F458071

General Info

Members Datasets Scaffolds Average Seq Length
516 331 1032 334

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510917015|2511102186
Length 385
Sequence LRAGLLTTVQDLGRPGYRHLGVATGGALDTLALEVGNRLVGNRPDAAGLEITFGPVALRFARATRVAITGTDFGATLGGRPVWSWWSLPVAAGEELVLNGAKRGMRAYVCAAGGIDVLPMLGSRSTDLAAGFGGLAGRALKDGDRLATGASFAPGRERAALDPGAPAFGVKAPVWCNFALADEPHHRRPRHPDGMAWAVPVRVLRGPEYDSFTPEAQRTLWSDEWQITPNSNRMGFRLTGTPLARASGADLLSHAVLPGTIQVPPSGQPIVLMADAQTTGGYPKIGSVIRADWWKLAQVRLTAGVRFVEATPAAARAALEEERAYLRQIDAAIAMHDERFASRRANGVASGVSSGISSGISSGISSGISSGVSGGVSGRVSSASA

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
117 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
123 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
124 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
147 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
148 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
153 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
238 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
239 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
244 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
245 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
253 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
254 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
258 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
259 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
260 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
261 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
262 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
263 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
264 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
265 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
266 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
267 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
268 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
269 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
270 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
271 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
272 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
273 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
274 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
275 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
276 2643221658 Variovorax sp. Root411 Isolate Unclassified
277 2643221672 Variovorax sp. Root434 Isolate Unclassified
278 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
279 2738541277 Variovorax sp. GV051 Isolate Unclassified
280 2738541307 Variovorax sp. GV008 Isolate Unclassified
281 2738543013 Variovorax sp. BT01 Isolate Unclassified
282 2738543019 Variovorax sp. GV040 Isolate Unclassified
283 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
284 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
285 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
286 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
287 2818991436 Collimonas arenae 515 Isolate Unclassified
288 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
289 2818991446 Variovorax sp. 1180 Isolate Unclassified
290 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
291 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
292 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
293 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
294 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
295 2842677519 Variovorax sp. R-72495 Isolate Unclassified
296 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
297 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
298 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
299 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
300 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
301 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
302 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
303 2885198086 Variovorax sp. 679 Isolate Unclassified
304 2885211737 Variovorax sp. 553 Isolate Unclassified
305 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
306 2899924645 Variovorax sp. 369 Isolate Unclassified
307 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
308 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
309 2904456579 Variovorax sp. 2002 Isolate Unclassified
310 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
311 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
312 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
313 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
314 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
315 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
316 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
317 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
318 2928037797 Variovorax sp. 1126 Isolate Unclassified
319 2928044640 Variovorax sp. 1128 Isolate Unclassified
320 2928051484 Variovorax sp. 1133 Isolate Unclassified
321 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
322 2928070936 Variovorax gossypii 1167 Isolate Unclassified
323 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
324 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
325 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
326 2929520902 Variovorax beijingensis 502 Isolate Unclassified
