F458078

General Info

Members Datasets Scaffolds Average Seq Length
516 411 1032 321

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2958115193|2958115822
Length 396
Sequence GWRRRSERMPSFSPEGEKREKKAANFAGPFYCALHKNLQWISICLKRDNRNWVTMKRQTAGASSDAVHTRNPMNLGTPDNSGAASLEAIARNGSLFRRIAVRIPTYLKDLRENPAWLPMFVLARTMPGRRMHWLGARRVRPLDNAGETMFAGVDREAVVAALRSDGLFSGFTLPSAIHEEIAVFAQRTPCFGNFDRRLEFIPGDHAEAEKRFGRSLLSGHYFERILDCPAALAIQRDPLLLEVAQHYLGGQAKLITTRVWWSFPTGKASDADKNLASLGKYHFDLDDWRMLKFFFYLVPVDAGTGPHVYVRGSHRRRALKHQLTLLVGHPAEDVLDVYGPESAATLTGEAGLGFVEDPFGFHMGTVPTHTPRLMMEIGFGVSRPSRRRFHGEPVIR

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
83 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
138 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
139 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
147 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
151 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
152 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
153 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
154 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
155 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
156 2512875024
157 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
158 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
159 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
160 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
161 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
162 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
163 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
164 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
165 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
166 2516143018 Ensifer sp. BR816 Isolate Nodule
167 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
168 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
169 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
170 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
171 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
172 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
173 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
174 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
175 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
176 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
177 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
178 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
179 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
180 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
181 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
182 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
183 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
184 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
185 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
186 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
187 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
188 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
189 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
190 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
191 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
192 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
193 2643221618 Ensifer sp. Root231 Isolate Unclassified
194 2643221626 Ensifer sp. Root31 Isolate Unclassified
195 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
196 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
197 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
198 2643221655 Ensifer sp. Root1252 Isolate Unclassified
199 2643221659 Ensifer sp. Root127 Isolate Unclassified
200 2643221698 Ensifer sp. Root142 Isolate Unclassified
201 2643221712 Ensifer sp. Root258 Isolate Unclassified
202 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
203 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
204 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
205 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
206 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
207 2738541293 Rhizobium sp. GV031 Isolate Unclassified
208 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
209 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
210 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
211 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
212 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
213 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
214 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
215 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
216 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
217 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
218 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
219 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
220 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
221 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
222 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
223 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
224 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
225 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
226 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
227 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
228 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
229 2844163670 Ensifer sp. 1H6 Isolate Unclassified
230 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
231 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
232 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
233 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
234 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
235 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
236 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
237 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
238 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
239 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
240 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
241 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
242 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
243 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
244 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
245 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
246 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
247 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
248 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
249 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
