sp. Root558 Isolate Unclassified
188 2643221568 Rhizobium sp. Root564 Isolate Unclassified
189 2643221607 Rhizobium sp. Root73 Isolate Unclassified
190 2643221610 Ensifer sp. Root74 Isolate Unclassified
191 2643221618 Ensifer sp. Root231 Isolate Unclassified
192 2643221626 Ensifer sp. Root31 Isolate Unclassified
193 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
194 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
195 2643221655 Ensifer sp. Root1252 Isolate Unclassified
196 2643221659 Ensifer sp. Root127 Isolate Unclassified
197 2643221668 Ensifer sp. Root423 Isolate Unclassified
198 2643221675 Ensifer sp. Root1298 Isolate Unclassified
199 2643221680 Ensifer sp. Root1312 Isolate Unclassified
200 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
201 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
202 2643221698 Ensifer sp. Root142 Isolate Unclassified
203 2643221712 Ensifer sp. Root258 Isolate Unclassified
204 2643221718 Rhizobium sp. Root268 Isolate Unclassified
205 2643221723 Ensifer sp. Root278 Isolate Unclassified
206 2643221726 Ensifer sp. Root954 Isolate Unclassified
207 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
208 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
209 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
210 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
211 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
212 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
213 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
214 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
215 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
216 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
217 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
218 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
219 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
220 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
221 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
222 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
223 2844163670 Ensifer sp. 1H6 Isolate Unclassified
224 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
225 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
226 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
227 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
228 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
229 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
230 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
231 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
232 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
233 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
234 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
235 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
236 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
237 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
238 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
239 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
240 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
241 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
242 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
243 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
244 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
245 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
246 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
247 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
248 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
249 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
250 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
251 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
252 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
253 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
254 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
255 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
256 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
257 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
258 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
259 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
260 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
261 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
262 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
263 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
264 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
265 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
266 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
267 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
268 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
269 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
270 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
271 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
272 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
273 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
274 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
275 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
276 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
277 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
278 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
279 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
280 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
281 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
282 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
283 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
284 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
285 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
286 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
287 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
288 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
289 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