327 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
328 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
329 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
330 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
331 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.88
Metatranscriptomes 0.58
Isolates 14.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.98
Nodule 2.91
Rhizoplane 1.74
Rhizosphere 47.67
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000459 3300002704 Bacteria 10374
2 JGI25155J39150_1000754 3300002704 Bacteria 5414
3 JGI25156J39149_1001386 3300002705 Bacteria 10368
4 JGI25156J39149_1011060 3300002705 Bacteria 2068
5 JGI25162J39368_1000023 3300002737 Bacteria 236658
6 JGI25154J39366_1000706 3300002738 Bacteria 15200
7 JGI25154J39366_1000836 3300002738 Bacteria 13393
8 JGI25157J39369_1000359 3300002741 Bacteria 31770
9 JGI25163J39215_1003613 3300002771 Bacteria 1211
10 JGI25152J39213_1006922 3300002773 Bacteria 2997
11 JGI25151J46595_10000872 3300003187 Bacteria 23847
12 JGI25151J46595_10001057 3300003187 Bacteria 20535
13 JGI25151J46595_10001511 3300003187 Bacteria 15561
14 JGI25151J46595_10055216 3300003187 Bacteria 1311
15 JGI25165J46597_1000030 3300003214 Bacteria 305254
16 rootL2_10111768 3300003322 Bacteria 3863
17 rootL2_10172394 3300003322 Bacteria 3385
18 rootH1_10008652 3300003323 Bacteria 3275
19 Ga0006562J51391_1077671 3300003578 Bacteria 10770
20 Ga0006562J51391_1077673 3300003578 Bacteria 6100
21 Ga0006562J51391_1081221 3300003578 Bacteria 3900
22 Ga0055538_1000017 3300003751 Bacteria 305254
23 Ga0055538_1000155 3300003751 Bacteria 46426
24 Ga0055539_1000022 3300003752 Bacteria 305254
25 Ga0055539_1000205 3300003752 Bacteria 46426
26 Ga0055533_1000030 3300003756 Bacteria 305254
27 Ga0055533_1000207 3300003756 Bacteria 46426
28 Ga0055532_1000023 3300003758 Bacteria 248212
29 Ga0055525_1000034 3300003759 Bacteria 305254
30 Ga0055525_1000284 3300003759 Bacteria 46426
31 Ga0055535_1000894 3300003761 Bacteria 20406
32 Ga0055542_1000074 3300003762 Bacteria 141185
33 Ga0055526_1008124 3300003771 Bacteria 5289
34 Ga0055526_1012806 3300003771 Bacteria 3618
35 Ga0055537_1000049 3300003773 Bacteria 87244
36 Ga0055537_1001494 3300003773 Bacteria 9000
37 Ga0055537_1001937 3300003773 Bacteria 7401
38 Ga0055524_1000491 3300003775 Bacteria 31117
39 Ga0055536_1008597 3300003781 Bacteria 4360
40 Ga0055534_1000049 3300003784 Bacteria 92974
41 Ga0055534_1000456 3300003784 Bacteria 23742
42 Ga0055534_1003358 3300003784 Bacteria 5062
43 Ga0055534_1004235 3300003784 Bacteria 4225
44 Ga0055534_1009666 3300003784 Bacteria 2077
45 Ga0055528_1001619 3300003790 Bacteria 13302
46 Ga0055528_1003830 3300003790 Bacteria 7402
47 Ga0055530_10001472 3300003791 Bacteria 17104
48 Ga0055530_10015884 3300003791 Bacteria 2432
49 Ga0055540_1000879 3300003792 Bacteria 19891
50 Ga0055540_1001733 3300003792 Bacteria 12525
51 Ga0055540_1012035 3300003792 Bacteria 2744
52 Ga0055531_10001127 3300003794 Bacteria 20691
53 Ga0055531_10006654 3300003794 Bacteria 6490
54 Ga0055541_1000015 3300003841 Bacteria 305254
55 Ga0055541_1000133 3300003841 Bacteria 46426
56 Ga0065714_10068536 3300005288 Bacteria 4663
57 Ga0070658_10216367 3300005327 Bacteria 1619
58 Ga0070660_100019826 3300005339 Bacteria 4933
59 Ga0070661_100042701 3300005344 Bacteria 3310
60 Ga0070674_100012504 3300005356 Bacteria 5214
61 Ga0068853_100006764 3300005539 Bacteria 9134
62 Ga0068855_100007926 3300005563 Bacteria 12835
63 Ga0068855_100016180 3300005563 Bacteria 8968
64 Ga0068855_100102792 3300005563 Bacteria 3289
65 Ga0068855_100290779 3300005563 Bacteria 1811
66 Ga0068857_100039265 3300005577 Bacteria 4193
67 Ga0068856_100055082 3300005614 Bacteria 3925
68 Ga0068852_100079388 3300005616 Bacteria 2907
69 Ga0068851_10008702 3300005834 Bacteria 4700
70 Ga0068862_100011851 3300005844 Bacteria 7200
71 Ga0075363_100033138 3300006048 Bacteria 2688
72 Ga0075363_100099578 3300006048 Bacteria 1607
73 Ga0075364_10007995 3300006051 Bacteria 6302
74 Ga0075364_10086761 3300006051 Bacteria 2074
75 Ga0075432_10006234 3300006058 Bacteria 4053
76 Ga0075362_10005019 3300006177 Bacteria 4805
77 Ga0075367_10171997 3300006178 Bacteria 1349
78 Ga0075366_10011218 3300006195 Bacteria 5055
79 Ga0075366_10082699 3300006195 Bacteria 1918
80 Ga0075370_10001114 3300006353 Bacteria 11245
81 Ga0075370_10003360 3300006353 Bacteria 7607
82 Ga0075370_10013768 3300006353 Bacteria 4303
83 Ga0075370_10122309 3300006353 Bacteria 1516
84 Ga0079104_1002433 3300006946 Bacteria 10055
85 Ga0079104_1033342 3300006946 Bacteria 1261
86 Ga0099826_10000007 3300006948 Bacteria 393518
87 Ga0099826_10007798 3300006948 Bacteria 7925
88 Ga0105251_10070916 3300009011 Bacteria 1622
89 Ga0105240_10006080 3300009093 Bacteria 17818
90 Ga0105240_10010984 3300009093 Bacteria 12680
91 Ga0105240_10045071 3300009093 Bacteria 5597
92 Ga0105240_10112118 3300009093 Bacteria 3298
93 Ga0105240_10187984 3300009093 Bacteria 2431
94 Ga0105237_10164482 3300009545 Bacteria 2217
95 Ga0105237_10304432 3300009545 Bacteria 1597
96 Ga0105237_10305507 3300009545 Bacteria 1594
97 Ga0105238_10002922 3300009551 Bacteria 17052
98 Ga0105246_10047951 3300011119 Bacteria 2919
99 Ga0157347_1000188 3300012502 Bacteria 3432
100 Ga0157373_10017716 3300013100 Bacteria 5186