250 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
251 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
252 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
253 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
254 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
255 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
256 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
257 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
258 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
259 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
260 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
261 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
262 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
263 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
264 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
265 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
266 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
267 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
268 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
269 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
270 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
271 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
272 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
273 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
274 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
275 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
276 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
277 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
278 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
279 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
280 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
281 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
282 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
283 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
284 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
285 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
286 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
287 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
288 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
289 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
290 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
291 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
292 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
293 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
294 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
295 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
296 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
297 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
298 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
299 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
300 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
301 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
302 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
303 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
304 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
305 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
306 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
307 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
308 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
309 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
310 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
311 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
312 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
313 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
314 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
315 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
316 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
317 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
318 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
319 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
320 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
321 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
322 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
323 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
324 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
325 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
326 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
327 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
328 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
329 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
330 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
331 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
332 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
333 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
334 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
335 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
336 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
337 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
338 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
339 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
340 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
341 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
342 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
343 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
344 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
345 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
346 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
347 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
348 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
349 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
350 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
351 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
352 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
353 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
354 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
355 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
356 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
357 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
358 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
359 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
360 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
361 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
362 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
363 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
364 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
365 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
366 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
367 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
368 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
369 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
370 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
371 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
372 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
373 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
374 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
375 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
376 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
377 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
378 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
379 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
380 2996887358 Rhizobium sp. R711 Isolate Nodule
381 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
382 3004167301 Mesorhizobium loti 582 Isolate Unclassified
383 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
384 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
385 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
386 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
387 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
388 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
389 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
390 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
391 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
392 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
393 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
394 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
395 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
396 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
397 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
398 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
399 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
400 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
401 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
402 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
403 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
404 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
405 8005321885 Rhizobium sp. R72 Isolate Nodule
406 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
407 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
408 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
409 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
410 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
411 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.41
Metatranscriptomes 0
Isolates 56.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.95
Nodule 41.47
Rhizoplane 1.94
Rhizosphere 22.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10055153 3300002067 Bacteria 1145
2 JGI25155J39150_1000199 3300002704 Bacteria 25175
3 JGI25156J39149_1000449 3300002705 Bacteria 25175
4 JGI25162J39368_1000201 3300002737 Bacteria 62939
5 JGI25162J39368_1001229 3300002737 Bacteria 14810
6 JGI25154J39366_1000369 3300002738 Bacteria 25163
7 JGI25157J39369_1000477 3300002741 Bacteria 25175
8 JGI25157J39369_1001050 3300002741 Bacteria 12594
9 JGI25152J39213_1001832 3300002773 Bacteria 8575
10 JGI25152J39213_1004525 3300002773 Bacteria 4349
11 JGI25150J39212_1000259 3300002774 Bacteria 28079
12 JGI25151J46595_10000574 3300003187 Bacteria 32717
13 JGI25165J46597_1000016 3300003214 Bacteria 377866
14 JGI25165J46597_1000274 3300003214 Bacteria 66514
15 JGI25165J46597_1001039 3300003214 Bacteria 18112
16 JGI25153J46596_10004695 3300003215 Bacteria 7296
17 Ga0055542_1000694 3300003762 Bacteria 26573
18 Ga0055526_1008674 3300003771 Bacteria 5020
19 Ga0055528_1006093 3300003790 Bacteria 5510
20 Ga0055531_10039503 3300003794 Bacteria 1400
21 Ga0058692_1000083 3300003856 Bacteria 66222
22 Ga0068853_100006235 3300005539 Bacteria 9448
23 Ga0070665_100048954 3300005548 Bacteria 4242
24 Ga0068855_100239372 3300005563 Bacteria 2029
25 Ga0068855_100569051 3300005563 Bacteria 1225
26 Ga0068854_100082855 3300005578 Bacteria 2371
27 Ga0068856_100021771 3300005614 Bacteria 6231
28 Ga0068852_100157607 3300005616 Bacteria 2116
29 Ga0068852_100320756 3300005616 Bacteria 1504
30 Ga0068851_10027494 3300005834 Bacteria 2804
31 Ga0075365_10030526 3300006038 Bacteria 3453
32 Ga0075365_10075216 3300006038 Bacteria 2279
33 Ga0075364_10164706 3300006051 Bacteria 1497
34 Ga0075367_10000071 3300006178 Bacteria 25828
35 Ga0075369_10003834 3300006186 Bacteria 5514
36 Ga0075369_10046950 3300006186 Bacteria 1861
37 Ga0075370_10038677 3300006353 Bacteria 2685
38 Ga0079104_1000010 3300006946 Bacteria 366021
39 Ga0105251_10039163 3300009011 Bacteria 2317
40 Ga0105240_10000142 3300009093 Bacteria 146932
41 Ga0105240_10099721 3300009093 Bacteria 3534
42 Ga0105243_10164904 3300009148 Bacteria 1914
43 Ga0105241_10053088 3300009174 Bacteria 3098
44 Ga0105237_10003634 3300009545 Bacteria 18200
45 Ga0105237_10073946 3300009545 Bacteria 3399
46 Ga0105238_10009417 3300009551 Bacteria 9780
47 Ga0105238_10875707 3300009551 Bacteria 916
48 Ga0123342_1007959 3300009766 Bacteria 13673
49 Ga0105239_10028919 3300010375 Bacteria 6091
50 Ga0105239_10067431 3300010375 Bacteria 3931
51 Ga0105239_10187927 3300010375 Bacteria 2312
52 Ga0105239_10194940 3300010375 Bacteria 2268
53 Ga0157371_10320018 3300013102 Bacteria 1126
54 Ga0157370_10004401 3300013104 Bacteria 16161
55 Ga0157370_10272846 3300013104 Bacteria 1563
56 Ga0157369_10068638 3300013105 Bacteria 3809
57 Ga0182008_10048255 3300014497 Bacteria 2115
58 Ga0182007_10007138 3300015262 Bacteria 4718
59 Ga0182007_10040263 3300015262 Bacteria 1561
60 Ga0182005_1003386 3300015265 Bacteria 5427
61 Ga0163161_10216979 3300017792 Bacteria 1480
62 Ga0209435_100133 3300025206 Bacteria 25498
63 Ga0209437_100203 3300025233 Bacteria 117490
64 Ga0209437_100204 3300025233 Bacteria 115781
65 Ga0209437_102716 3300025233 Bacteria 3350
66 Ga0207425_1000335 3300025245 Bacteria 32808
67 Ga0209646_1000404 3300025246 Bacteria 25498
68 Ga0209646_1005230 3300025246 Bacteria 2284
69 Ga0209026_1000005 3300025250 Bacteria 731387
70 Ga0209026_1000558 3300025250 Bacteria 25498
71 Ga0209677_100553 3300025253 Bacteria 20782
72 Ga0209148_1000057 3300025254 Bacteria 360463
73 Ga0209148_1006485 3300025254 Bacteria 2532
