F458065

General Info

Members Datasets Scaffolds Average Seq Length
516 263 1032 142

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_118364_c1|nmdc:mga06r32_118364_c1_1239_1733
Length 164
Sequence VVDIGSRGWTPRGANLLAVPVNTAAIGKEYEPVTYAVGREKIREYAHAVGETNPLHIDVDAARAAGFRDVVAPPMFASVYCSRAIGPAMFDPEVGIDFSRLVHSGQEFSWGPLVVAGDEVTTKLTVKDISERAGSGFYVFESLSTNQDGDVVCVGTWSNIVRGG

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 11.24
Rhizosphere 83.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_118364_c1 3300050510 Bacteria 2611
2 JGI24743J22301_10014721 3300001991 Bacteria 1444
3 JGI25406J46586_10231751 3300003203 Bacteria 541
4 JGI25404J52841_10026289 3300003659 Bacteria 1253
5 Ga0070658_10227256 3300005327 Bacteria 1579
6 Ga0068869_100860321 3300005334 Bacteria 783
7 Ga0068869_101526142 3300005334 Bacteria 593
8 Ga0070682_100522183 3300005337 Bacteria 924
9 Ga0068868_100026924 3300005338 Bacteria 4383
10 Ga0068868_100096367 3300005338 Bacteria 2390
11 Ga0068868_100340361 3300005338 Bacteria 1282
12 Ga0070660_100856105 3300005339 Bacteria 766
13 Ga0070691_10515037 3300005341 Bacteria 694
14 Ga0070687_100105224 3300005343 Bacteria 1587
15 Ga0070687_100749120 3300005343 Bacteria 687
16 Ga0070661_100273087 3300005344 Bacteria 1310
17 Ga0070692_10090378 3300005345 Bacteria 1664
18 Ga0070668_100767126 3300005347 Bacteria 855
19 Ga0070668_100915079 3300005347 Bacteria 785
20 Ga0070669_100133675 3300005353 Bacteria 1906
21 Ga0070675_100400345 3300005354 Bacteria 1225
22 Ga0070671_100443130 3300005355 Bacteria 1114
23 Ga0070674_100136447 3300005356 Bacteria 1835
24 Ga0070674_100748394 3300005356 Bacteria 839
25 Ga0070674_101206907 3300005356 Bacteria 672
26 Ga0070673_100306781 3300005364 Bacteria 1399
27 Ga0070659_100035635 3300005366 Bacteria 3875
28 Ga0070714_100095526 3300005435 Bacteria 2610
29 Ga0070714_100670677 3300005435 Bacteria 999
30 Ga0070713_100015622 3300005436 Bacteria 5685
31 Ga0070710_10044674 3300005437 Bacteria 2459
32 Ga0070711_100060259 3300005439 Bacteria 2638
33 Ga0070700_100100997 3300005441 Bacteria 1900
34 Ga0070700_100265095 3300005441 Bacteria 1239
35 Ga0070663_100275549 3300005455 Bacteria 1339
36 Ga0070678_100197821 3300005456 Bacteria 1657
37 Ga0070662_100505052 3300005457 Bacteria 1009
38 Ga0068867_100194401 3300005459 Bacteria 1621
39 Ga0068867_100477411 3300005459 Bacteria 1067
40 Ga0070685_10317591 3300005466 Bacteria 1055
41 Ga0070685_11366908 3300005466 Bacteria 543
42 Ga0070679_101718210 3300005530 Bacteria 576
43 Ga0070672_100207100 3300005543 Bacteria 1642
44 Ga0070672_100568396 3300005543 Bacteria 986
45 Ga0070672_101366222 3300005543 Bacteria 633
46 Ga0070686_100269351 3300005544 Bacteria 1252
47 Ga0070696_100656727 3300005546 Bacteria 851
48 Ga0070693_100228091 3300005547 Bacteria 1224
49 Ga0070693_100851587 3300005547 Bacteria 680
50 Ga0070693_101129498 3300005547 Bacteria 599
51 Ga0070665_100109022 3300005548 Bacteria 2771
52 Ga0070704_101024050 3300005549 Bacteria 748
53 Ga0070664_100056077 3300005564 Bacteria 3348
54 Ga0070664_100101947 3300005564 Bacteria 2497
55 Ga0070664_100525236 3300005564 Bacteria 1093
56 Ga0068854_100142377 3300005578 Bacteria 1841
57 Ga0068854_100648225 3300005578 Bacteria 906
58 Ga0068856_100193389 3300005614 Bacteria 2048
59 Ga0068856_101353709 3300005614 Bacteria 727
60 Ga0070702_100022394 3300005615 Bacteria 3339
61 Ga0070702_100315043 3300005615 Bacteria 1088
62 Ga0070702_100928240 3300005615 Bacteria 684
63 Ga0068852_100620850 3300005616 Bacteria 1086
64 Ga0068852_100980413 3300005616 Bacteria 864
65 Ga0068852_101212998 3300005616 Bacteria 776
66 Ga0068864_100607758 3300005618 Bacteria 1062
67 Ga0068864_100677404 3300005618 Bacteria 1006
68 Ga0068866_10054645 3300005718 Bacteria 2047
69 Ga0068866_10150658 3300005718 Bacteria 1346
70 Ga0068861_100036402 3300005719 Bacteria 3652
71 Ga0068861_100180355 3300005719 Bacteria 1757
72 Ga0068851_10251970 3300005834 Bacteria 1002
73 Ga0068851_10391847 3300005834 Bacteria 816
74 Ga0068870_10157666 3300005840 Bacteria 1343
75 Ga0068870_10276695 3300005840 Bacteria 1051
76 Ga0081455_10013066 3300005937 Bacteria 8230
77 Ga0081455_10364808 3300005937 Bacteria 1014
78 Ga0081538_10039932 3300005981 Bacteria 3001
79 Ga0081538_10134645 3300005981 Bacteria 1153
80 Ga0081540_1001048 3300005983 Bacteria 24669
81 Ga0081539_10010836 3300005985 Bacteria 7329
82 Ga0070717_10000001 3300006028 Bacteria 465573
83 Ga0070717_10022385 3300006028 Bacteria 4993
84 Ga0070717_10410153 3300006028 Bacteria 1218
85 Ga0075363_100401959 3300006048 Bacteria 805
86 Ga0070712_100013702 3300006175 Bacteria 5188
87 Ga0068871_100762826 3300006358 Bacteria 890
88 Ga0075428_100976540 3300006844 Bacteria 897
89 Ga0075431_100129629 3300006847 Bacteria 2602
90 Ga0075433_10712719 3300006852 Bacteria 879