101 Ga0157373_10197744 3300013100 Bacteria 1417
102 Ga0157371_10154689 3300013102 Bacteria 1636
103 Ga0157370_10015763 3300013104 Bacteria 7671
104 Ga0157369_10351559 3300013105 Bacteria 1531
105 Ga0182008_10005473 3300014497 Bacteria 7231
106 Ga0182008_10066865 3300014497 Bacteria 1769
107 Ga0182006_1001767 3300015261 Bacteria 12532
108 Ga0182006_1023681 3300015261 Bacteria 2541
109 Ga0182007_10000319 3300015262 Bacteria 30540
110 Ga0182007_10001545 3300015262 Bacteria 12265
111 Ga0182007_10007307 3300015262 Bacteria 4643
112 Ga0182007_10030712 3300015262 Bacteria 1834
113 Ga0182005_1000360 3300015265 Bacteria 25495
114 Ga0183362_10005 3300015683 Bacteria 437616
115 Ga0163161_10000320 3300017792 Bacteria 41236
116 Ga0163161_10004197 3300017792 Bacteria 10059
117 Ga0209435_100013 3300025206 Bacteria 366789
118 Ga0209435_100145 3300025206 Bacteria 23871
119 Ga0209436_105910 3300025208 Bacteria 2744
120 Ga0209784_100002 3300025224 Bacteria 1753105
121 Ga0209784_100034 3300025224 Bacteria 305504
122 Ga0209566_100003 3300025225 Bacteria 1753105
123 Ga0209566_100038 3300025225 Bacteria 305504
124 Ga0209674_100004 3300025226 Bacteria 1753105
125 Ga0209674_100056 3300025226 Bacteria 305504
126 Ga0209672_100480 3300025228 Bacteria 22362
127 Ga0209672_100925 3300025228 Bacteria 13270
128 Ga0209147_100030 3300025229 Bacteria 366789
129 Ga0209147_101353 3300025229 Bacteria 9225
130 Ga0209563_100006 3300025230 Bacteria 1753105
131 Ga0209563_100057 3300025230 Bacteria 305604
132 Ga0207427_100245 3300025231 Bacteria 43757
133 Ga0209437_100071 3300025233 Bacteria 305604
134 Ga0209437_100265 3300025233 Bacteria 80495
135 Ga0209258_100176 3300025242 Bacteria 141261
136 Ga0209258_100205 3300025242 Bacteria 119727
137 Ga0207425_1000274 3300025245 Bacteria 37943
138 Ga0209646_1000034 3300025246 Bacteria 366789
139 Ga0209646_1000321 3300025246 Bacteria 36870
140 Ga0209026_1000022 3300025250 Bacteria 366789
141 Ga0209026_1001923 3300025250 Bacteria 8400
142 Ga0209677_100003 3300025253 Bacteria 1753105
143 Ga0209677_100035 3300025253 Bacteria 305504
144 Ga0209148_1000033 3300025254 Bacteria 555508
145 Ga0209759_1000018 3300025256 Bacteria 366789
146 Ga0209759_1000599 3300025256 Bacteria 34894
147 Ga0209129_1000270 3300025258 Bacteria 50956
148 Ga0209129_1006434 3300025258 Bacteria 3791
149 Ga0209233_1000094 3300025261 Bacteria 305604
150 Ga0209565_1000020 3300025263 Bacteria 432627
151 Ga0209565_1000106 3300025263 Bacteria 122574
152 Ga0209565_1000484 3300025263 Bacteria 29227
153 Ga0209565_1001828 3300025263 Bacteria 8550
154 Ga0209455_1010908 3300025272 Bacteria 2274
155 Ga0209673_1000295 3300025273 Bacteria 92499
156 Ga0209673_1001140 3300025273 Bacteria 29216
157 Ga0209673_1002762 3300025273 Bacteria 11469
158 Ga0209130_1000558 3300025284 Bacteria 36936
159 Ga0209130_1000560 3300025284 Bacteria 36900
160 Ga0209130_1004616 3300025284 Bacteria 5135
161 Ga0209675_1000014 3300025291 Bacteria 421902
162 Ga0209675_1000168 3300025291 Bacteria 79360
163 Ga0209675_1000363 3300025291 Bacteria 38568
164 Ga0209675_1000506 3300025291 Bacteria 29087
165 Ga0209675_1004572 3300025291 Bacteria 6103
166 Ga0209675_1011140 3300025291 Bacteria 3002
167 Ga0209676_1000036 3300025292 Bacteria 457623
168 Ga0209676_1000048 3300025292 Bacteria 403716
169 Ga0209676_1000124 3300025292 Bacteria 194206
170 Ga0209676_1003151 3300025292 Bacteria 10532
171 Ga0209676_1029132 3300025292 Bacteria 1709
172 Ga0209676_1035313 3300025292 Bacteria 1467
173 Ga0209676_1047892 3300025292 Bacteria 1146
174 Ga0209025_1000204 3300025294 Bacteria 142193
175 Ga0209025_1000462 3300025294 Bacteria 79379
176 Ga0209025_1000733 3300025294 Bacteria 55578
177 Ga0209025_1001247 3300025294 Bacteria 35308
178 Ga0209025_1003410 3300025294 Bacteria 15079
179 Ga0209025_1007631 3300025294 Bacteria 8003
180 Ga0209025_1008440 3300025294 Bacteria 7413
181 Ga0209025_1032464 3300025294 Bacteria 2440
182 Ga0209564_1000753 3300025295 Bacteria 45895
183 Ga0209564_1000760 3300025295 Bacteria 45546
184 Ga0209564_1001348 3300025295 Bacteria 26048
185 Ga0209564_1003006 3300025295 Bacteria 12082
186 Ga0209564_1003952 3300025295 Bacteria 9443
187 Ga0209758_1000833 3300025297 Bacteria 43061
188 Ga0209758_1016188 3300025297 Bacteria 3802
189 Ga0209758_1021733 3300025297 Bacteria 2978
190 Ga0209050_1000012 3300025298 Bacteria 813717
191 Ga0209050_1001006 3300025298 Bacteria 35335
192 Ga0209050_1003791 3300025298 Bacteria 10807
193 Ga0209256_1000095 3300025299 Bacteria 206120
194 Ga0209256_1000220 3300025299 Bacteria 106021
195 Ga0209256_1000527 3300025299 Bacteria 55578
196 Ga0207426_1001012 3300025302 Bacteria 27217
197 Ga0207426_1001262 3300025302 Bacteria 22097
198 Ga0209051_1000019 3300025303 Bacteria 511268
199 Ga0209051_1000099 3300025303 Bacteria 165161
200 Ga0209051_1000579 3300025303 Bacteria 43794
201 Ga0209051_1019700 3300025303 Bacteria 2933
202 Ga0209257_1000024 3300025304 Bacteria 726068
203 Ga0209257_1000258 3300025304 Bacteria 122220
204 Ga0209257_1012279 3300025304 Bacteria 3984
205 Ga0207656_10016242 3300025321 Bacteria 2896
206 Ga0207656_10104418 3300025321 Bacteria 1302
207 Ga0207655_1012656 3300025728 Bacteria 4908
208 Ga0207705_10000761 3300025909 Bacteria 26624
209 Ga0207695_10006378 3300025913 Bacteria 15351
210 Ga0207695_10009955 3300025913 Bacteria 11684
211 Ga0207695_10111530 3300025913 Bacteria 2714