290 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
291 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
292 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
293 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
294 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
295 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
296 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
297 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
298 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
299 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
300 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
301 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
302 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
303 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
304 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
305 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
306 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
307 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
308 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
309 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
310 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
311 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
312 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
313 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
314 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
315 2932401849 Devosia sp. 2618 Isolate Rhizosphere
316 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
317 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
318 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
319 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
320 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
321 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
322 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
323 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
324 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
325 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
326 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
327 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
328 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
329 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
330 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
331 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
332 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
333 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
334 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
335 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
336 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
337 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
338 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
339 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
340 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
341 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
342 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
343 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
344 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
345 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
346 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
347 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
348 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
349 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
350 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
351 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
352 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
353 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
354 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
355 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
356 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
357 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
358 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
359 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
360 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
361 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
362 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
363 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
364 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
365 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
366 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
367 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
368 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
369 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
370 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
371 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
372 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
373 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
374 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
375 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
376 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
377 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
378 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
379 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
380 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
381 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
382 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
383 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
384 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
385 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
386 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
387 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
388 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
389 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
390 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
391 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
392 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
393 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
394 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
395 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
396 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
397 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
398 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
399 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
400 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
401 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
402 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
403 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
404 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
405 3004167301 Mesorhizobium loti 582 Isolate Unclassified
406 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
407 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
408 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
409 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
410 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
411 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
412 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
413 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
414 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
415 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
416 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
417 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
418 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
419 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
420 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
421 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
422 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
423 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
424 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
425 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
426 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
427 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
428 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
429 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
430 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 47.48
Metatranscriptomes 0
Isolates 52.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 19.19
Nodule 37.21
Rhizoplane 0.58
Rhizosphere 24.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0050445 3300048924 Bacteria 3516
2 JGI24735J21928_10038080 3300002067 Bacteria 1408
3 JGI25156J39149_1018789 3300002705 Bacteria 1267
4 JGI25158J39367_1000270 3300002739 Bacteria 11802
5 JGI25157J39369_1003828 3300002741 Bacteria 2933
6 JGI25152J39213_1003426 3300002773 Bacteria 5422
7 JGI25152J39213_1010771 3300002773 Bacteria 2066
8 JGI25150J39212_1001197 3300002774 Bacteria 7688
9 JGI25159J45721_1000563 3300002987 Bacteria 16655
10 JGI25159J45721_1000661 3300002987 Bacteria 15285
11 JGI25151J46595_10003579 3300003187 Bacteria 8518
12 JGI25151J46595_10067982 3300003187 Bacteria 1095
13 JGI25153J46596_10000066 3300003215 Bacteria 123268
14 JGI25153J46596_10007864 3300003215 Bacteria 5175
15 JGI25160J50197_1000820 3300003354 Bacteria 16655
16 JGI25160J50197_1008401 3300003354 Bacteria 3938
17 JGI25161J50226_1000289 3300003374 Bacteria 28340
18 JGI25161J50226_1002468 3300003374 Bacteria 4719
19 Ga0055526_1001598 3300003771 Bacteria 15895
20 Ga0055526_1006061 3300003771 Bacteria 6690
21 Ga0055524_1002668 3300003775 Bacteria 9035
22 Ga0055524_1012961 3300003775 Bacteria 3171
23 Ga0055524_1019036 3300003775 Bacteria 2361
24 Ga0055536_1001086 3300003781 Bacteria 17117
25 Ga0055528_1004598 3300003790 Bacteria 6610
26 Ga0055540_1013800 3300003792 Bacteria 2445
27 Ga0055540_1017042 3300003792 Bacteria 2041
28 Ga0055531_10016501 3300003794 Bacteria 3181
29 Ga0055543_1000023 3300004625 Bacteria 140513
30 Ga0055543_1000727 3300004625 Bacteria 16693
31 Ga0065165_1002311 3300005262 Bacteria 16693
32 Ga0065165_1014552 3300005262 Bacteria 3048
33 Ga0070711_100285334 3300005439 Bacteria 1308
34 Ga0068853_100011643 3300005539 Bacteria 7149
35 Ga0068853_100310947 3300005539 Bacteria 1459
36 Ga0070665_100150042 3300005548 Bacteria 2334
37 Ga0070665_100357281 3300005548 Bacteria 1467
38 Ga0070664_100111217 3300005564 Bacteria 2391
39 Ga0068856_100261346 3300005614 Bacteria 1746
40 Ga0068870_10206961 3300005840 Bacteria 1193
41 Ga0068862_100313273 3300005844 Bacteria 1447
42 Ga0075365_10067131 3300006038 Bacteria 2407
43 Ga0075365_10067848 3300006038 Bacteria 2395
44 Ga0075365_10337354 3300006038 Bacteria 1062
45 Ga0070715_10092544 3300006163 Bacteria 1394
46 Ga0075362_10026824 3300006177 Bacteria 2463
47 Ga0075367_10067180 3300006178 Bacteria 2149
48 Ga0075367_10124465 3300006178 Bacteria 1590
49 Ga0075367_10256632 3300006178 Bacteria 1097
50 Ga0075370_10031152 3300006353 Bacteria 2977
51 Ga0075428_100295041 3300006844 Bacteria 1743
52 Ga0075428_100605910 3300006844 Bacteria 1170
53 Ga0105240_10065519 3300009093 Bacteria 4509
54 Ga0114129_10882835 3300009147 Bacteria 1134
55 Ga0105237_10257163 3300009545 Bacteria 1748
56 Ga0105238_10048642 3300009551 Bacteria 4272
57 Ga0105249_10110180 3300009553 Bacteria 2601
58 Ga0105239_10187910 3300010375 Bacteria 2312
59 Ga0105239_10330002 3300010375 Bacteria 1721
60 Ga0157369_10037593 3300013105 Bacteria 5300
61 Ga0171463_1016 3300013249 Bacteria 62129
62 Ga0157380_10209917 3300014326 Bacteria 1734
63 Ga0183363_1267 3300015690 Bacteria 8408
64 Ga0209436_100053 3300025208 Bacteria 63474
65 Ga0209436_100712 3300025208 Bacteria 13940
66 Ga0207425_1000968 3300025245 Bacteria 13512
67 Ga0207425_1015882 3300025245 Bacteria 1681
68 Ga0209026_1000141 3300025250 Bacteria 114545
69 Ga0209148_1000111 3300025254 Bacteria 198095
70 Ga0209148_1019152 3300025254 Bacteria 1140
71 Ga0209759_1000354 3300025256 Bacteria 59742
72 Ga0209129_1003607 3300025258 Bacteria 6618
73 Ga0209129_1006383 3300025258 Bacteria 3829