91 Ga0075434_100658986 3300006871 Bacteria 1065
92 Ga0068865_100048127 3300006881 Bacteria 2933
93 Ga0068865_101257723 3300006881 Bacteria 657
94 Ga0075436_100463138 3300006914 Bacteria 924
95 Ga0097620_101093541 3300006931 Bacteria 877
96 Ga0105251_10202229 3300009011 Bacteria 895
97 Ga0105244_10157240 3300009036 Bacteria 1087
98 Ga0105240_10134768 3300009093 Bacteria 2958
99 Ga0111539_10200146 3300009094 Bacteria 2329
100 Ga0111539_10479146 3300009094 Bacteria 1449
101 Ga0111539_11083813 3300009094 Bacteria 931
102 Ga0111539_11410277 3300009094 Bacteria 808
103 Ga0105245_10107804 3300009098 Bacteria 2586
104 Ga0105245_10111385 3300009098 Bacteria 2545
105 Ga0105245_10266549 3300009098 Bacteria 1669
106 Ga0105245_10465868 3300009098 Bacteria 1275
107 Ga0105245_10753050 3300009098 Bacteria 1010
108 Ga0105247_10034999 3300009101 Bacteria 3059
109 Ga0105247_10307485 3300009101 Bacteria 1102
110 Ga0114129_12011918 3300009147 Bacteria 698
111 Ga0105243_10076884 3300009148 Bacteria 2714
112 Ga0105243_10108841 3300009148 Bacteria 2314
113 Ga0105243_10125681 3300009148 Bacteria 2169
114 Ga0105243_10339750 3300009148 Bacteria 1375
115 Ga0105243_10629437 3300009148 Bacteria 1037
116 Ga0105241_10436957 3300009174 Bacteria 1155
117 Ga0105242_10258968 3300009176 Bacteria 1571
118 Ga0105248_10319289 3300009177 Bacteria 1749
119 Ga0105248_10548299 3300009177 Bacteria 1304
120 Ga0105237_11941561 3300009545 Bacteria 597
121 Ga0105238_10575693 3300009551 Bacteria 1132
122 Ga0105238_10634119 3300009551 Bacteria 1078
123 Ga0105249_10371202 3300009553 Bacteria 1454
124 Ga0105249_10650848 3300009553 Bacteria 1111
125 Ga0105239_10346274 3300010375 Bacteria 1678
126 Ga0105246_10401976 3300011119 Bacteria 1138
127 Ga0105246_10813475 3300011119 Bacteria 830
128 Ga0157329_1016327 3300012491 Bacteria 651
129 Ga0157371_11105421 3300013102 Bacteria 608
130 Ga0157369_10996274 3300013105 Bacteria 858
131 Ga0157369_11210957 3300013105 Bacteria 771
132 Ga0163162_10153787 3300013306 Bacteria 2419
133 Ga0157372_10146183 3300013307 Bacteria 2726
134 Ga0157372_10820641 3300013307 Bacteria 1080
135 Ga0157372_12982760 3300013307 Bacteria 541
136 Ga0157375_10659937 3300013308 Bacteria 1202
137 Ga0157375_13445438 3300013308 Bacteria 527
138 Ga0163163_10061256 3300014325 Bacteria 3728
139 Ga0163163_10213057 3300014325 Bacteria 1981
140 Ga0163163_10644310 3300014325 Bacteria 1123
141 Ga0157380_10158402 3300014326 Bacteria 1965
142 Ga0157380_11067909 3300014326 Bacteria 845
143 Ga0157380_13490975 3300014326 Bacteria 503
144 Ga0157377_10115422 3300014745 Bacteria 1620
145 Ga0157377_10132377 3300014745 Bacteria 1525
146 Ga0157377_10336044 3300014745 Bacteria 1009
147 Ga0157379_10149260 3300014968 Bacteria 2108
148 Ga0157379_10426764 3300014968 Bacteria 1221
149 Ga0157379_11155752 3300014968 Bacteria 743
150 Ga0157376_10528157 3300014969 Bacteria 1164
151 Ga0163161_10328982 3300017792 Bacteria 1210
152 Ga0213876_10087648 3300021384 Bacteria 1648
153 Ga0213875_10000351 3300021388 Bacteria 43186
154 Ga0213875_10036726 3300021388 Bacteria 2310
155 Ga0213875_10046194 3300021388 Bacteria 2044
156 Ga0213875_10244203 3300021388 Bacteria 846
157 Ga0207656_10097479 3300025321 Bacteria 1343
158 Ga0207656_10417044 3300025321 Bacteria 676
159 Ga0207682_10606948 3300025893 Bacteria 515
160 Ga0207692_10411152 3300025898 Bacteria 845
161 Ga0207642_10062843 3300025899 Bacteria 1734
162 Ga0207642_10447746 3300025899 Bacteria 782
163 Ga0207642_10479682 3300025899 Bacteria 758
164 Ga0207688_10005034 3300025901 Bacteria 7186
165 Ga0207688_10191222 3300025901 Bacteria 1224
166 Ga0207688_10416733 3300025901 Bacteria 834
167 Ga0207680_10193575 3300025903 Bacteria 1382
168 Ga0207647_10044563 3300025904 Bacteria 2771
169 Ga0207643_10008536 3300025908 Bacteria 5494
170 Ga0207643_10051915 3300025908 Bacteria 2328
171 Ga0207643_10747317 3300025908 Bacteria 633
172 Ga0207695_10171946 3300025913 Bacteria 2092
173 Ga0207693_10053381 3300025915 Bacteria 3171
174 Ga0207663_10043766 3300025916 Bacteria 2744
175 Ga0207662_10010234 3300025918 Bacteria 5173
176 Ga0207662_10229093 3300025918 Bacteria 1213
177 Ga0207662_10445530 3300025918 Bacteria 885
178 Ga0207662_10708666 3300025918 Bacteria 706
179 Ga0207657_10079428 3300025919 Bacteria 2760
180 Ga0207657_10242861 3300025919 Bacteria 1437
181 Ga0207657_10484634 3300025919 Bacteria 969
182 Ga0207649_10212301 3300025920 Bacteria 1374
183 Ga0207649_10984081 3300025920 Bacteria 663
184 Ga0207652_10703623 3300025921 Bacteria 901
185 Ga0207681_10143705 3300025923 Bacteria 1780
186 Ga0207681_10408433 3300025923 Bacteria 1098
187 Ga0207681_11067629 3300025923 Bacteria 678
188 Ga0207694_10441554 3300025924 Bacteria 1086
189 Ga0207650_10530731 3300025925 Bacteria 985
190 Ga0207659_10591371 3300025926 Bacteria 945
191 Ga0207687_10051711 3300025927 Bacteria 2865