212 Ga0207671_10215873 3300025914 Bacteria 1502
213 Ga0207671_10280682 3300025914 Bacteria 1314
214 Ga0207681_10126460 3300025923 Bacteria 1883
215 Ga0207694_10002354 3300025924 Bacteria 15458
216 Ga0207706_10010483 3300025933 Bacteria 8469
217 Ga0207706_10108566 3300025933 Bacteria 2442
218 Ga0207709_10063408 3300025935 Bacteria 2317
219 Ga0207669_10101618 3300025937 Bacteria 1902
220 Ga0207667_10000276 3300025949 Bacteria 70838
221 Ga0207667_10000438 3300025949 Bacteria 55784
222 Ga0207667_10032940 3300025949 Bacteria 5577
223 Ga0207667_10181532 3300025949 Bacteria 2161
224 Ga0207668_10093851 3300025972 Bacteria 2212
225 Ga0207639_10156733 3300026041 Bacteria 1914
226 Ga0207702_10020507 3300026078 Bacteria 5471
227 Ga0207674_10030972 3300026116 Bacteria 5622
228 Ga0207698_10298690 3300026142 Bacteria 1498
229 Ga0209281_1016793 3300027111 Bacteria 1497
230 Ga0209282_1000061 3300027666 Bacteria 96444
231 Ga0209282_1000501 3300027666 Bacteria 19021
232 Ga0207428_10143218 3300027907 Bacteria 1823
233 Ga0268266_10064452 3300028379 Bacteria 3165
234 Ga0268265_10017960 3300028380 Bacteria 4894
235 Ga0265338_10001135 3300028800 Bacteria 44081
236 Ga0314311_1043350 3300030733 Bacteria 3455
237 Ga0316178_1108165 3300030735 Bacteria 2376
238 Ga0316183_1097411 3300030742 Bacteria 8021
239 Ga0316181_1138108 3300030744 Bacteria 2155
240 Ga0265340_10069869 3300031247 Bacteria 1666
241 Ga0265331_10022699 3300031250 Bacteria 3199
242 Ga0265327_10000698 3300031251 Bacteria 53455
243 Ga0265327_10001208 3300031251 Bacteria 34808
244 Ga0307513_10113721 3300031456 Bacteria 2694
245 Ga0307514_10015883 3300031649 Bacteria 6203
246 Ga0307405_10018086 3300031731 Bacteria 3881
247 Ga0307405_10064576 3300031731 Bacteria 2327
248 Ga0307413_10022834 3300031824 Bacteria 3380
249 Ga0307406_10011586 3300031901 Bacteria 5009
250 Ga0307406_10215711 3300031901 Bacteria 1423
251 Ga0307412_10065481 3300031911 Bacteria 2459
252 Ga0307412_10120698 3300031911 Bacteria 1886
253 Ga0307414_10128368 3300032004 Bacteria 1963
254 Ga0307411_10000669 3300032005 Bacteria 12542
255 Ga0307411_10201294 3300032005 Bacteria 1529
256 Ga0395899_0000308 3300037312 Bacteria 62516
257 Ga0395900_0000159 3300037418 Bacteria 111486
258 Ga0395900_0005041 3300037418 Bacteria 13859
259 Ga0395898_0000425 3300037466 Bacteria 89768
260 Ga0395898_0002495 3300037466 Bacteria 21639
261 Ga0395898_0020013 3300037466 Bacteria 6803
262 Ga0395905_0024463 3300037471 Bacteria 5700
263 Ga0395901_0000017 3300038443 Bacteria 345003
264 Ga0395901_0000109 3300038443 Bacteria 112882
265 Ga0395901_0296773 3300038443 Bacteria 1676
266 Ga0436361_0159409 3300039447 Bacteria 43692
267 Ga0436361_0339053 3300039447 Bacteria 16474
268 Ga0436361_0371158 3300039447 Unclassified 2139
269 Ga0439436_0008551 3300041404 Bacteria 3148
270 Ga0439466_0003682 3300041411 Bacteria 5917
271 Ga0439442_000830 3300042002 Bacteria 6368
272 Ga0450898_002806 3300042134 Bacteria 2447
273 Ga0450906_000601 3300042145 Bacteria 7655
274 Ga0450908_001510 3300042184 Bacteria 4520
275 Ga0439434_0000518 3300042435 Bacteria 10981
276 Ga0466969_0019995 3300044656 Bacteria 3470
277 Ga0466969_0041349 3300044656 Bacteria 2306
278 Ga0466969_0070707 3300044656 Bacteria 1678
279 Ga0466972_0099177 3300044658 Bacteria 1379
280 Ga0466973_0080925 3300044659 Bacteria 2844
281 Ga0466977_0000036 3300044666 Bacteria 22554
282 Ga0466965_0030449 3300044683 Bacteria 2629
283 Ga0466966_0000024 3300044684 Bacteria 110205
284 Ga0466966_0000134 3300044684 Bacteria 47765
285 Ga0466966_0007082 3300044684 Bacteria 7432
286 Ga0466961_0006172 3300044693 Bacteria 7607
287 Ga0466961_0023570 3300044693 Bacteria 3960
288 Ga0466961_0115861 3300044693 Bacteria 1684
289 Ga0466963_0004731 3300044694 Bacteria 7944
290 Ga0466963_0057530 3300044694 Bacteria 2589
291 Ga0466964_0020470 3300044706 Bacteria 2548
292 Ga0453684_0034048 3300044712 Bacteria 7083
293 Ga0466971_0001591 3300044719 Bacteria 9582
294 Ga0466971_0002073 3300044719 Bacteria 8499
295 Ga0466970_0009385 3300044765 Bacteria 4946
296 Ga0466970_0016868 3300044765 Bacteria 3770
297 Ga0466970_0019354 3300044765 Bacteria 3528
298 Ga0466957_0003563 3300044842 Bacteria 8576
299 Ga0466957_0011686 3300044842 Bacteria 5074
300 Ga0466959_0002275 3300045049 Bacteria 12245
301 Ga0466959_0018078 3300045049 Bacteria 5173
302 Ga0466959_0089478 3300045049 Bacteria 2212
303 Ga0466959_0134267 3300045049 Bacteria 1752
304 Ga0466958_0003950 3300045836 Bacteria 7777
305 Ga0466958_0007169 3300045836 Bacteria 6112
306 Ga0466958_0009829 3300045836 Bacteria 5338
307 Ga0466958_0016375 3300045836 Bacteria 4268
308 Ga0495627_002649 3300046453 Bacteria 8415
309 Ga0495592_0017597 3300046454 Bacteria 5433
310 Ga0495592_0222599 3300046454 Bacteria 1261
311 Ga0495629_0036316 3300046459 Bacteria 3479
312 Ga0495638_0024113 3300046460 Bacteria 3971
313 Ga0495651_0004685 3300046462 Bacteria 10466
314 Ga0495651_0120242 3300046462 Bacteria 1930
315 Ga0495653_0015984 3300046463 Bacteria 6116
316 Ga0495653_0081072 3300046463 Bacteria 2398
317 Ga0495650_0002137 3300046471 Bacteria 16818
318 Ga0495650_0023101 3300046471 Bacteria 2967
319 Ga0495605_0007314 3300046474 Bacteria 6272
320 Ga0495664_0014022 3300046477 Bacteria 4540
321 Ga0495596_0000331 3300046500 Bacteria 30844
322 Ga0495607_0051518 3300046501 Bacteria 2390