74 Ga0209233_1032775 3300025261 Bacteria 1198
75 Ga0209455_1000206 3300025272 Bacteria 84430
76 Ga0209130_1000031 3300025284 Bacteria 322932
77 Ga0209130_1001334 3300025284 Bacteria 16707
78 Ga0209676_1001434 3300025292 Bacteria 22507
79 Ga0209025_1000121 3300025294 Bacteria 208700
80 Ga0209025_1005690 3300025294 Bacteria 10037
81 Ga0209025_1007351 3300025294 Bacteria 8243
82 Ga0209564_1000081 3300025295 Bacteria 261592
83 Ga0209564_1000826 3300025295 Bacteria 42101
84 Ga0209758_1000028 3300025297 Bacteria 530102
85 Ga0209758_1011158 3300025297 Bacteria 5246
86 Ga0209758_1011779 3300025297 Bacteria 5009
87 Ga0209758_1014158 3300025297 Bacteria 4271
88 Ga0209050_1000852 3300025298 Bacteria 41567
89 Ga0209256_1000639 3300025299 Bacteria 47642
90 Ga0209256_1002527 3300025299 Bacteria 14697
91 Ga0209256_1003364 3300025299 Bacteria 11321
92 Ga0207426_1000042 3300025302 Bacteria 433289
93 Ga0207426_1001728 3300025302 Bacteria 16707
94 Ga0209051_1003025 3300025303 Bacteria 11387
95 Ga0209051_1013148 3300025303 Bacteria 3956
96 Ga0209051_1086325 3300025303 Bacteria 888
97 Ga0209257_1001851 3300025304 Bacteria 23010
98 Ga0209257_1029949 3300025304 Bacteria 1763
99 Ga0207647_10043176 3300025904 Bacteria 2822
100 Ga0207685_10074953 3300025905 Bacteria 1383
101 Ga0207663_10019446 3300025916 Bacteria 3826
102 Ga0207694_10031155 3300025924 Bacteria 4073
103 Ga0207694_10049985 3300025924 Bacteria 3237
104 Ga0207700_10275159 3300025928 Bacteria 1446
105 Ga0207669_10238552 3300025937 Bacteria 1346
106 Ga0207665_10357454 3300025939 Bacteria 1104
107 Ga0207679_10194098 3300025945 Bacteria 1691
108 Ga0207667_10355538 3300025949 Bacteria 1494
109 Ga0207667_10450037 3300025949 Bacteria 1309
110 Ga0207639_10297492 3300026041 Bacteria 1425
111 Ga0207675_100002563 3300026118 Bacteria 18003
112 Ga0268266_10019827 3300028379 Bacteria 5731
113 Ga0265318_10016718 3300028577 Bacteria 3023
114 Ga0307515_10022779 3300028794 Bacteria 11022
115 Ga0307515_10024806 3300028794 Bacteria 10418
116 Ga0265338_10038152 3300028800 Bacteria 4557
117 Ga0265324_10019345 3300029957 Bacteria 2454
118 Ga0265330_10033198 3300031235 Bacteria 2310
119 Ga0265325_10003181 3300031241 Bacteria 10801
120 Ga0265340_10132951 3300031247 Bacteria 1140
121 Ga0265339_10001174 3300031249 Bacteria 19772
122 Ga0265331_10001404 3300031250 Bacteria 17682
123 Ga0265331_10033771 3300031250 Bacteria 2528
124 Ga0265331_10068817 3300031250 Bacteria 1659
125 Ga0265327_10001987 3300031251 Bacteria 23267
126 Ga0265316_10015822 3300031344 Bacteria 6573
127 Ga0307513_10003256 3300031456 Bacteria 22138
128 Ga0307513_10024760 3300031456 Bacteria 6977
129 Ga0307513_10102828 3300031456 Bacteria 2875
130 Ga0265313_10000523 3300031595 Bacteria 40161
131 Ga0265313_10001290 3300031595 Bacteria 23699
132 Ga0265314_10040368 3300031711 Bacteria 3350
133 Ga0265314_10055239 3300031711 Bacteria 2743
134 Ga0265342_10010921 3300031712 Bacteria 6246
135 Ga0265342_10045329 3300031712 Bacteria 2647
136 Ga0307406_10244809 3300031901 Bacteria 1347
137 Ga0373927_0141317 3300035695 Bacteria 1575
138 Ga0373937_0107899 3300036401 Bacteria 2589
139 Ga0395899_0047144 3300037312 Bacteria 3209
140 Ga0395900_0000021 3300037418 Bacteria 351144
141 Ga0395900_0297530 3300037418 Bacteria 1601
142 Ga0395898_0002409 3300037466 Bacteria 22197
143 Ga0395905_0000912 3300037471 Bacteria 38176
144 Ga0395905_0025305 3300037471 Bacteria 5597
145 Ga0395901_0014520 3300038443 Bacteria 8009
146 Ga0436365_1709922 3300039437 Bacteria 2478
147 Ga0436361_0095035 3300039447 Bacteria 4270
148 Ga0439465_0036161 3300041413 Bacteria 1585
149 Ga0466972_0018590 3300044658 Bacteria 3476
150 Ga0466965_0001487 3300044683 Bacteria 9485
151 Ga0466966_0007644 3300044684 Bacteria 7163
152 Ga0466961_0037548 3300044693 Bacteria 3107
153 Ga0466961_0292673 3300044693 Bacteria 995
154 Ga0466964_0056330 3300044706 Bacteria 1625
155 Ga0466970_0008194 3300044765 Bacteria 5248
156 Ga0466957_0087624 3300044842 Bacteria 1947
157 Ga0495638_0014130 3300046460 Bacteria 5406
158 Ga0495610_0041751 3300046512 Bacteria 2300
159 Ga0495610_0091584 3300046512 Bacteria 1377
160 Ga0495643_0052753 3300046522 Bacteria 2182
161 Ga0495648_0186718 3300046524 Bacteria 1049
162 Ga0495597_0104515 3300046542 Bacteria 1192
163 Ga0495625_0054747 3300046660 Bacteria 2848
164 Ga0495625_0196167 3300046660 Bacteria 1335
165 Ga0495588_0208511 3300046674 Bacteria 1032
166 Ga0495681_0063185 3300047470 Bacteria 1700
167 Ga0495686_0104364 3300047472 Bacteria 1707
168 Ga0495686_0175082 3300047472 Bacteria 1246
169 Ga0495626_0081406 3300048091 Bacteria 1438
170 Ga0496106_0000401 3300048909 Bacteria 30792
171 Ga0496112_0065977 3300048915 Bacteria 3572
172 Ga0496116_0000233 3300048919 Bacteria 102081
173 Ga0496117_0001463 3300048920 Bacteria 34016
174 Ga0496117_0255224 3300048920 Bacteria 954
175 Ga0496118_0036064 3300048921 Bacteria 4004
176 Ga0496118_0103818 3300048921 Bacteria 1910
177 Ga0496119_0001035 3300048922 Bacteria 35586
178 Ga0496120_0002869 3300048923 Bacteria 16553
179 Ga0496120_0067307 3300048923 Bacteria 1979
180 Ga0496121_0007775 3300048924 Bacteria 12839
181 Ga0496121_0206842 3300048924 Bacteria 1394
182 Ga0496121_0225315 3300048924 Bacteria 1317
183 Ga0496121_0236407 3300048924 Bacteria 1276
184 Ga0496122_0001329 3300048925 Bacteria 40484
185 Ga0496122_0008279 3300048925 Bacteria 11277
186 Ga0496123_0000018 3300048926 Bacteria 404553
187 Ga0496123_0001422 3300048926 Bacteria 33457
188 Ga0496123_0061037 3300048926 Bacteria 2426
189 Ga0496124_0000940 3300048927 Bacteria 46669
190 Ga0496124_0070672 3300048927 Bacteria 2895
191 Ga0496125_0000161 3300048928 Bacteria 150707
192 Ga0496125_0000221 3300048928 Bacteria 116650
193 Ga0496125_0274251 3300048928 Bacteria 1049
194 Ga0496126_0000212 3300048929 Bacteria 128871
195 Ga0496126_0000421 3300048929 Bacteria 85210
196 Ga0496126_0001037 3300048929 Bacteria 46997
197 Ga0496126_0100786 3300048929 Bacteria 2527