192 Ga0207687_10091327 3300025927 Bacteria 2221
193 Ga0207687_10214457 3300025927 Bacteria 1512
194 Ga0207687_10268423 3300025927 Bacteria 1363
195 Ga0207687_10571494 3300025927 Bacteria 950
196 Ga0207664_10000004 3300025929 Bacteria 493014
197 Ga0207664_10003392 3300025929 Bacteria 10603
198 Ga0207664_10308289 3300025929 Bacteria 1394
199 Ga0207664_10660500 3300025929 Bacteria 940
200 Ga0207644_10307648 3300025931 Bacteria 1279
201 Ga0207690_10710697 3300025932 Bacteria 827
202 Ga0207690_11439104 3300025932 Bacteria 576
203 Ga0207706_10203832 3300025933 Bacteria 1735
204 Ga0207706_10257402 3300025933 Bacteria 1524
205 Ga0207706_10462538 3300025933 Bacteria 1097
206 Ga0207706_10780749 3300025933 Bacteria 812
207 Ga0207686_10177237 3300025934 Bacteria 1509
208 Ga0207686_10692217 3300025934 Bacteria 810
209 Ga0207709_10063942 3300025935 Bacteria 2308
210 Ga0207709_10432984 3300025935 Bacteria 1013
211 Ga0207669_10102338 3300025937 Bacteria 1897
212 Ga0207704_10142546 3300025938 Bacteria 1679
213 Ga0207704_10540120 3300025938 Bacteria 946
214 Ga0207665_10599203 3300025939 Bacteria 860
215 Ga0207691_10051774 3300025940 Bacteria 3752
216 Ga0207691_10258214 3300025940 Bacteria 1502
217 Ga0207691_10291929 3300025940 Bacteria 1402
218 Ga0207691_10330466 3300025940 Bacteria 1306
219 Ga0207691_10778187 3300025940 Bacteria 805
220 Ga0207711_10525541 3300025941 Bacteria 1103
221 Ga0207689_10345065 3300025942 Bacteria 1237
222 Ga0207689_10404119 3300025942 Bacteria 1139
223 Ga0207661_10178689 3300025944 Bacteria 1852
224 Ga0207661_10250670 3300025944 Bacteria 1573
225 Ga0207661_10287838 3300025944 Bacteria 1470
226 Ga0207661_10877273 3300025944 Bacteria 826
227 Ga0207679_10056239 3300025945 Bacteria 2904
228 Ga0207679_10214418 3300025945 Bacteria 1616
229 Ga0207679_10246098 3300025945 Bacteria 1517
230 Ga0207651_10213485 3300025960 Bacteria 1555
231 Ga0207651_11347686 3300025960 Bacteria 642
232 Ga0207712_10108333 3300025961 Bacteria 2079
233 Ga0207712_10770406 3300025961 Bacteria 844
234 Ga0207668_10191738 3300025972 Bacteria 1620
235 Ga0207668_11081919 3300025972 Bacteria 718
236 Ga0207668_11105487 3300025972 Bacteria 711
237 Ga0207640_10503391 3300025981 Bacteria 1009
238 Ga0207640_11224549 3300025981 Bacteria 668
239 Ga0207677_10045739 3300026023 Bacteria 2925
240 Ga0207677_10166161 3300026023 Bacteria 1720
241 Ga0207677_10216350 3300026023 Bacteria 1534
242 Ga0207677_10703832 3300026023 Bacteria 897
243 Ga0207703_11837621 3300026035 Bacteria 582
244 Ga0207639_11316176 3300026041 Bacteria 678
245 Ga0207678_10059737 3300026067 Bacteria 3280
246 Ga0207678_10101975 3300026067 Bacteria 2450
247 Ga0207678_10172451 3300026067 Bacteria 1847
248 Ga0207678_10244938 3300026067 Bacteria 1535
249 Ga0207708_10022420 3300026075 Bacteria 4769
250 Ga0207708_10071687 3300026075 Bacteria 2654
251 Ga0207708_10248912 3300026075 Bacteria 1431
252 Ga0207708_10332232 3300026075 Bacteria 1243
253 Ga0207708_11247881 3300026075 Bacteria 650
254 Ga0207702_10121401 3300026078 Bacteria 2339
255 Ga0207702_10375849 3300026078 Bacteria 1365
256 Ga0207702_10932887 3300026078 Bacteria 860
257 Ga0207641_10118480 3300026088 Bacteria 2359
258 Ga0207641_10256397 3300026088 Bacteria 1636
259 Ga0207648_10056653 3300026089 Bacteria 3420
260 Ga0207648_10104787 3300026089 Bacteria 2481
261 Ga0207648_10492740 3300026089 Bacteria 1120
262 Ga0207648_10695776 3300026089 Bacteria 942
263 Ga0207676_10864267 3300026095 Bacteria 885
264 Ga0207676_10883554 3300026095 Bacteria 876
265 Ga0207674_10106903 3300026116 Bacteria 2775
266 Ga0207674_10297390 3300026116 Bacteria 1563
267 Ga0207675_100027402 3300026118 Bacteria 5307
268 Ga0207675_100054475 3300026118 Bacteria 3731
269 Ga0207683_10095629 3300026121 Bacteria 2648
270 Ga0207683_10472400 3300026121 Bacteria 1157
271 Ga0207698_10620279 3300026142 Bacteria 1068
272 Ga0207698_10761645 3300026142 Bacteria 968
273 Ga0207698_10803131 3300026142 Bacteria 943
274 Ga0207698_10998362 3300026142 Bacteria 848
275 Ga0207698_11010987 3300026142 Bacteria 842
276 Ga0207428_10508982 3300027907 Bacteria 874
277 Ga0268266_10088815 3300028379 Bacteria 2705
278 Ga0268266_10180848 3300028379 Bacteria 1920
279 Ga0268265_10298135 3300028380 Bacteria 1450
280 Ga0268264_10387283 3300028381 Bacteria 1340
281 Ga0265337_1176427 3300028556 Bacteria 580
282 Ga0265326_10000006 3300028558 Bacteria 233392
283 Ga0265334_10000016 3300028573 Bacteria 147961
284 Ga0265338_10000961 3300028800 Bacteria 48623
285 Ga0265340_10291133 3300031247 Bacteria 725
286 Ga0307405_10425373 3300031731 Bacteria 1046
287 Ga0307405_10704148 3300031731 Bacteria 837
288 Ga0307413_10446999 3300031824 Bacteria 1025
289 Ga0307410_10790822 3300031852 Bacteria 806
290 Ga0307406_10832920 3300031901 Bacteria 781
291 Ga0307412_10789321 3300031911 Bacteria 823