323 Ga0495606_0029896 3300046507 Bacteria 3817
324 Ga0495608_0008736 3300046511 Bacteria 7086
325 Ga0495610_0000728 3300046512 Bacteria 31222
326 Ga0495616_0000650 3300046513 Bacteria 25854
327 Ga0495616_0007076 3300046513 Bacteria 6739
328 Ga0495618_0005814 3300046514 Bacteria 7501
329 Ga0495620_0004324 3300046515 Bacteria 8029
330 Ga0495628_0002031 3300046516 Bacteria 18340
331 Ga0495628_0007114 3300046516 Bacteria 9692
332 Ga0495631_0000264 3300046518 Bacteria 36684
333 Ga0495637_0020550 3300046520 Bacteria 3038
334 Ga0495637_0025109 3300046520 Bacteria 2689
335 Ga0495652_0004043 3300046529 Bacteria 14180
336 Ga0495652_0010845 3300046529 Bacteria 8256
337 Ga0495652_0013397 3300046529 Bacteria 7379
338 Ga0495654_0008138 3300046530 Bacteria 5808
339 Ga0495665_0009285 3300046531 Bacteria 5327
340 Ga0495609_0027795 3300046538 Bacteria 2583
341 Ga0495597_0019622 3300046542 Bacteria 3160
342 Ga0495645_0017013 3300046543 Bacteria 5205
343 Ga0495645_0042019 3300046543 Bacteria 3333
344 Ga0495656_0000809 3300046615 Bacteria 10113
345 Ga0495625_0000045 3300046660 Bacteria 202475
346 Ga0495625_0004071 3300046660 Bacteria 13965
347 Ga0495625_0208498 3300046660 Bacteria 1285
348 Ga0495635_0061198 3300046663 Bacteria 2586
349 Ga0495635_0072896 3300046663 Bacteria 2352
350 Ga0495661_0057517 3300046665 Bacteria 2321
351 Ga0495588_0018593 3300046674 Bacteria 3391
352 Ga0495588_0192739 3300046674 Bacteria 1076
353 Ga0495657_0011596 3300046675 Bacteria 6586
354 Ga0495599_0017939 3300046678 Bacteria 4408
355 Ga0495623_0002736 3300046679 Bacteria 11644
356 Ga0495623_0029166 3300046679 Bacteria 3551
357 Ga0495646_0000603 3300046680 Bacteria 19560
358 Ga0495646_0003142 3300046680 Bacteria 10251
359 Ga0495646_0242325 3300046680 Bacteria 968
360 Ga0495658_0167705 3300046683 Bacteria 1357
361 Ga0495669_0078118 3300046684 Bacteria 1516
362 Ga0495624_0008091 3300046690 Bacteria 7360
363 Ga0495624_0016909 3300046690 Bacteria 4906
364 Ga0495670_0105522 3300046691 Bacteria 1455
365 Ga0495671_0001551 3300046692 Bacteria 15270
366 Ga0495671_0001739 3300046692 Bacteria 14116
367 Ga0495649_0023951 3300046694 Bacteria 3408
368 Ga0495600_0038852 3300046809 Bacteria 3098
369 Ga0495660_0057537 3300046810 Bacteria 2097
370 Ga0495604_0008587 3300047317 Bacteria 8071
371 Ga0495680_0018092 3300047322 Bacteria 5996
372 Ga0495680_0076624 3300047322 Bacteria 2535
373 Ga0495673_0031911 3300047469 Bacteria 2463
374 Ga0495686_0000067 3300047472 Bacteria 218601
375 Ga0495593_0016011 3300047673 Bacteria 4233
376 Ga0495593_0020913 3300047673 Bacteria 3658
377 Ga0495602_0044487 3300048088 Bacteria 4026
378 Ga0495602_0070715 3300048088 Bacteria 2984
379 Ga0495602_0194292 3300048088 Bacteria 1553
380 Ga0495614_0027682 3300048089 Bacteria 2443
381 Ga0496101_0003950 3300048904 Bacteria 9271
382 Ga0496103_0394964 3300048906 Bacteria 888
383 Ga0496104_0103221 3300048907 Bacteria 2731
384 Ga0496105_0016499 3300048908 Bacteria 5897
385 Ga0496111_0220179 3300048914 Bacteria 1410
386 Ga0496114_0164150 3300048917 Bacteria 1933
387 Ga0496116_0014689 3300048919 Bacteria 6238
388 Ga0496116_0060971 3300048919 Bacteria 2444
389 Ga0496117_0014867 3300048920 Bacteria 6678
390 Ga0496118_0010807 3300048921 Bacteria 8993
391 Ga0496118_0077489 3300048921 Bacteria 2357
392 Ga0496121_0036415 3300048924 Bacteria 4385
393 Ga0496122_0003887 3300048925 Bacteria 19143
394 Ga0496122_0006857 3300048925 Bacteria 12901
395 Ga0496122_0026487 3300048925 Bacteria 4996
396 Ga0496123_0002370 3300048926 Bacteria 23635
397 Ga0496123_0004365 3300048926 Bacteria 14939
398 Ga0496123_0024866 3300048926 Bacteria 4534
399 Ga0496123_0056230 3300048926 Bacteria 2574
400 Ga0496125_0007438 3300048928 Bacteria 11649
401 Ga0496125_0025066 3300048928 Bacteria 5472
402 Ga0496125_0069303 3300048928 Bacteria 2769
403 Ga0496125_0157444 3300048928 Bacteria 1549
404 Ga0496126_0097268 3300048929 Bacteria 2580
405 Ga0501043_0024311 3300049579 Bacteria 4755
406 Ga0501225_0031288 3300049705 Bacteria 1464
407 nmdc:mga03683_14529_c1 3300050489 Bacteria 2915
408 nmdc:mga0k408_22596_c1 3300050493 Bacteria 3542
409 nmdc:mga07m45_139405_c1 3300050496 Bacteria 1404
410 nmdc:mga07m45_636_c1 3300050496 Bacteria 14923
411 nmdc:mga07m45_927_c1 3300050496 Bacteria 12821
412 Ga0495601_0109801 3300053077 Bacteria 1786
413 Ga0500610_0002074 3300053079 Bacteria 7211
414 Ga0500610_0063098 3300053079 Bacteria 1932
415 Ga0500651_0001130 3300053093 Bacteria 13214
416 Ga0500571_000655 3300053110 Bacteria 14384
417 Ga0500593_000088 3300053117 Bacteria 33611
418 Ga0500594_0014651 3300053118 Bacteria 1880
419 Ga0500595_000834 3300053119 Bacteria 17625
420 Ga0500607_001303 3300053121 Bacteria 22821
421 Ga0500607_016032 3300053121 Bacteria 4308
422 Ga0500608_028154 3300053122 Bacteria 2651
423 Ga0500618_002131 3300053125 Bacteria 7808
424 Ga0500618_016150 3300053125 Bacteria 1873
425 Ga0500626_002948 3300053128 Bacteria 6062
426 Ga0500655_002542 3300053133 Bacteria 3312
427 Ga0500658_0004135 3300053134 Bacteria 5451
428 Ga0500658_0004150 3300053134 Bacteria 5443
429 Ga0500559_0017055 3300053136 Bacteria 3067
430 Ga0500564_008194 3300053138 Bacteria 4480
431 Ga0500568_0001273 3300053139 Bacteria 16617
432 Ga0500574_000508 3300053141 Bacteria 4971
433 Ga0500616_0013890 3300053153 Bacteria 4649
434 Ga0500619_000259 3300053154 Bacteria 11195