198 Ga0496126_0121662 3300048929 Bacteria 2263
199 Ga0496126_0145305 3300048929 Bacteria 2038
200 Ga0496126_0244142 3300048929 Bacteria 1499
201 Ga0501036_0236381 3300049572 Bacteria 1533
202 Ga0501043_0055857 3300049579 Bacteria 3102
203 Ga0501043_0113091 3300049579 Bacteria 2132
204 Ga0501047_0710094 3300049581 Bacteria 823
205 Ga0501070_0099750 3300049586 Bacteria 2403
206 Ga0501070_0211260 3300049586 Bacteria 1593
207 Ga0501073_0115941 3300049589 Bacteria 1856
208 Ga0501079_0454631 3300049741 Bacteria 1006
209 Ga0501080_0301528 3300049742 Bacteria 1453
210 Ga0501080_0310757 3300049742 Bacteria 1428
211 Ga0501080_0522556 3300049742 Bacteria 1059
212 Ga0501083_0084433 3300049744 Bacteria 2102
213 Ga0501044_0077274 3300049823 Bacteria 3377
214 nmdc:mga00v17_36310_c1 3300050491 Bacteria 2936
215 nmdc:mga0yw44_14370_c1 3300050492 Bacteria 4203
216 nmdc:mga0yw44_146641_c1 3300050492 Bacteria 1537
217 nmdc:mga0yw44_21463_c1 3300050492 Bacteria 3602
218 nmdc:mga06z11_90902_c1 3300050494 Bacteria 1657
219 nmdc:mga08y16_86642_c1 3300050511 Bacteria 3264
220 nmdc:mga0sz30_54198_c1 3300050516 Bacteria 1705
221 Ga0500610_0075848 3300053079 Bacteria 1753
222 Ga0500644_0024731 3300053088 Bacteria 1839
223 Ga0500556_0000199 3300053104 Bacteria 49258
224 Ga0500572_002031 3300053111 Bacteria 5040
225 Ga0500594_0029275 3300053118 Bacteria 1439
226 Ga0500658_0090920 3300053134 Bacteria 1320
227 Ga0500559_0007036 3300053136 Bacteria 5025
228 Ga0500568_0000004 3300053139 Bacteria 621666
229 Ga0500568_0015840 3300053139 Bacteria 3364
230 Ga0500568_0043291 3300053139 Bacteria 1800
231 Ga0500577_0057322 3300053142 Bacteria 1486
232 Ga0500604_0017549 3300053151 Bacteria 1983
233 Ga0500604_0060622 3300053151 Bacteria 1187
234 Ga0500604_0061790 3300053151 Bacteria 1178
235 Ga0500616_0045242 3300053153 Bacteria 2346
236 Ga0500616_0077664 3300053153 Bacteria 1676
237 Ga0500620_007038 3300053155 Bacteria 2748
238 Ga0500620_056394 3300053155 Bacteria 1329
239 Ga0500622_0000343 3300053156 Bacteria 45668
240 Ga0500622_0004607 3300053156 Bacteria 8558
241 Ga0500627_0074170 3300053158 Bacteria 1510
242 Ga0500633_0007428 3300053160 Bacteria 2759
243 Ga0500636_0001782 3300053177 Bacteria 11796
244 Ga0500645_030683 3300053730 Bacteria 1617
245 Ga0501084_0105956 3300054114 Bacteria 2362
246 2503198881 2503198000 Bacteria 6884444
247 2509117909 2508501123 Bacteria 6283661
248 2509368891 2509276018 Bacteria 6910194
249 2509393696 2509276022 Bacteria 6200534
250 2510315219 2510065059 Bacteria 6847884
251 2510840237 2510461069 Bacteria 5505000
252 2511137280 2510917022 Bacteria 6504556
253 2511195215 2510917030 Bacteria 7460662
254 2511389561 2511231027 Bacteria 5013807
255 2512933724 2512875016 Bacteria 6529530
256 2512961889 2512875024 Bacteria 7195110
257 2514035443 2513237164 Bacteria 7563725
258 2514421955 2513237305 Bacteria 7293571
259 2524452002 2524023207 Bacteria 6813453
260 2585164364 2582581283 Bacteria 6030556
261 2585222314 2582581298 Bacteria 7315509
262 2585264605 2582581306 Bacteria 6450535
263 2585274107 2582581307 Bacteria 6597605
264 2585389973 2582581865 Bacteria 6644329
265 2585544733 2585427529 Bacteria 7395659
266 2585560557 2585427531 Bacteria 6992870
267 2585898769 2585427608 Bacteria 6544331
268 2585903660 2585427609 Bacteria 6667127
269 2587981221 2585428125 Bacteria 6662905
270 2588519807 2588253730 Bacteria 6881675
271 2600197117 2599185352 Bacteria 7228948
272 2643804840 2643221557 Bacteria 7184309
273 2643853944 2643221568 Bacteria 5187270
274 2644051701 2643221607 Bacteria 6314006
275 2644067379 2643221610 Bacteria 7480339
276 2644104275 2643221618 Bacteria 7717186
277 2644148038 2643221626 Bacteria 8069654
278 2644200185 2643221636 Bacteria 6583769
279 2644206990 2643221637 Bacteria 5345260
280 2644310233 2643221655 Bacteria 7722067
281 2644333439 2643221659 Bacteria 7890716
282 2644378855 2643221668 Bacteria 7306521
283 2644418467 2643221675 Bacteria 7473456
284 2644451834 2643221680 Bacteria 7473610
285 2644480569 2643221686 Bacteria 6310811
286 2644498721 2643221689 Bacteria 6042950
287 2644543709 2643221698 Bacteria 7756764
288 2644616778 2643221712 Bacteria 7729434
289 2644650638 2643221718 Bacteria 5345506
290 2644675178 2643221723 Bacteria 7095460
291 2644691007 2643221726 Bacteria 7455827
292 2688596157 2687453392 Bacteria 6880454
293 2692318989 2690316117 Bacteria 6800650
294 2694636824 2693429784 Bacteria 7241525
295 2723573295 2721755686 Bacteria 7343952
296 2739350915 2738543031 Bacteria 5769731
297 2753459283 2751185821 Bacteria 6189929
298 2756673554 2756170246 Bacteria 7451806
299 2776269684 2775506902 Bacteria 6208009
300 2776282613 2775506904 Bacteria 5954060
301 2776916039 2775507049 Bacteria 6284736
302 2793281448 2791355253 Bacteria 5171699
303 2842510548 2842509118 Bacteria 6850950
304 2842872622 2842871566 Bacteria 4827117
305 2843690988 2843690924 Bacteria 5169057
306 2844003278 2844002411 Bacteria 7168230
307 2844010961 2844009547 Bacteria 6728125
308 2844165048 2844163670 Bacteria 7266046
309 2844538837 2844533157 Bacteria 7517899
310 2847422509 2847417321 Bacteria 6913799
311 2848998082 2848992105 Bacteria 6810864
312 2852390982 2852387548 Bacteria 8025568
313 2855875846 2855872281 Bacteria 6964271
314 2856324072 2856320880 Bacteria 7263508
315 2856329439 2856328259 Bacteria 6528202
316 2856335080 2856334872 Bacteria 7037011
317 2856367386 2856364286 Bacteria 6939991
318 2857353097 2857349434 Bacteria 7926032
319 2857370410 2857367948 Bacteria 6965560
320 2869174242 2869169390 Bacteria 6659796
321 2869239196 2869234852 Bacteria 6654993
322 2869246630 2869242130 Bacteria 6609239
323 2869256583 2869249662 Bacteria 6868783
324 2869257582 2869256925 Bacteria 6981691
325 2869270091 2869264136 Bacteria 6880765
326 2869271627 2869271264 Bacteria 6908218
327 2869282403 2869278585 Bacteria 7077053
328 2869288527 2869285874 Bacteria 6901219
329 2871431194 2871429161 Bacteria 6547891
330 2871443380 2871435913 Bacteria 6880295