292 Ga0307409_100051004 3300031995 Bacteria 3164
293 Ga0307416_100075257 3300032002 Bacteria 2825
294 Ga0307416_100302456 3300032002 Bacteria 1591
295 Ga0307416_100555605 3300032002 Bacteria 1222
296 Ga0307416_100902171 3300032002 Bacteria 984
297 Ga0307416_101072153 3300032002 Bacteria 910
298 Ga0307411_10760769 3300032005 Bacteria 849
299 Ga0307411_11222183 3300032005 Bacteria 682
300 Ga0307411_11568210 3300032005 Bacteria 607
301 Ga0307415_100031211 3300032126 Bacteria 3429
302 Ga0307415_100363410 3300032126 Bacteria 1223
303 Ga0307415_100430669 3300032126 Bacteria 1135
304 Ga0307415_101250332 3300032126 Bacteria 701
305 Ga0307415_101442994 3300032126 Bacteria 657
306 Ga0373942_0129651 3300035207 Bacteria 795
307 Ga0373935_0690971 3300035692 Bacteria 750
308 Ga0395900_0316009 3300037418 Bacteria 1544
309 Ga0395900_1170986 3300037418 Bacteria 685
310 Ga0395898_0462162 3300037466 Bacteria 1208
311 Ga0395898_0733143 3300037466 Bacteria 930
312 Ga0436364_0358577 3300037853 Bacteria 27430
313 Ga0436364_0790855 3300037853 Bacteria 6788
314 Ga0436364_0838033 3300037853 Bacteria 3277
315 Ga0436364_1426665 3300037853 Bacteria 33049
316 Ga0395901_0513673 3300038443 Bacteria 1218
317 Ga0395901_0579181 3300038443 Bacteria 1134
318 Ga0395901_0666971 3300038443 Bacteria 1041
319 Ga0242420_015434 3300038996 Bacteria 1321
320 Ga0436365_0095147 3300039437 Bacteria 17914
321 Ga0436365_0720259 3300039437 Bacteria 5859
322 Ga0436365_1207802 3300039437 Bacteria 1142
323 Ga0436365_1486005 3300039437 Bacteria 16123
324 Ga0436361_0272158 3300039447 Bacteria 1136
325 Ga0436363_0023518 3300039450 Bacteria 29320
326 Ga0436363_0430150 3300039450 Bacteria 1122
327 Ga0436363_0554644 3300039450 Bacteria 1157
328 Ga0436363_0595781 3300039450 Bacteria 730
329 Ga0436363_0962015 3300039450 Bacteria 694
330 Ga0436362_0061179 3300039453 Bacteria 1376
331 Ga0451789_0786662 3300041443 Bacteria 525
332 Ga0451791_0375976 3300041451 Bacteria 756
333 Ga0451791_1170775 3300041451 Bacteria 527
334 Ga0451800_1432649 3300041459 Bacteria 655
335 Ga0451833_1279285 3300041491 Bacteria 1127
336 Ga0451853_2596443 3300041512 Bacteria 1192
337 Ga0451853_2801483 3300041512 Bacteria 1236
338 Ga0439448_0150675 3300042005 Bacteria 807
339 Ga0439450_077808 3300042008 Bacteria 821
340 Ga0439463_123069 3300042016 Bacteria 670
341 Ga0439458_0113528 3300042157 Bacteria 710
342 Ga0439435_0251572 3300042436 Bacteria 595
343 Ga0439459_0010293 3300042438 Bacteria 1629
344 Ga0439460_0081474 3300042461 Bacteria 1016
345 Ga0466965_0750473 3300044683 Bacteria 562
346 Ga0466965_0887795 3300044683 Bacteria 519
347 Ga0466966_0088810 3300044684 Bacteria 1920
348 Ga0466963_0002619 3300044694 Bacteria 10102
349 Ga0466963_0022738 3300044694 Bacteria 3974
350 Ga0466963_0031412 3300044694 Bacteria 3433
351 Ga0466963_0143215 3300044694 Bacteria 1657
352 Ga0466963_0385141 3300044694 Bacteria 988
353 Ga0466963_0460420 3300044694 Bacteria 897
354 Ga0466963_0465403 3300044694 Bacteria 892
355 Ga0466963_0765374 3300044694 Bacteria 681
356 Ga0466964_0167625 3300044706 Bacteria 1032
357 Ga0466964_0212705 3300044706 Bacteria 935
358 Ga0466964_0241199 3300044706 Bacteria 887
359 Ga0466964_0293349 3300044706 Bacteria 817
360 Ga0466964_0402738 3300044706 Bacteria 715
361 Ga0466971_0003944 3300044719 Bacteria 6374
362 Ga0466971_0214992 3300044719 Bacteria 910
363 Ga0466968_0103183 3300044735 Bacteria 1275
364 Ga0466968_0130927 3300044735 Bacteria 1141
365 Ga0466968_0517521 3300044735 Bacteria 596
366 Ga0466970_0030634 3300044765 Bacteria 2838
367 Ga0466970_0197308 3300044765 Bacteria 1119
368 Ga0466970_0212093 3300044765 Bacteria 1079
369 Ga0466970_0252414 3300044765 Bacteria 988
370 Ga0466957_0048520 3300044842 Bacteria 2581
371 Ga0466957_0071353 3300044842 Bacteria 2148
372 Ga0466957_0126828 3300044842 Bacteria 1631
373 Ga0466957_0203486 3300044842 Bacteria 1301
374 Ga0466957_0283740 3300044842 Bacteria 1109
375 Ga0466957_0717754 3300044842 Bacteria 706
376 Ga0466960_0097603 3300044901 Bacteria 1508
377 Ga0466960_0438900 3300044901 Bacteria 757
378 Ga0466960_0761467 3300044901 Bacteria 584
379 Ga0466959_0017231 3300045049 Bacteria 5291
380 Ga0466959_0034204 3300045049 Bacteria 3761
381 Ga0466959_0044829 3300045049 Bacteria 3258
382 Ga0466959_0282446 3300045049 Bacteria 1139
383 Ga0466959_0316413 3300045049 Bacteria 1067
384 Ga0466959_0582000 3300045049 Bacteria 754
385 Ga0466959_0672678 3300045049 Bacteria 694
386 Ga0466959_0795078 3300045049 Bacteria 632
387 Ga0466958_0009686 3300045836 Bacteria 5376
388 Ga0466958_0021402 3300045836 Bacteria 3779
389 Ga0466958_0035334 3300045836 Bacteria 2985
390 Ga0466958_0204887 3300045836 Bacteria 1256
391 Ga0466958_0232478 3300045836 Bacteria 1177
392 Ga0466967_0003189 3300045976 Bacteria 10582