435 Ga0500627_0000349 3300053158 Bacteria 12529
436 Ga0500638_000681 3300053162 Bacteria 8980
437 Ga0500636_0013371 3300053177 Bacteria 4819
438 Ga0466962_0001598 3300061719 Bacteria 10607
439 Ga0466962_0002324 3300061719 Bacteria 9008
440 Ga0466962_0003387 3300061719 Bacteria 7590
441 Ga0466962_0070401 3300061719 Bacteria 1671
442 2511102186 2510917015 Bacteria 7950052
443 2501410251 2501025504 Bacteria 8008976
444 2511090189 2510917013 Bacteria 9951648
445 2511095569 2510917014 Bacteria 8296963
446 2511250870 2511231003 Bacteria 5606035
447 2511387523 2511231026 Bacteria 5225445
448 2513230621 2513020051 Bacteria 6053213
449 2513554626 2513237082 Bacteria 8640282
450 2513563577 2513237083 Bacteria 8410967
451 2515688171 2515154123 Bacteria 6387382
452 2516018605 2515154189 Bacteria 9629850
453 2521557714 2521172590 Bacteria 5047645
454 2550692636 2548876994 Bacteria 4904866
455 2553002830 2551306416 Bacteria 6152985
456 2599626305 2599185214 Bacteria 8209958
457 2599676371 2599185226 Bacteria 8233575
458 2599682007 2599185227 Bacteria 8246414
459 2599695657 2599185229 Bacteria 8216126
460 2644161745 2643221628 Bacteria 5745828
461 2644328478 2643221658 Bacteria 6064537
462 2644399711 2643221672 Bacteria 6322190
463 2723875909 2721755763 Bacteria 4464185
464 2738721275 2738541277 Bacteria 7458140
465 2738880619 2738541307 Bacteria 8606193
466 2739251965 2738543013 Bacteria 5618633
467 2739280944 2738543019 Bacteria 7459457
468 2765570113 2765235838 Bacteria 5445269
469 2808981601 2808606386 Bacteria 4471946
470 2809129184 2808606415 Bacteria 4576710
471 2809148804 2808606419 Bacteria 4576925
472 2819542173 2818991436 Bacteria 5376622
473 2819591567 2818991445 Bacteria 4955017
474 2819601583 2818991446 Bacteria 7757362
475 2819615152 2818991449 Bacteria 5518009
476 2831269197 2831265667 Bacteria 7184833
477 2838059171 2838054893 Bacteria 7451788
478 2839096947 2839094727 Bacteria 5534556
479 2840879231 2840878972 Bacteria 5483153
480 2842679715 2842677519 Bacteria 5615038
481 2852621342 2852618963 Bacteria 4577824
482 2856292311 2856287931 Bacteria 7223934
483 2857365537 2857357740 Bacteria 9937880
484 2883096232 2883087390 Bacteria 9532701
485 2884816911 2884811622 Bacteria 5552861
486 2884837377 2884836552 Bacteria 5219991
487 2884853668 2884852848 Bacteria 5221161
488 2885203091 2885198086 Bacteria 7212419
489 2885216512 2885211737 Bacteria 7212420
490 2896155215 2896154374 Bacteria 5221518
491 2899930646 2899924645 Bacteria 7487985
492 2904441545 2904439833 Bacteria 5931679
493 2904452555 2904449895 Bacteria 6927402
494 2904460846 2904456579 Bacteria 6819253
495 2904531525 2904530477 Bacteria 5876334
496 2904586838 2904584206 Bacteria 6028872
497 2904593129 2904589729 Bacteria 6113573
498 2904603025 2904601388 Bacteria 5884906
499 2919050850 2919046199 Bacteria 5567169
500 2919083954 2919079590 Bacteria 5946433
501 2919463815 2919462493 Bacteria 5817112
502 2923510920 2923510766 Bacteria 5926163
503 2928041032 2928037797 Bacteria 7273642
504 2928047874 2928044640 Bacteria 7271509
505 2928055766 2928051484 Bacteria 7773759
506 2928069865 2928064002 Bacteria 7419480
507 2928075274 2928070936 Bacteria 8062541
508 2928088566 2928084124 Bacteria 7159212
509 2928119311 2928115317 Bacteria 6477646
510 2928130892 2928130867 Bacteria 5467269
511 2929522812 2929520902 Bacteria 6765052
512 2945909896 2945909444 Bacteria 7065066
513 2945945940 2945945610 Bacteria 5951079
514 2945975558 2945972063 Bacteria 6086495
515 2945988143 2945984333 Bacteria 7358892
516 8003960324 8003955200 Bacteria 8601927
517 JGI25155J39150_1000459
518 JGI25155J39150_1000754
519 JGI25156J39149_1001386
520 JGI25156J39149_1011060
521 JGI25162J39368_1000023
522 JGI25154J39366_1000706
523 JGI25154J39366_1000836
524 JGI25157J39369_1000359
525 JGI25163J39215_1003613
526 JGI25152J39213_1006922
527 JGI25151J46595_10000872
528 JGI25151J46595_10001057
529 JGI25151J46595_10001511
530 JGI25151J46595_10055216
531 JGI25165J46597_1000030
532 rootL2_10111768
533 rootL2_10172394
534 rootH1_10008652
535 Ga0006562J51391_1077671
536 Ga0006562J51391_1077673
537 Ga0006562J51391_1081221
538 Ga0055538_1000017
539 Ga0055538_1000155
540 Ga0055539_1000022
541 Ga0055539_1000205
542 Ga0055533_1000030
543 Ga0055533_1000207
544 Ga0055532_1000023
545 Ga0055525_1000034
546 Ga0055525_1000284
547 Ga0055535_1000894
548 Ga0055542_1000074
549 Ga0055526_1008124
550 Ga0055526_1012806
551 Ga0055537_1000049
552 Ga0055537_1001494
553 Ga0055537_1001937
554 Ga0055524_1000491
555 Ga0055536_1008597
556 Ga0055534_1000049
557 Ga0055534_1000456
558 Ga0055534_1003358
559 Ga0055534_1004235
560 Ga0055534_1009666
561 Ga0055528_1001619
562 Ga0055528_1003830
563 Ga0055530_10001472
564 Ga0055530_10015884
565 Ga0055540_1000879
566 Ga0055540_1001733
567 Ga0055540_1012035
568 Ga0055531_10001127
569 Ga0055531_10006654
570 Ga0055541_1000015
571 Ga0055541_1000133
572 Ga0065714_10068536
573 Ga0070658_10216367
574 Ga0070660_100019826
575 Ga0070661_100042701
576 Ga0070674_100012504
577 Ga0068853_100006764
578 Ga0068855_100007926
579 Ga0068855_100016180
580 Ga0068855_100102792
581 Ga0068855_100290779
582 Ga0068857_100039265
583 Ga0068856_100055082
584 Ga0068852_100079388
585 Ga0068851_10008702
586 Ga0068862_100011851
587 Ga0075363_100033138
588 Ga0075363_100099578
589 Ga0075364_10007995