331 2871452047 2871451962 Bacteria 7336357
332 2871465277 2871459585 Bacteria 6866887
333 2871473469 2871466892 Bacteria 6923287
334 2871478539 2871474448 Bacteria 6806570
335 2871481547 2871481445 Bacteria 6700002
336 2871498818 2871495908 Bacteria 6935695
337 2874123516 2874116593 Bacteria 6674494
338 2874126292 2874123672 Bacteria 7238285
339 2874134451 2874131515 Bacteria 6820270
340 2874142766 2874139085 Bacteria 7021506
341 2874150569 2874146452 Bacteria 7533118
342 2874158309 2874155637 Bacteria 6724144
343 2874163671 2874162495 Bacteria 6174670
344 2874170527 2874168670 Bacteria 8062617
345 2876364021 2876363079 Bacteria 6544991
346 2876392592 2876386047 Bacteria 6698674
347 2876399059 2876392853 Bacteria 6660880
348 2876401116 2876399893 Bacteria 6927900
349 2876407901 2876406927 Bacteria 6191900
350 2876416617 2876413966 Bacteria 6831344
351 2876427225 2876420981 Bacteria 6687741
352 2878739796 2878738818 Bacteria 7136951
353 2878747798 2878745973 Bacteria 6867388
354 2878763036 2878760144 Bacteria 6823465
355 2878770006 2878767105 Bacteria 6898628
356 2878774498 2878774303 Bacteria 6108671
357 2878788311 2878781027 Bacteria 6834456
358 2881148372 2881147464 Bacteria 7779814
359 2881158314 2881155292 Bacteria 6461656
360 2881165156 2881161766 Bacteria 7127907
361 2882635234 2882632389 Bacteria 8154593
362 2885307034 2885305155 Bacteria 7348390
363 2885329031 2885326080 Bacteria 7134805
364 2885348590 2885342637 Bacteria 7011821
365 2885357491 2885350715 Bacteria 6787678
366 2888343545 2888337043 Bacteria 6629336
367 2888353371 2888350351 Bacteria 7372807
368 2889015087 2889010040 Bacteria 6749192
369 2889019838 2889016732 Bacteria 6700763
370 2891376951 2891373044 Bacteria 5202277
371 2903453880 2903448605 Bacteria 7357801
372 2903502279 2903492973 Bacteria 13473544
373 2903525820 2903521522 Bacteria 6525694
374 2903532634 2903528002 Bacteria 6586099
375 2903543620 2903540706 Bacteria 7062119
376 2904615879 2904615490 Bacteria 10047340
377 2904665586 2904659560 Bacteria 6685615
378 2906310971 2906308376 Bacteria 6841989
379 2906323082 2906321335 Bacteria 6579571
380 2906366076 2906363423 Bacteria 6856682
381 2906375629 2906370794 Bacteria 6881062
382 2906385751 2906378014 Bacteria 6911440
383 2906391742 2906386501 Bacteria 5977019
384 2906394420 2906393657 Bacteria 6790866
385 2906403154 2906401398 Bacteria 6693206
386 2906408991 2906408224 Bacteria 6162342
387 2906429072 2906427513 Bacteria 6375796
388 2919102880 2919100787 Bacteria 7710546
389 2922137751 2922130491 Bacteria 7173936
390 2922153576 2922151315 Bacteria 6902399
391 2922173263 2922172374 Bacteria 6167644
392 2922192793 2922185730 Bacteria 7113964
393 2924717801 2924710171 Bacteria 6752351
394 2924719079 2924718760 Bacteria 6331356
395 2924740595 2924733363 Bacteria 7574837
396 2924741756 2924741084 Bacteria 6661321
397 2924753113 2924748358 Bacteria 6154725
398 2924768710 2924762789 Bacteria 6561353
399 2924777417 2924776078 Bacteria 7492003
400 2932405046 2932401849 Bacteria 4262978
401 2937815512 2937813078 Bacteria 7783518
402 2937822828 2937822353 Bacteria 7290551
403 2937838872 2937836603 Bacteria 6811263
404 2937852717 2937848649 Bacteria 6983481
405 2937864389 2937861824 Bacteria 6660327
406 2937880436 2937877337 Bacteria 7246526
407 2937975766 2937972304 Bacteria 7532020
408 2937986473 2937980651 Bacteria 6517427
409 2937997466 2937994558 Bacteria 7036190
410 2939671943 2939669807 Bacteria 5028511
411 2941503970 2941499720 Bacteria 7599444
412 2957444696 2957443900 Bacteria 6869977
413 2958038261 2958034702 Bacteria 6989922
414 2958050987 2958041894 Bacteria 13082850
415 2958057325 2958041894 Bacteria 13082850
416 2958072331 2958071322 Bacteria 6815895
417 2958087571 2958084443 Bacteria 7312792
418 2958100427 2958092219 Bacteria 6861151
419 2958105005 2958100919 Bacteria 6800575
420 2958116253 2958115193 Bacteria 6923548
421 2958129575 2958122699 Bacteria 7280457
422 2958132929 2958130278 Bacteria 6897202
423 2958142292 2958137437 Bacteria 6050276
424 2958161392 2958158011 Bacteria 6058449
425 2958167940 2958165035 Bacteria 6906348
426 2958182631 2958179912 Bacteria 6874908
427 2960621129 2960617483 Bacteria 6727748
428 2960630354 2960624210 Bacteria 6875384
429 2960661411 2960660292 Bacteria 7041660
430 2961080479 2961077736 Bacteria 7079850
431 2961120929 2961114664 Bacteria 6680456
432 2961127930 2961127735 Bacteria 7196641
433 2961141615 2961136820 Bacteria 6775228
434 2961166408 2961163497 Bacteria 6901077
435 2961187708 2961183825 Bacteria 6688536
436 2963645479 2963644680 Bacteria 6530403
437 2965021227 2965018300 Bacteria 6883036
438 2965026807 2965025482 Bacteria 6532201
439 2965033247 2965032056 Bacteria 6887443
440 2965046122 2965040258 Bacteria 6855979
441 2965053989 2965047637 Bacteria 6623551
442 2965091075 2965089291 Bacteria 6866420
443 2965125534 2965119406 Bacteria 6956431
444 2968017401 2968016561 Bacteria 7022047
445 2968085190 2968083720 Bacteria 7351627
446 2968117079 2968110612 Bacteria 6814636
447 2968122497 2968117919 Bacteria 6536078
448 2968174809 2968171901 Bacteria 6894245
449 2970472445 2970469710 Bacteria 6969209
450 2970493571 2970489779 Bacteria 6517260
451 2970511145 2970510686 Bacteria 7006402
452 2970536324 2970532167 Bacteria 6553173
453 2970550902 2970547951 Bacteria 6931819
454 2970557891 2970554993 Bacteria 6814252
455 2970597012 2970593180 Bacteria 7073582
456 2970624389 2970619444 Bacteria 6986144
457 2970629598 2970627176 Bacteria 6680862
458 2977524911 2977523885 Bacteria 6960446
459 2977846723 2977843712 Bacteria 6753583
460 2977853501 2977851361 Bacteria 6694324
461 2977863252 2977858184 Bacteria 6215359
462 2977869313 2977864932 Bacteria 7534097
463 2977876736 2977872689 Bacteria 7270173
464 2977902949 2977898635 Bacteria 6675551
465 2977913297 2977907340 Bacteria 6577984
466 2977920409 2977915119 Bacteria 6829656
467 2977924744 2977922695 Bacteria 6956781