393 Ga0466967_0005224 3300045976 Bacteria 8945
394 Ga0466967_0061345 3300045976 Bacteria 3335
395 Ga0466967_0076518 3300045976 Bacteria 3010
396 Ga0466967_0128138 3300045976 Bacteria 2353
397 Ga0466967_0287731 3300045976 Bacteria 1578
398 Ga0466967_0287837 3300045976 Bacteria 1578
399 Ga0466967_0303967 3300045976 Bacteria 1535
400 Ga0466967_0310280 3300045976 Bacteria 1519
401 Ga0466967_0317949 3300045976 Bacteria 1501
402 Ga0466967_0354314 3300045976 Bacteria 1421
403 Ga0466967_0485682 3300045976 Bacteria 1210
404 Ga0466967_1081806 3300045976 Bacteria 799
405 Ga0466967_1399048 3300045976 Bacteria 697
406 Ga0495603_0232424 3300046455 Bacteria 1063
407 Ga0495641_0018791 3300046461 Bacteria 3557
408 Ga0495584_0030716 3300046491 Bacteria 2721
409 Ga0495596_0239231 3300046500 Bacteria 705
410 Ga0495620_0160764 3300046515 Bacteria 873
411 Ga0495644_0079511 3300046523 Bacteria 1235
412 Ga0495654_0310382 3300046530 Bacteria 642
413 Ga0495665_0319572 3300046531 Bacteria 793
414 Ga0495597_0094774 3300046542 Bacteria 1264
415 Ga0495645_0398903 3300046543 Bacteria 877
416 Ga0495656_0239188 3300046615 Bacteria 914
417 Ga0495656_0258200 3300046615 Bacteria 882
418 Ga0495658_0391279 3300046683 Bacteria 886
419 Ga0495589_0452778 3300046794 Bacteria 587
420 Ga0495581_0529054 3300047315 Bacteria 685
421 Ga0495674_0581490 3300047319 Bacteria 889
422 Ga0495672_0435595 3300047320 Bacteria 594
423 Ga0495676_0259832 3300047321 Bacteria 1182
424 Ga0495676_0277324 3300047321 Bacteria 1136
425 Ga0495677_0238766 3300047445 Bacteria 710
426 Ga0496100_0000263 3300048903 Bacteria 26697
427 Ga0496100_0027994 3300048903 Bacteria 3472
428 Ga0496100_0125902 3300048903 Bacteria 1798
429 Ga0496100_0409378 3300048903 Bacteria 1034
430 Ga0496101_0000448 3300048904 Bacteria 26182
431 Ga0496101_0127526 3300048904 Bacteria 1929
432 Ga0496101_0160940 3300048904 Bacteria 1721
433 Ga0496101_0219400 3300048904 Bacteria 1475
434 Ga0496102_0020424 3300048905 Bacteria 5853
435 Ga0496102_0843642 3300048905 Bacteria 838
436 Ga0496103_0165182 3300048906 Bacteria 1420
437 Ga0496104_0003622 3300048907 Bacteria 13344
438 Ga0496104_0265924 3300048907 Bacteria 1627
439 Ga0496104_0963397 3300048907 Bacteria 757
440 Ga0496105_0004110 3300048908 Bacteria 10910
441 Ga0496105_0072661 3300048908 Bacteria 2842
442 Ga0496105_0172386 3300048908 Bacteria 1773
443 Ga0496105_0579325 3300048908 Bacteria 873
444 Ga0496106_0056599 3300048909 Bacteria 2964
445 Ga0496106_0071322 3300048909 Bacteria 2655
446 Ga0496106_0213545 3300048909 Bacteria 1537
447 Ga0496106_0227459 3300048909 Bacteria 1488
448 Ga0496107_0116183 3300048910 Bacteria 1969
449 Ga0496107_0251381 3300048910 Bacteria 1315
450 Ga0496108_0000407 3300048911 Bacteria 35282
451 Ga0496108_0065853 3300048911 Bacteria 3054
452 Ga0496108_0109114 3300048911 Bacteria 2364
453 Ga0496109_0013268 3300048912 Bacteria 7137
454 Ga0496109_0016546 3300048912 Bacteria 6449
455 Ga0496109_0360463 3300048912 Bacteria 1373
456 Ga0496109_0393411 3300048912 Bacteria 1309
457 Ga0496109_0454809 3300048912 Bacteria 1209
458 Ga0496109_0697088 3300048912 Bacteria 953
459 Ga0496109_1133578 3300048912 Bacteria 719
460 Ga0496110_0000936 3300048913 Bacteria 20525
461 Ga0496110_0020514 3300048913 Bacteria 5580
462 Ga0496110_0190529 3300048913 Bacteria 1862
463 Ga0496110_0674186 3300048913 Bacteria 934
464 Ga0496110_0675614 3300048913 Bacteria 933
465 Ga0496111_0058420 3300048914 Bacteria 2793
466 Ga0496111_0287753 3300048914 Bacteria 1219
467 Ga0496112_0034156 3300048915 Bacteria 4948
468 Ga0496112_0190755 3300048915 Bacteria 2011
469 Ga0496112_0452528 3300048915 Bacteria 1221
470 Ga0496112_0619365 3300048915 Bacteria 1013
471 Ga0496112_0888459 3300048915 Bacteria 813
472 Ga0496113_0003853 3300048916 Bacteria 9082
473 Ga0496113_0050928 3300048916 Bacteria 3089
474 Ga0496113_0173823 3300048916 Bacteria 1706
475 Ga0496113_0332856 3300048916 Bacteria 1217
476 Ga0496113_1113220 3300048916 Bacteria 619
477 Ga0496114_0184888 3300048917 Bacteria 1821
478 Ga0496114_0692606 3300048917 Bacteria 894
479 Ga0496115_0000023 3300048918 Bacteria 163267
480 Ga0496117_0557216 3300048920 Bacteria 544
481 Ga0496120_0469325 3300048923 Bacteria 545
482 Ga0496121_0021265 3300048924 Bacteria 6366
483 Ga0496121_0333571 3300048924 Bacteria 1016
484 Ga0501031_0110954 3300049568 Bacteria 1791
485 Ga0501032_0141941 3300049569 Bacteria 1581
486 Ga0501037_0065949 3300049573 Bacteria 2637
487 Ga0501038_0055667 3300049574 Bacteria 3397
488 Ga0501039_0107166 3300049575 Bacteria 2183
489 Ga0501042_0041308 3300049578 Bacteria 3279
490 Ga0501043_0055352 3300049579 Bacteria 3116
491 Ga0501043_0851186 3300049579 Bacteria 657
492 Ga0501046_0019635 3300049580 Bacteria 5602
493 Ga0501047_0421240 3300049581 Bacteria 1166
494 Ga0501048_0043609 3300049582 Bacteria 3210