590 Ga0075364_10086761
591 Ga0075432_10006234
592 Ga0075362_10005019
593 Ga0075367_10171997
594 Ga0075366_10011218
595 Ga0075366_10082699
596 Ga0075370_10001114
597 Ga0075370_10003360
598 Ga0075370_10013768
599 Ga0075370_10122309
600 Ga0079104_1002433
601 Ga0079104_1033342
602 Ga0099826_10000007
603 Ga0099826_10007798
604 Ga0105251_10070916
605 Ga0105240_10006080
606 Ga0105240_10010984
607 Ga0105240_10045071
608 Ga0105240_10112118
609 Ga0105240_10187984
610 Ga0105237_10164482
611 Ga0105237_10304432
612 Ga0105237_10305507
613 Ga0105238_10002922
614 Ga0105246_10047951
615 Ga0157347_1000188
616 Ga0157373_10017716
617 Ga0157373_10197744
618 Ga0157371_10154689
619 Ga0157370_10015763
620 Ga0157369_10351559
621 Ga0182008_10005473
622 Ga0182008_10066865
623 Ga0182006_1001767
624 Ga0182006_1023681
625 Ga0182007_10000319
626 Ga0182007_10001545
627 Ga0182007_10007307
628 Ga0182007_10030712
629 Ga0182005_1000360
630 Ga0183362_10005
631 Ga0163161_10000320
632 Ga0163161_10004197
633 Ga0209435_100013
634 Ga0209435_100145
635 Ga0209436_105910
636 Ga0209784_100002
637 Ga0209784_100034
638 Ga0209566_100003
639 Ga0209566_100038
640 Ga0209674_100004
641 Ga0209674_100056
642 Ga0209672_100480
643 Ga0209672_100925
644 Ga0209147_100030
645 Ga0209147_101353
646 Ga0209563_100006
647 Ga0209563_100057
648 Ga0207427_100245
649 Ga0209437_100071
650 Ga0209437_100265
651 Ga0209258_100176
652 Ga0209258_100205
653 Ga0207425_1000274
654 Ga0209646_1000034
655 Ga0209646_1000321
656 Ga0209026_1000022
657 Ga0209026_1001923
658 Ga0209677_100003
659 Ga0209677_100035
660 Ga0209148_1000033
661 Ga0209759_1000018
662 Ga0209759_1000599
663 Ga0209129_1000270
664 Ga0209129_1006434
665 Ga0209233_1000094
666 Ga0209565_1000020
667 Ga0209565_1000106
668 Ga0209565_1000484
669 Ga0209565_1001828
670 Ga0209455_1010908
671 Ga0209673_1000295
672 Ga0209673_1001140
673 Ga0209673_1002762
674 Ga0209130_1000558
675 Ga0209130_1000560
676 Ga0209130_1004616
677 Ga0209675_1000014
678 Ga0209675_1000168
679 Ga0209675_1000363
680 Ga0209675_1000506
681 Ga0209675_1004572
682 Ga0209675_1011140
683 Ga0209676_1000036
684 Ga0209676_1000048
685 Ga0209676_1000124
686 Ga0209676_1003151
687 Ga0209676_1029132
688 Ga0209676_1035313
689 Ga0209676_1047892
690 Ga0209025_1000204
691 Ga0209025_1000462
692 Ga0209025_1000733
693 Ga0209025_1001247
694 Ga0209025_1003410
695 Ga0209025_1007631
696 Ga0209025_1008440
697 Ga0209025_1032464
698 Ga0209564_1000753
699 Ga0209564_1000760
700 Ga0209564_1001348
701 Ga0209564_1003006
702 Ga0209564_1003952
703 Ga0209758_1000833
704 Ga0209758_1016188
705 Ga0209758_1021733
706 Ga0209050_1000012
707 Ga0209050_1001006
708 Ga0209050_1003791
709 Ga0209256_1000095
710 Ga0209256_1000220
711 Ga0209256_1000527
712 Ga0207426_1001012
713 Ga0207426_1001262
714 Ga0209051_1000019
715 Ga0209051_1000099
716 Ga0209051_1000579
717 Ga0209051_1019700
718 Ga0209257_1000024
719 Ga0209257_1000258
720 Ga0209257_1012279
721 Ga0207656_10016242
722 Ga0207656_10104418
723 Ga0207655_1012656
724 Ga0207705_10000761
725 Ga0207695_10006378
726 Ga0207695_10009955
727 Ga0207695_10111530
728 Ga0207671_10215873
729 Ga0207671_10280682
730 Ga0207681_10126460
731 Ga0207694_10002354
732 Ga0207706_10010483
733 Ga0207706_10108566
734 Ga0207709_10063408
735 Ga0207669_10101618
736 Ga0207667_10000276
737 Ga0207667_10000438
738 Ga0207667_10032940
739 Ga0207667_10181532
740 Ga0207668_10093851
741 Ga0207639_10156733
742 Ga0207702_10020507
743 Ga0207674_10030972
744 Ga0207698_10298690
745 Ga0209281_1016793
746 Ga0209282_1000061
747 Ga0209282_1000501
748 Ga0207428_10143218
749 Ga0268266_10064452
750 Ga0268265_10017960
751 Ga0265338_10001135
752 Ga0314311_1043350
753 Ga0316178_1108165
754 Ga0316183_1097411
755 Ga0316181_1138108
756 Ga0265340_10069869
757 Ga0265331_10022699
758 Ga0265327_10000698
759 Ga0265327_10001208
760 Ga0307513_10113721
761 Ga0307514_10015883
762 Ga0307405_10018086
763 Ga0307405_10064576
764 Ga0307413_10022834
765 Ga0307406_10011586
766 Ga0307406_10215711
767 Ga0307412_10065481
768 Ga0307412_10120698
769 Ga0307414_10128368
770 Ga0307411_10000669
771 Ga0307411_10201294
772 Ga0395899_0000308
773 Ga0395900_0000159
774 Ga0395900_0005041
775 Ga0395898_0000425
776 Ga0395898_0002495
777 Ga0395898_0020013
778 Ga0395905_0024463
779 Ga0395901_0000017
780 Ga0395901_0000109
781 Ga0395901_0296773
782 Ga0436361_0159409
783 Ga0436361_0339053
784 Ga0436361_0371158
785 Ga0439436_0008551
786 Ga0439466_0003682
787 Ga0439442_000830
788 Ga0450898_002806
789 Ga0450906_000601
790 Ga0450908_001510
791 Ga0439434_0000518
792 Ga0466969_0019995
793 Ga0466969_0041349
794 Ga0466969_0070707
795 Ga0466972_0099177
796 Ga0466973_0080925
797 Ga0466977_0000036
798 Ga0466965_0030449
799 Ga0466966_0000024
800 Ga0466966_0000134
801 Ga0466966_0007082
802 Ga0466961_0006172
803 Ga0466961_0023570
804 Ga0466961_0115861
805 Ga0466963_0004731
806 Ga0466963_0057530
807 Ga0466964_0020470
808 Ga0453684_0034048
809 Ga0466971_0001591
810 Ga0466971_0002073
811 Ga0466970_0009385
812 Ga0466970_0016868
813 Ga0466970_0019354
814 Ga0466957_0003563
815 Ga0466957_0011686
816 Ga0466959_0002275
817 Ga0466959_0018078
818 Ga0466959_0089478
819 Ga0466959_0134267
820 Ga0466958_0003950
821 Ga0466958_0007169
822 Ga0466958_0009829
823 Ga0466958_0016375
824 Ga0495627_002649
825 Ga0495592_0017597
826 Ga0495592_0222599
827 Ga0495629_0036316