468 2977945553 2977942078 Bacteria 7570577
469 2977952143 2977950692 Bacteria 6893264
470 2977958474 2977957713 Bacteria 6877875
471 2977978633 2977971508 Bacteria 7472917
472 2978970100 2978969890 Bacteria 5400756
473 2979715331 2979710463 Bacteria 6785254
474 2979751257 2979742915 Bacteria 7301278
475 2979768883 2979764755 Bacteria 6610066
476 2979775667 2979772303 Bacteria 6618277
477 2979797133 2979793036 Bacteria 6808957
478 2984587129 2984587000 Bacteria 5263363
479 2987641689 2987636660 Bacteria 8088555
480 2987646914 2987645492 Bacteria 6117018
481 2987653926 2987652177 Bacteria 6969023
482 2987662416 2987659509 Bacteria 6966464
483 2987667130 2987666974 Bacteria 6509233
484 2989353809 2989349275 Bacteria 6349068
485 2996314974 2996310559 Bacteria 6357320
486 2996349855 2996348954 Bacteria 7239054
487 2996392777 2996386984 Bacteria 6978667
488 3000137548 3000135777 Bacteria 6891109
489 3002141571 3002141150 Bacteria 5254435
490 3003935663 3003930520 Bacteria 5667563
491 3004173473 3004167301 Bacteria 8330599
492 3004191467 3004188549 Bacteria 6952365
493 3004202985 3004195979 Bacteria 6776956
494 3004209499 3004203850 Bacteria 7307914
495 3004218535 3004211236 Bacteria 7417683
496 3004223619 3004218560 Bacteria 7421728
497 3004248071 3004239961 Bacteria 6892290
498 3004249846 3004248173 Bacteria 6563236
499 3004273026 3004268573 Bacteria 7043476
500 3004276557 3004275668 Bacteria 7114440
501 3004293639 3004289098 Bacteria 6135450
502 3004337082 3004334049 Bacteria 8449246
503 637076836 637000159 Bacteria 7596297
504 643823619 643692032 Bacteria 6891900
505 649870717 649633066 Bacteria 6690028
506 8002287305 8002285264 Bacteria 6717907
507 8004314948 8004312739 Bacteria 7444653
508 8004368349 8004361976 Bacteria 6858373
509 8004390496 8004387939 Bacteria 7049250
510 8004448772 8004445564 Bacteria 6322258
511 8004638938 8004633249 Bacteria 6723080
512 8004641864 8004640170 Bacteria 6723001
513 8004704749 8004703790 Bacteria 8006957
514 8004717188 8004714634 Bacteria 6776161
515 8004734608 8004727605 Bacteria 6643904
516 8018150490 8018150411 Bacteria 5549903
517 Ga0496121_0050445
518 JGI24735J21928_10038080
519 JGI25156J39149_1018789
520 JGI25158J39367_1000270
521 JGI25157J39369_1003828
522 JGI25152J39213_1003426
523 JGI25152J39213_1010771
524 JGI25150J39212_1001197
525 JGI25159J45721_1000563
526 JGI25159J45721_1000661
527 JGI25151J46595_10003579
528 JGI25151J46595_10067982
529 JGI25153J46596_10000066
530 JGI25153J46596_10007864
531 JGI25160J50197_1000820
532 JGI25160J50197_1008401
533 JGI25161J50226_1000289
534 JGI25161J50226_1002468
535 Ga0055526_1001598
536 Ga0055526_1006061
537 Ga0055524_1002668
538 Ga0055524_1012961
539 Ga0055524_1019036
540 Ga0055536_1001086
541 Ga0055528_1004598
542 Ga0055540_1013800
543 Ga0055540_1017042
544 Ga0055531_10016501
545 Ga0055543_1000023
546 Ga0055543_1000727
547 Ga0065165_1002311
548 Ga0065165_1014552
549 Ga0070711_100285334
550 Ga0068853_100011643
551 Ga0068853_100310947
552 Ga0070665_100150042
553 Ga0070665_100357281
554 Ga0070664_100111217
555 Ga0068856_100261346
556 Ga0068870_10206961
557 Ga0068862_100313273
558 Ga0075365_10067131
559 Ga0075365_10067848
560 Ga0075365_10337354
561 Ga0070715_10092544
562 Ga0075362_10026824
563 Ga0075367_10067180
564 Ga0075367_10124465
565 Ga0075367_10256632
566 Ga0075370_10031152
567 Ga0075428_100295041
568 Ga0075428_100605910
569 Ga0105240_10065519
570 Ga0114129_10882835
571 Ga0105237_10257163
572 Ga0105238_10048642
573 Ga0105249_10110180
574 Ga0105239_10187910
575 Ga0105239_10330002
576 Ga0157369_10037593
577 Ga0171463_1016
578 Ga0157380_10209917
579 Ga0183363_1267
580 Ga0209436_100053
581 Ga0209436_100712
582 Ga0207425_1000968
583 Ga0207425_1015882
584 Ga0209026_1000141
585 Ga0209148_1000111
586 Ga0209148_1019152
587 Ga0209759_1000354
588 Ga0209129_1003607
589 Ga0209129_1006383
590 Ga0209233_1032775
591 Ga0209455_1000206
592 Ga0209130_1000031
593 Ga0209130_1001334
594 Ga0209676_1001434
595 Ga0209025_1000121
596 Ga0209025_1005690
597 Ga0209025_1007351
598 Ga0209564_1000081
599 Ga0209564_1000826
600 Ga0209758_1000028
601 Ga0209758_1011158
602 Ga0209758_1011779
603 Ga0209758_1014158
604 Ga0209050_1000852
605 Ga0209256_1000639
606 Ga0209256_1002527
607 Ga0209256_1003364
608 Ga0207426_1000042
609 Ga0207426_1001728
610 Ga0209051_1003025
611 Ga0209051_1013148
612 Ga0209051_1086325
613 Ga0209257_1001851
614 Ga0209257_1029949
615 Ga0207647_10043176
616 Ga0207685_10074953
617 Ga0207663_10019446
618 Ga0207694_10031155
619 Ga0207694_10049985
620 Ga0207700_10275159
621 Ga0207669_10238552
622 Ga0207665_10357454
623 Ga0207679_10194098
624 Ga0207667_10355538
625 Ga0207667_10450037
626 Ga0207639_10297492
627 Ga0207675_100002563
628 Ga0268266_10019827
629 Ga0265318_10016718
630 Ga0307515_10022779
631 Ga0307515_10024806
632 Ga0265338_10038152
633 Ga0265324_10019345
634 Ga0265330_10033198
635 Ga0265325_10003181
636 Ga0265340_10132951
637 Ga0265339_10001174
638 Ga0265331_10001404
639 Ga0265331_10033771
640 Ga0265331_10068817
641 Ga0265327_10001987
642 Ga0265316_10015822
643 Ga0307513_10003256
644 Ga0307513_10024760
645 Ga0307513_10102828
646 Ga0265313_10000523
647 Ga0265313_10001290
648 Ga0265314_10040368
649 Ga0265314_10055239
650 Ga0265342_10010921
651 Ga0265342_10045329
652 Ga0307406_10244809
653 Ga0373927_0141317
654 Ga0373937_0107899
655 Ga0395899_0047144
656 Ga0395900_0000021
657 Ga0395900_0297530
658 Ga0395898_0002409
659 Ga0395905_0000912
660 Ga0395905_0025305
661 Ga0395901_0014520
662 Ga0436365_1709922
663 Ga0436361_0095035
664 Ga0439465_0036161
665 Ga0466972_0018590
666 Ga0466965_0001487
667 Ga0466966_0007644
668 Ga0466961_0037548
669 Ga0466961_0292673
670 Ga0466964_0056330
671 Ga0466970_0008194
672 Ga0466957_0087624
673 Ga0495638_0014130
674 Ga0495610_0041751
675 Ga0495610_0091584
676 Ga0495643_0052753
677 Ga0495648_0186718
678 Ga0495597_0104515
679 Ga0495625_0054747
680 Ga0495625_0196167
681 Ga0495588_0208511
682 Ga0495681_0063185
683 Ga0495686_0104364