495 Ga0501067_0060054 3300049583 Bacteria 2104
496 Ga0501068_0048435 3300049584 Bacteria 2566
497 Ga0501070_0035205 3300049586 Bacteria 4184
498 Ga0501071_0060962 3300049587 Bacteria 2732
499 Ga0501072_1013009 3300049588 Bacteria 647
500 Ga0501079_0298742 3300049741 Bacteria 1260
501 Ga0501081_1145880 3300049743 Bacteria 589
502 Ga0501083_0035587 3300049744 Bacteria 3400
503 Ga0501035_0039791 3300049822 Bacteria 4253
504 Ga0501045_0336331 3300049824 Bacteria 1124
505 nmdc:mga03n38_330223_c1 3300050490 Bacteria 825
506 nmdc:mga05p37_1051608_c1 3300050507 Bacteria 858
507 nmdc:mga08y16_1115232_c1 3300050511 Bacteria 763
508 nmdc:mga08y16_137663_c1 3300050511 Bacteria 2538
509 nmdc:mga0n895_576416_c1 3300050512 Bacteria 1129
510 Ga0495655_0153927 3300053083 Bacteria 725
511 Ga0500641_0405637 3300053096 Bacteria 535
512 Ga0500616_0079699 3300053153 Bacteria 1648
513 Ga0501084_0022867 3300054114 Bacteria 5217
514 Ga0501082_0176712 3300060353 Bacteria 1856
515 Ga0466962_0020519 3300061719 Bacteria 3175
516 Ga0466962_0583810 3300061719 Bacteria 569
517 nmdc:mga06r32_118364_c1
518 JGI24743J22301_10014721
519 JGI25406J46586_10231751
520 JGI25404J52841_10026289
521 Ga0070658_10227256
522 Ga0068869_100860321
523 Ga0068869_101526142
524 Ga0070682_100522183
525 Ga0068868_100026924
526 Ga0068868_100096367
527 Ga0068868_100340361
528 Ga0070660_100856105
529 Ga0070691_10515037
530 Ga0070687_100105224
531 Ga0070687_100749120
532 Ga0070661_100273087
533 Ga0070692_10090378
534 Ga0070668_100767126
535 Ga0070668_100915079
536 Ga0070669_100133675
537 Ga0070675_100400345
538 Ga0070671_100443130
539 Ga0070674_100136447
540 Ga0070674_100748394
541 Ga0070674_101206907
542 Ga0070673_100306781
543 Ga0070659_100035635
544 Ga0070714_100095526
545 Ga0070714_100670677
546 Ga0070713_100015622
547 Ga0070710_10044674
548 Ga0070711_100060259
549 Ga0070700_100100997
550 Ga0070700_100265095
551 Ga0070663_100275549
552 Ga0070678_100197821
553 Ga0070662_100505052
554 Ga0068867_100194401
555 Ga0068867_100477411
556 Ga0070685_10317591
557 Ga0070685_11366908
558 Ga0070679_101718210
559 Ga0070672_100207100
560 Ga0070672_100568396
561 Ga0070672_101366222
562 Ga0070686_100269351
563 Ga0070696_100656727
564 Ga0070693_100228091
565 Ga0070693_100851587
566 Ga0070693_101129498
567 Ga0070665_100109022
568 Ga0070704_101024050
569 Ga0070664_100056077
570 Ga0070664_100101947
571 Ga0070664_100525236
572 Ga0068854_100142377
573 Ga0068854_100648225
574 Ga0068856_100193389
575 Ga0068856_101353709
576 Ga0070702_100022394
577 Ga0070702_100315043
578 Ga0070702_100928240
579 Ga0068852_100620850
580 Ga0068852_100980413
581 Ga0068852_101212998
582 Ga0068864_100607758
583 Ga0068864_100677404
584 Ga0068866_10054645
585 Ga0068866_10150658
586 Ga0068861_100036402
587 Ga0068861_100180355
588 Ga0068851_10251970
589 Ga0068851_10391847
590 Ga0068870_10157666
591 Ga0068870_10276695
592 Ga0081455_10013066
593 Ga0081455_10364808
594 Ga0081538_10039932
595 Ga0081538_10134645
596 Ga0081540_1001048
597 Ga0081539_10010836
598 Ga0070717_10000001
599 Ga0070717_10022385
600 Ga0070717_10410153
601 Ga0075363_100401959
602 Ga0070712_100013702
603 Ga0068871_100762826
604 Ga0075428_100976540
605 Ga0075431_100129629
606 Ga0075433_10712719
607 Ga0075434_100658986
608 Ga0068865_100048127
609 Ga0068865_101257723
610 Ga0075436_100463138
611 Ga0097620_101093541
612 Ga0105251_10202229
613 Ga0105244_10157240
614 Ga0105240_10134768
615 Ga0111539_10200146
616 Ga0111539_10479146
617 Ga0111539_11083813
618 Ga0111539_11410277
619 Ga0105245_10107804
620 Ga0105245_10111385
621 Ga0105245_10266549
622 Ga0105245_10465868
623 Ga0105245_10753050
624 Ga0105247_10034999
625 Ga0105247_10307485
626 Ga0114129_12011918
627 Ga0105243_10076884
628 Ga0105243_10108841
629 Ga0105243_10125681
630 Ga0105243_10339750
631 Ga0105243_10629437
632 Ga0105241_10436957
633 Ga0105242_10258968
634 Ga0105248_10319289
635 Ga0105248_10548299
636 Ga0105237_11941561
637 Ga0105238_10575693
638 Ga0105238_10634119
639 Ga0105249_10371202
640 Ga0105249_10650848
641 Ga0105239_10346274
642 Ga0105246_10401976
643 Ga0105246_10813475
644 Ga0157329_1016327
645 Ga0157371_11105421
646 Ga0157369_10996274
647 Ga0157369_11210957
648 Ga0163162_10153787
649 Ga0157372_10146183
650 Ga0157372_10820641
651 Ga0157372_12982760
652 Ga0157375_10659937
653 Ga0157375_13445438
654 Ga0163163_10061256
655 Ga0163163_10213057
656 Ga0163163_10644310
657 Ga0157380_10158402
658 Ga0157380_11067909
659 Ga0157380_13490975
660 Ga0157377_10115422
661 Ga0157377_10132377
662 Ga0157377_10336044
663 Ga0157379_10149260
664 Ga0157379_10426764
665 Ga0157379_11155752
666 Ga0157376_10528157
667 Ga0163161_10328982
668 Ga0213876_10087648
669 Ga0213875_10000351
670 Ga0213875_10036726
671 Ga0213875_10046194
672 Ga0213875_10244203
673 Ga0207656_10097479
674 Ga0207656_10417044
675 Ga0207682_10606948