828 Ga0495638_0024113
829 Ga0495651_0004685
830 Ga0495651_0120242
831 Ga0495653_0015984
832 Ga0495653_0081072
833 Ga0495650_0002137
834 Ga0495650_0023101
835 Ga0495605_0007314
836 Ga0495664_0014022
837 Ga0495596_0000331
838 Ga0495607_0051518
839 Ga0495606_0029896
840 Ga0495608_0008736
841 Ga0495610_0000728
842 Ga0495616_0000650
843 Ga0495616_0007076
844 Ga0495618_0005814
845 Ga0495620_0004324
846 Ga0495628_0002031
847 Ga0495628_0007114
848 Ga0495631_0000264
849 Ga0495637_0020550
850 Ga0495637_0025109
851 Ga0495652_0004043
852 Ga0495652_0010845
853 Ga0495652_0013397
854 Ga0495654_0008138
855 Ga0495665_0009285
856 Ga0495609_0027795
857 Ga0495597_0019622
858 Ga0495645_0017013
859 Ga0495645_0042019
860 Ga0495656_0000809
861 Ga0495625_0000045
862 Ga0495625_0004071
863 Ga0495625_0208498
864 Ga0495635_0061198
865 Ga0495635_0072896
866 Ga0495661_0057517
867 Ga0495588_0018593
868 Ga0495588_0192739
869 Ga0495657_0011596
870 Ga0495599_0017939
871 Ga0495623_0002736
872 Ga0495623_0029166
873 Ga0495646_0000603
874 Ga0495646_0003142
875 Ga0495646_0242325
876 Ga0495658_0167705
877 Ga0495669_0078118
878 Ga0495624_0008091
879 Ga0495624_0016909
880 Ga0495670_0105522
881 Ga0495671_0001551
882 Ga0495671_0001739
883 Ga0495649_0023951
884 Ga0495600_0038852
885 Ga0495660_0057537
886 Ga0495604_0008587
887 Ga0495680_0018092
888 Ga0495680_0076624
889 Ga0495673_0031911
890 Ga0495686_0000067
891 Ga0495593_0016011
892 Ga0495593_0020913
893 Ga0495602_0044487
894 Ga0495602_0070715
895 Ga0495602_0194292
896 Ga0495614_0027682
897 Ga0496101_0003950
898 Ga0496103_0394964
899 Ga0496104_0103221
900 Ga0496105_0016499
901 Ga0496111_0220179
902 Ga0496114_0164150
903 Ga0496116_0014689
904 Ga0496116_0060971
905 Ga0496117_0014867
906 Ga0496118_0010807
907 Ga0496118_0077489
908 Ga0496121_0036415
909 Ga0496122_0003887
910 Ga0496122_0006857
911 Ga0496122_0026487
912 Ga0496123_0002370
913 Ga0496123_0004365
914 Ga0496123_0024866
915 Ga0496123_0056230
916 Ga0496125_0007438
917 Ga0496125_0025066
918 Ga0496125_0069303
919 Ga0496125_0157444
920 Ga0496126_0097268
921 Ga0501043_0024311
922 Ga0501225_0031288
923 nmdc:mga03683_14529_c1
924 nmdc:mga0k408_22596_c1
925 nmdc:mga07m45_139405_c1
926 nmdc:mga07m45_636_c1
927 nmdc:mga07m45_927_c1
928 Ga0495601_0109801
929 Ga0500610_0002074
930 Ga0500610_0063098
931 Ga0500651_0001130
932 Ga0500571_000655
933 Ga0500593_000088
934 Ga0500594_0014651
935 Ga0500595_000834
936 Ga0500607_001303
937 Ga0500607_016032
938 Ga0500608_028154
939 Ga0500618_002131
940 Ga0500618_016150
941 Ga0500626_002948
942 Ga0500655_002542
943 Ga0500658_0004135
944 Ga0500658_0004150
945 Ga0500559_0017055
946 Ga0500564_008194
947 Ga0500568_0001273
948 Ga0500574_000508
949 Ga0500616_0013890
950 Ga0500619_000259
951 Ga0500627_0000349
952 Ga0500638_000681
953 Ga0500636_0013371
954 Ga0466962_0001598
955 Ga0466962_0002324
956 Ga0466962_0003387
957 Ga0466962_0070401
958 2511102186
959 2501410251
960 2511090189
961 2511095569
962 2511250870
963 2511387523
964 2513230621
965 2513554626
966 2513563577
967 2515688171
968 2516018605
969 2521557714
970 2550692636
971 2553002830
972 2599626305
973 2599676371
974 2599682007
975 2599695657
976 2644161745
977 2644328478
978 2644399711
979 2723875909
980 2738721275
981 2738880619
982 2739251965
983 2739280944
984 2765570113
985 2808981601
986 2809129184
987 2809148804
988 2819542173
989 2819591567
990 2819601583
991 2819615152
992 2831269197
993 2838059171
994 2839096947
995 2840879231
996 2842679715
997 2852621342
998 2856292311
999 2857365537
1000 2883096232
1001 2884816911
1002 2884837377
1003 2884853668
1004 2885203091
1005 2885216512
1006 2896155215
1007 2899930646
1008 2904441545
1009 2904452555
1010 2904460846
1011 2904531525
1012 2904586838
1013 2904593129
1014 2904603025
1015 2919050850
1016 2919083954
1017 2919463815
1018 2923510920
1019 2928041032
1020 2928047874
1021 2928055766
1022 2928069865
1023 2928075274
1024 2928088566
1025 2928119311
1026 2928130892
1027 2929522812
1028 2945909896
1029 2945945940
1030 2945975558
1031 2945988143
1032 8003960324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

20

309

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9656 1 321
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9593 1 321
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9506 1 327
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9475 1 327
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.9214 2 301
ID Description Score Start End Superfamily
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9773 189 319 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9486 188 299 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9485 189 326 2.40.100.10
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9379 190 324 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9354 189 326 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A0P9U5F5-F1-model_v4 Allophanate hydrolase 2 subunit 2 0.9873 194 324 GO:0005524
GO:0016787
AF-W1Y8Y5-F1-model_v4 Carboxyltransferase domain-containing protein 0.9822 199 307 GO:0005524
GO:0016787
AF-I6DQQ4-F1-model_v4 deleted 0.9812 195 324
AF-A0A6C9QK81-F1-model_v4 5-oxoprolinase subunit PxpC (EC 3.5.2.9) 0.9812 209 325 GO:0005524
GO:0017168
AF-W4QA83-F1-model_v4 Allophanate hydrolase 2 subunit 2 0.9772 202 325 GO:0005524
GO:0016787

Map