684 Ga0495686_0175082
685 Ga0495626_0081406
686 Ga0496106_0000401
687 Ga0496112_0065977
688 Ga0496116_0000233
689 Ga0496117_0001463
690 Ga0496117_0255224
691 Ga0496118_0036064
692 Ga0496118_0103818
693 Ga0496119_0001035
694 Ga0496120_0002869
695 Ga0496120_0067307
696 Ga0496121_0007775
697 Ga0496121_0206842
698 Ga0496121_0225315
699 Ga0496121_0236407
700 Ga0496122_0001329
701 Ga0496122_0008279
702 Ga0496123_0000018
703 Ga0496123_0001422
704 Ga0496123_0061037
705 Ga0496124_0000940
706 Ga0496124_0070672
707 Ga0496125_0000161
708 Ga0496125_0000221
709 Ga0496125_0274251
710 Ga0496126_0000212
711 Ga0496126_0000421
712 Ga0496126_0001037
713 Ga0496126_0100786
714 Ga0496126_0121662
715 Ga0496126_0145305
716 Ga0496126_0244142
717 Ga0501036_0236381
718 Ga0501043_0055857
719 Ga0501043_0113091
720 Ga0501047_0710094
721 Ga0501070_0099750
722 Ga0501070_0211260
723 Ga0501073_0115941
724 Ga0501079_0454631
725 Ga0501080_0301528
726 Ga0501080_0310757
727 Ga0501080_0522556
728 Ga0501083_0084433
729 Ga0501044_0077274
730 nmdc:mga00v17_36310_c1
731 nmdc:mga0yw44_14370_c1
732 nmdc:mga0yw44_146641_c1
733 nmdc:mga0yw44_21463_c1
734 nmdc:mga06z11_90902_c1
735 nmdc:mga08y16_86642_c1
736 nmdc:mga0sz30_54198_c1
737 Ga0500610_0075848
738 Ga0500644_0024731
739 Ga0500556_0000199
740 Ga0500572_002031
741 Ga0500594_0029275
742 Ga0500658_0090920
743 Ga0500559_0007036
744 Ga0500568_0000004
745 Ga0500568_0015840
746 Ga0500568_0043291
747 Ga0500577_0057322
748 Ga0500604_0017549
749 Ga0500604_0060622
750 Ga0500604_0061790
751 Ga0500616_0045242
752 Ga0500616_0077664
753 Ga0500620_007038
754 Ga0500620_056394
755 Ga0500622_0000343
756 Ga0500622_0004607
757 Ga0500627_0074170
758 Ga0500633_0007428
759 Ga0500636_0001782
760 Ga0500645_030683
761 Ga0501084_0105956
762 2503198881
763 2509117909
764 2509368891
765 2509393696
766 2510315219
767 2510840237
768 2511137280
769 2511195215
770 2511389561
771 2512933724
772 2512961889
773 2514035443
774 2514421955
775 2524452002
776 2585164364
777 2585222314
778 2585264605
779 2585274107
780 2585389973
781 2585544733
782 2585560557
783 2585898769
784 2585903660
785 2587981221
786 2588519807
787 2600197117
788 2643804840
789 2643853944
790 2644051701
791 2644067379
792 2644104275
793 2644148038
794 2644200185
795 2644206990
796 2644310233
797 2644333439
798 2644378855
799 2644418467
800 2644451834
801 2644480569
802 2644498721
803 2644543709
804 2644616778
805 2644650638
806 2644675178
807 2644691007
808 2688596157
809 2692318989
810 2694636824
811 2723573295
812 2739350915
813 2753459283
814 2756673554
815 2776269684
816 2776282613
817 2776916039
818 2793281448
819 2842510548
820 2842872622
821 2843690988
822 2844003278
823 2844010961
824 2844165048
825 2844538837
826 2847422509
827 2848998082
828 2852390982
829 2855875846
830 2856324072
831 2856329439
832 2856335080
833 2856367386
834 2857353097
835 2857370410
836 2869174242
837 2869239196
838 2869246630
839 2869256583
840 2869257582
841 2869270091
842 2869271627
843 2869282403
844 2869288527
845 2871431194
846 2871443380
847 2871452047
848 2871465277
849 2871473469
850 2871478539
851 2871481547
852 2871498818
853 2874123516
854 2874126292
855 2874134451
856 2874142766
857 2874150569
858 2874158309
859 2874163671
860 2874170527
861 2876364021
862 2876392592
863 2876399059
864 2876401116
865 2876407901
866 2876416617
867 2876427225
868 2878739796
869 2878747798
870 2878763036
871 2878770006
872 2878774498
873 2878788311
874 2881148372
875 2881158314
876 2881165156
877 2882635234
878 2885307034
879 2885329031
880 2885348590
881 2885357491
882 2888343545
883 2888353371
884 2889015087
885 2889019838
886 2891376951
887 2903453880
888 2903502279
889 2903525820
890 2903532634
891 2903543620
892 2904615879
893 2904665586
894 2906310971
895 2906323082
896 2906366076
897 2906375629
898 2906385751
899 2906391742
900 2906394420
901 2906403154
902 2906408991
903 2906429072
904 2919102880
905 2922137751
906 2922153576
907 2922173263
908 2922192793
909 2924717801
910 2924719079
911 2924740595
912 2924741756
913 2924753113
914 2924768710
915 2924777417
916 2932405046
917 2937815512
918 2937822828
919 2937838872
920 2937852717
921 2937864389
922 2937880436
923 2937975766
924 2937986473
925 2937997466
926 2939671943
927 2941503970
928 2957444696
929 2958038261
930 2958050987
931 2958057325
932 2958072331
933 2958087571
934 2958100427
935 2958105005
936 2958116253
937 2958129575
938 2958132929
939 2958142292
940 2958161392
941 2958167940
942 2958182631
943 2960621129
944 2960630354
945 2960661411
946 2961080479
947 2961120929
948 2961127930
949 2961141615
950 2961166408
951 2961187708
952 2963645479
953 2965021227
954 2965026807
955 2965033247
956 2965046122
957 2965053989
958 2965091075
959 2965125534
960 2968017401
961 2968085190
962 2968117079
963 2968122497
964 2968174809
965 2970472445
966 2970493571
967 2970511145
968 2970536324
969 2970550902
970 2970557891
971 2970597012
972 2970624389
973 2970629598
974 2977524911
975 2977846723
976 2977853501
977 2977863252
978 2977869313
979 2977876736
980 2977902949
981 2977913297
982 2977920409
983 2977924744
984 2977945553
985 2977952143
986 2977958474
987 2977978633
988 2978970100
989 2979715331
990 2979751257
991 2979768883
992 2979775667
993 2979797133
994 2984587129
995 2987641689
996 2987646914
997 2987653926
998 2987662416
999 2987667130
1000 2989353809
1001 2996314974
1002 2996349855
1003 2996392777
1004 3000137548
1005 3002141571
1006 3003935663
1007 3004173473
1008 3004191467
1009 3004202985
1010 3004209499
1011 3004218535
1012 3004223619
1013 3004248071
1014 3004249846
1015 3004273026
1016 3004276557
1017 3004293639
1018 3004337082
1019 637076836
1020 643823619
1021 649870717
1022 8002287305
1023 8004314948
1024 8004368349
1025 8004390496
1026 8004448772
1027 8004638938
1028 8004641864
1029 8004704749
1030 8004717188
1031 8004734608
1032 8018150490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

122

293

0.98

Map