676 Ga0207692_10411152
677 Ga0207642_10062843
678 Ga0207642_10447746
679 Ga0207642_10479682
680 Ga0207688_10005034
681 Ga0207688_10191222
682 Ga0207688_10416733
683 Ga0207680_10193575
684 Ga0207647_10044563
685 Ga0207643_10008536
686 Ga0207643_10051915
687 Ga0207643_10747317
688 Ga0207695_10171946
689 Ga0207693_10053381
690 Ga0207663_10043766
691 Ga0207662_10010234
692 Ga0207662_10229093
693 Ga0207662_10445530
694 Ga0207662_10708666
695 Ga0207657_10079428
696 Ga0207657_10242861
697 Ga0207657_10484634
698 Ga0207649_10212301
699 Ga0207649_10984081
700 Ga0207652_10703623
701 Ga0207681_10143705
702 Ga0207681_10408433
703 Ga0207681_11067629
704 Ga0207694_10441554
705 Ga0207650_10530731
706 Ga0207659_10591371
707 Ga0207687_10051711
708 Ga0207687_10091327
709 Ga0207687_10214457
710 Ga0207687_10268423
711 Ga0207687_10571494
712 Ga0207664_10000004
713 Ga0207664_10003392
714 Ga0207664_10308289
715 Ga0207664_10660500
716 Ga0207644_10307648
717 Ga0207690_10710697
718 Ga0207690_11439104
719 Ga0207706_10203832
720 Ga0207706_10257402
721 Ga0207706_10462538
722 Ga0207706_10780749
723 Ga0207686_10177237
724 Ga0207686_10692217
725 Ga0207709_10063942
726 Ga0207709_10432984
727 Ga0207669_10102338
728 Ga0207704_10142546
729 Ga0207704_10540120
730 Ga0207665_10599203
731 Ga0207691_10051774
732 Ga0207691_10258214
733 Ga0207691_10291929
734 Ga0207691_10330466
735 Ga0207691_10778187
736 Ga0207711_10525541
737 Ga0207689_10345065
738 Ga0207689_10404119
739 Ga0207661_10178689
740 Ga0207661_10250670
741 Ga0207661_10287838
742 Ga0207661_10877273
743 Ga0207679_10056239
744 Ga0207679_10214418
745 Ga0207679_10246098
746 Ga0207651_10213485
747 Ga0207651_11347686
748 Ga0207712_10108333
749 Ga0207712_10770406
750 Ga0207668_10191738
751 Ga0207668_11081919
752 Ga0207668_11105487
753 Ga0207640_10503391
754 Ga0207640_11224549
755 Ga0207677_10045739
756 Ga0207677_10166161
757 Ga0207677_10216350
758 Ga0207677_10703832
759 Ga0207703_11837621
760 Ga0207639_11316176
761 Ga0207678_10059737
762 Ga0207678_10101975
763 Ga0207678_10172451
764 Ga0207678_10244938
765 Ga0207708_10022420
766 Ga0207708_10071687
767 Ga0207708_10248912
768 Ga0207708_10332232
769 Ga0207708_11247881
770 Ga0207702_10121401
771 Ga0207702_10375849
772 Ga0207702_10932887
773 Ga0207641_10118480
774 Ga0207641_10256397
775 Ga0207648_10056653
776 Ga0207648_10104787
777 Ga0207648_10492740
778 Ga0207648_10695776
779 Ga0207676_10864267
780 Ga0207676_10883554
781 Ga0207674_10106903
782 Ga0207674_10297390
783 Ga0207675_100027402
784 Ga0207675_100054475
785 Ga0207683_10095629
786 Ga0207683_10472400
787 Ga0207698_10620279
788 Ga0207698_10761645
789 Ga0207698_10803131
790 Ga0207698_10998362
791 Ga0207698_11010987
792 Ga0207428_10508982
793 Ga0268266_10088815
794 Ga0268266_10180848
795 Ga0268265_10298135
796 Ga0268264_10387283
797 Ga0265337_1176427
798 Ga0265326_10000006
799 Ga0265334_10000016
800 Ga0265338_10000961
801 Ga0265340_10291133
802 Ga0307405_10425373
803 Ga0307405_10704148
804 Ga0307413_10446999
805 Ga0307410_10790822
806 Ga0307406_10832920
807 Ga0307412_10789321
808 Ga0307409_100051004
809 Ga0307416_100075257
810 Ga0307416_100302456
811 Ga0307416_100555605
812 Ga0307416_100902171
813 Ga0307416_101072153
814 Ga0307411_10760769
815 Ga0307411_11222183
816 Ga0307411_11568210
817 Ga0307415_100031211
818 Ga0307415_100363410
819 Ga0307415_100430669
820 Ga0307415_101250332
821 Ga0307415_101442994
822 Ga0373942_0129651
823 Ga0373935_0690971
824 Ga0395900_0316009
825 Ga0395900_1170986
826 Ga0395898_0462162
827 Ga0395898_0733143
828 Ga0436364_0358577
829 Ga0436364_0790855
830 Ga0436364_0838033
831 Ga0436364_1426665
832 Ga0395901_0513673
833 Ga0395901_0579181
834 Ga0395901_0666971
835 Ga0242420_015434
836 Ga0436365_0095147
837 Ga0436365_0720259
838 Ga0436365_1207802
839 Ga0436365_1486005
840 Ga0436361_0272158
841 Ga0436363_0023518
842 Ga0436363_0430150
843 Ga0436363_0554644
844 Ga0436363_0595781
845 Ga0436363_0962015
846 Ga0436362_0061179
847 Ga0451789_0786662
848 Ga0451791_0375976
849 Ga0451791_1170775
850 Ga0451800_1432649
851 Ga0451833_1279285
852 Ga0451853_2596443
853 Ga0451853_2801483
854 Ga0439448_0150675
855 Ga0439450_077808
856 Ga0439463_123069
857 Ga0439458_0113528
858 Ga0439435_0251572
859 Ga0439459_0010293
860 Ga0439460_0081474
861 Ga0466965_0750473
862 Ga0466965_0887795
863 Ga0466966_0088810
864 Ga0466963_0002619
865 Ga0466963_0022738
866 Ga0466963_0031412
867 Ga0466963_0143215
868 Ga0466963_0385141
869 Ga0466963_0460420
870 Ga0466963_0465403
871 Ga0466963_0765374
872 Ga0466964_0167625
873 Ga0466964_0212705
874 Ga0466964_0241199
875 Ga0466964_0293349
876 Ga0466964_0402738
877 Ga0466971_0003944
878 Ga0466971_0214992
879 Ga0466968_0103183
880 Ga0466968_0130927
881 Ga0466968_0517521
882 Ga0466970_0030634
883 Ga0466970_0197308
884 Ga0466970_0212093
885 Ga0466970_0252414
886 Ga0466957_0048520
887 Ga0466957_0071353
888 Ga0466957_0126828
889 Ga0466957_0203486
890 Ga0466957_0283740
891 Ga0466957_0717754
892 Ga0466960_0097603
893 Ga0466960_0438900
894 Ga0466960_0761467
895 Ga0466959_0017231
896 Ga0466959_0034204
897 Ga0466959_0044829
898 Ga0466959_0282446
899 Ga0466959_0316413
900 Ga0466959_0582000
901 Ga0466959_0672678
902 Ga0466959_0795078
903 Ga0466958_0009686
904 Ga0466958_0021402
905 Ga0466958_0035334
906 Ga0466958_0204887
907 Ga0466958_0232478
908 Ga0466967_0003189
909 Ga0466967_0005224
910 Ga0466967_0061345
911 Ga0466967_0076518
912 Ga0466967_0128138
913 Ga0466967_0287731
914 Ga0466967_0287837
915 Ga0466967_0303967
916 Ga0466967_0310280
917 Ga0466967_0317949
918 Ga0466967_0354314
919 Ga0466967_0485682
920 Ga0466967_1081806
921 Ga0466967_1399048
922 Ga0495603_0232424
923 Ga0495641_0018791
924 Ga0495584_0030716
925 Ga0495596_0239231
926 Ga0495620_0160764
927 Ga0495644_0079511
928 Ga0495654_0310382
929 Ga0495665_0319572
930 Ga0495597_0094774
931 Ga0495645_0398903
932 Ga0495656_0239188
933 Ga0495656_0258200
934 Ga0495658_0391279
935 Ga0495589_0452778
936 Ga0495581_0529054
937 Ga0495674_0581490
938 Ga0495672_0435595
939 Ga0495676_0259832
940 Ga0495676_0277324
941 Ga0495677_0238766
942 Ga0496100_0000263
943 Ga0496100_0027994
944 Ga0496100_0125902
945 Ga0496100_0409378
946 Ga0496101_0000448
947 Ga0496101_0127526
948 Ga0496101_0160940
949 Ga0496101_0219400
950 Ga0496102_0020424
951 Ga0496102_0843642
952 Ga0496103_0165182
953 Ga0496104_0003622
954 Ga0496104_0265924
955 Ga0496104_0963397
956 Ga0496105_0004110
957 Ga0496105_0072661
958 Ga0496105_0172386
959 Ga0496105_0579325
960 Ga0496106_0056599
961 Ga0496106_0071322
962 Ga0496106_0213545
963 Ga0496106_0227459
964 Ga0496107_0116183
965 Ga0496107_0251381
966 Ga0496108_0000407
967 Ga0496108_0065853
968 Ga0496108_0109114
969 Ga0496109_0013268
970 Ga0496109_0016546
971 Ga0496109_0360463
972 Ga0496109_0393411
973 Ga0496109_0454809
974 Ga0496109_0697088
975 Ga0496109_1133578
976 Ga0496110_0000936
977 Ga0496110_0020514
978 Ga0496110_0190529
979 Ga0496110_0674186
980 Ga0496110_0675614
981 Ga0496111_0058420
982 Ga0496111_0287753
983 Ga0496112_0034156
984 Ga0496112_0190755
985 Ga0496112_0452528
986 Ga0496112_0619365
987 Ga0496112_0888459
988 Ga0496113_0003853
989 Ga0496113_0050928
990 Ga0496113_0173823
991 Ga0496113_0332856
992 Ga0496113_1113220
993 Ga0496114_0184888
994 Ga0496114_0692606
995 Ga0496115_0000023
996 Ga0496117_0557216
997 Ga0496120_0469325
998 Ga0496121_0021265
999 Ga0496121_0333571
1000 Ga0501031_0110954
1001 Ga0501032_0141941
1002 Ga0501037_0065949
1003 Ga0501038_0055667
1004 Ga0501039_0107166
1005 Ga0501042_0041308
1006 Ga0501043_0055352
1007 Ga0501043_0851186
1008 Ga0501046_0019635
1009 Ga0501047_0421240
1010 Ga0501048_0043609
1011 Ga0501067_0060054
1012 Ga0501068_0048435
1013 Ga0501070_0035205
1014 Ga0501071_0060962
1015 Ga0501072_1013009
1016 Ga0501079_0298742
1017 Ga0501081_1145880
1018 Ga0501083_0035587
1019 Ga0501035_0039791
1020 Ga0501045_0336331
1021 nmdc:mga03n38_330223_c1
1022 nmdc:mga05p37_1051608_c1
1023 nmdc:mga08y16_1115232_c1
1024 nmdc:mga08y16_137663_c1
1025 nmdc:mga0n895_576416_c1
1026 Ga0495655_0153927
1027 Ga0500641_0405637
1028 Ga0500616_0079699
1029 Ga0501084_0022867
1030 Ga0501082_0176712
1031 Ga0466962_0020519
1032 Ga0466962_0583810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

24

154

0.93

PF01575

MaoC_dehydratas

MaoC like domain

21

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f41-assembly2.cif.gz_D crystal structure of fapr- a global regulator of fatty acid biosynthesis in b. subtilis 0.8851 83 141
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8665 4 145
4a12-assembly1.cif.gz_B structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator 0.8646 83 146
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.8608 1 144
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.8596 1 144
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8886 6 146 3.10.129.10
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8712 83 143 3.10.129.10
af_Q86HX3_15_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8662 84 140 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8595 1 144 3.10.129.10
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8552 6 146 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6F8YKQ5-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9477 65 146
AF-A0A6J4T4L8-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9438 11 146 GO:0016836
AF-A0A7K0PEW4-F1-model_v4 MaoC family dehydratase 0.9378 8 146 GO:0006633
GO:0019171
AF-A0A7C4SWN5-F1-model_v4 Dehydratase 0.9303 1 145 GO:0003857
GO:0004300
GO:0006635
GO:0044594
AF-A0A7Y4TZX9-F1-model_v4 Dehydratase 0.9282 1 145 GO:0003857
GO:0004300
GO:0005777
GO:0006635
GO:0044594

Map