74 Ga0209759_1000292 3300025256 Bacteria 69246
75 Ga0209759_1000800 3300025256 Bacteria 25498
76 Ga0209129_1000983 3300025258 Bacteria 17090
77 Ga0209129_1002141 3300025258 Bacteria 10021
78 Ga0209233_1000068 3300025261 Bacteria 377969
79 Ga0209233_1000205 3300025261 Bacteria 118120
80 Ga0209233_1000280 3300025261 Bacteria 70793
81 Ga0209233_1000582 3300025261 Bacteria 19324
82 Ga0209233_1008107 3300025261 Bacteria 3279
83 Ga0209455_1000240 3300025272 Bacteria 68476
84 Ga0209673_1003950 3300025273 Bacteria 8285
85 Ga0209025_1001361 3300025294 Bacteria 32808
86 Ga0209025_1020597 3300025294 Bacteria 3598
87 Ga0209025_1042309 3300025294 Bacteria 1937
88 Ga0209564_1017425 3300025295 Bacteria 2799
89 Ga0209758_1001195 3300025297 Bacteria 32808
90 Ga0209758_1003476 3300025297 Bacteria 14271
91 Ga0209256_1012578 3300025299 Bacteria 3220
92 Ga0207426_1001369 3300025302 Bacteria 20642
93 Ga0209051_1002708 3300025303 Bacteria 12325
94 Ga0207713_1038439 3300025735 Bacteria 2030
95 Ga0207647_10007663 3300025904 Bacteria 7779
96 Ga0207695_10000234 3300025913 Bacteria 146987
97 Ga0207671_10000043 3300025914 Bacteria 206915
98 Ga0207671_10012327 3300025914 Bacteria 6880
99 Ga0207644_10087850 3300025931 Bacteria 2311
100 Ga0207706_10019343 3300025933 Bacteria 6125
101 Ga0207706_10425083 3300025933 Bacteria 1151
102 Ga0207704_10111019 3300025938 Bacteria 1854
103 Ga0207667_10077362 3300025949 Bacteria 3451
104 Ga0207639_10033417 3300026041 Bacteria 3795
105 Ga0207702_10039210 3300026078 Bacteria 3969
106 Ga0207702_10076251 3300026078 Bacteria 2898
107 Ga0207702_10237169 3300026078 Bacteria 1707
108 Ga0207698_10112016 3300026142 Bacteria 2289
109 Ga0209281_1000078 3300027111 Bacteria 261622
110 Ga0209371_1000251 3300027312 Bacteria 66325
111 Ga0209371_1002781 3300027312 Bacteria 9357
112 Ga0268256_1000475 3300030500 Bacteria 34521
113 Ga0268256_1002490 3300030500 Bacteria 9358
114 Ga0265330_10013038 3300031235 Bacteria 3878
115 Ga0307405_10002764 3300031731 Bacteria 7866
116 Ga0395900_0175467 3300037418 Bacteria 2180
117 Ga0439436_0004729 3300041404 Bacteria 4176
118 Ga0439447_035913 3300041407 Bacteria 1226
119 Ga0439462_0018583 3300042015 Bacteria 1806
120 Ga0450918_004841 3300042531 Bacteria 2435
121 Ga0466966_0087772 3300044684 Bacteria 1933
122 Ga0466970_0075969 3300044765 Bacteria 1809
123 Ga0466959_0093900 3300045049 Bacteria 2153
124 Ga0495638_0000281 3300046460 Bacteria 68208
125 Ga0495650_0024139 3300046471 Bacteria 2877
126 Ga0495605_0000415 3300046474 Bacteria 38918
127 Ga0495585_0002302 3300046492 Bacteria 13757
128 Ga0495607_0010747 3300046501 Bacteria 6132
129 Ga0495583_0005684 3300046506 Bacteria 8384
130 Ga0495606_0075855 3300046507 Bacteria 2103
131 Ga0495610_0001567 3300046512 Bacteria 20154
132 Ga0495610_0076559 3300046512 Bacteria 1547
133 Ga0495620_0031205 3300046515 Bacteria 2444
134 Ga0495631_0000853 3300046518 Bacteria 19290
135 Ga0495632_0003102 3300046519 Bacteria 12039
136 Ga0495632_0019189 3300046519 Bacteria 3731
137 Ga0495643_0034832 3300046522 Bacteria 2775
138 Ga0495643_0046282 3300046522 Bacteria 2359
139 Ga0495644_0104084 3300046523 Bacteria 1075
140 Ga0495654_0063383 3300046530 Bacteria 1770
141 Ga0495622_0151090 3300046557 Bacteria 1051
142 Ga0495633_0039043 3300046558 Bacteria 2266
143 Ga0495656_0010629 3300046615 Bacteria 3353
144 Ga0495668_0002430 3300046616 Bacteria 15352
145 Ga0495611_0007278 3300046648 Bacteria 4702
146 Ga0495625_0002937 3300046660 Bacteria 17782
147 Ga0495625_0016487 3300046660 Bacteria 5812
148 Ga0495670_0012771 3300046691 Bacteria 4129
149 Ga0495660_0024043 3300046810 Bacteria 3472
150 Ga0495636_0089456 3300047318 Bacteria 1335
151 Ga0495672_0010573 3300047320 Bacteria 6564
152 Ga0495686_0005577 3300047472 Bacteria 9897
153 Ga0495686_0045549 3300047472 Bacteria 2775
154 Ga0496100_0024941 3300048903 Bacteria 3652
155 Ga0496101_0123497 3300048904 Bacteria 1960
156 Ga0496102_0028693 3300048905 Bacteria 4972
157 Ga0496103_0072045 3300048906 Bacteria 2163
158 Ga0496111_0001273 3300048914 Bacteria 14124
159 Ga0496112_0016728 3300048915 Bacteria 6878
160 Ga0496116_0001086 3300048919 Bacteria 32769
161 Ga0496116_0004225 3300048919 Bacteria 13803
162 Ga0496116_0006901 3300048919 Bacteria 10190
163 Ga0496117_0005406 3300048920 Bacteria 13438
164 Ga0496117_0010623 3300048920 Bacteria 8353
165 Ga0496117_0015868 3300048920 Bacteria 6387
166 Ga0496117_0168283 3300048920 Bacteria 1275
167 Ga0496118_0006076 3300048921 Bacteria 13438
168 Ga0496118_0070890 3300048921 Bacteria 2513
169 Ga0496118_0090742 3300048921 Bacteria 2104
170 Ga0496119_0020683 3300048922 Bacteria 4787
171 Ga0496119_0237910 3300048922 Bacteria 924
172 Ga0496122_0008549 3300048925 Bacteria 11011
173 Ga0496122_0015191 3300048925 Bacteria 7376
174 Ga0496122_0022839 3300048925 Bacteria 5541
175 Ga0496122_0030368 3300048925 Bacteria 4528
176 Ga0496122_0064062 3300048925 Bacteria 2677
177 Ga0496122_0154023 3300048925 Bacteria 1413
178 Ga0496123_0005656 3300048926 Bacteria 12482
179 Ga0496123_0025344 3300048926 Bacteria 4473
180 Ga0496123_0053877 3300048926 Bacteria 2654
181 Ga0496123_0061030 3300048926 Bacteria 2426
182 Ga0496123_0089869 3300048926 Bacteria 1828
183 Ga0496124_0002303 3300048927 Bacteria 25203
184 Ga0496124_0028841 3300048927 Bacteria 4957
185 Ga0496124_0095392 3300048927 Bacteria 2418
186 Ga0496124_0157488 3300048927 Bacteria 1774
187 Ga0496125_0007469 3300048928 Bacteria 11627
188 Ga0496125_0102093 3300048928 Bacteria 2108
189 Ga0496126_0044310 3300048929 Bacteria 4098
190 Ga0496126_0066171 3300048929 Bacteria 3232
191 Ga0496126_0106001 3300048929 Bacteria 2453
192 Ga0496126_0204245 3300048929 Bacteria 1666
193 Ga0496126_0270525 3300048929 Bacteria 1410
194 Ga0495682_0049235 3300049460 Bacteria 1535
195 Ga0501073_0295380 3300049589 Bacteria 1118
196 Ga0501080_0276280 3300049742 Bacteria 1528
197 Ga0501083_0115923 3300049744 Bacteria 1759
198 Ga0501044_0274633 3300049823 Bacteria 1620
199 nmdc:mga03n38_17268_c1 3300050490 Bacteria 2490
200 nmdc:mga0yw44_24926_c1 3300050492 Bacteria 3393
201 nmdc:mga0yw44_88446_c1 3300050492 Bacteria 1953
202 nmdc:mga06z11_59683_c1 3300050494 Bacteria 1983
203 nmdc:mga06z11_76787_c1 3300050494 Bacteria 1782
204 nmdc:mga07m45_140685_c1 3300050496 Bacteria 1398
205 nmdc:mga0sz30_14426_c1 3300050516 Bacteria 3110
206 Ga0500610_0002978 3300053079 Bacteria 6383
207 Ga0500610_0018626 3300053079 Bacteria 3362
208 Ga0500578_0183849 3300053086 Bacteria 1287
209 Ga0500557_000235 3300053105 Bacteria 8197
210 Ga0500557_000320 3300053105 Bacteria 6363
211 Ga0500569_004583 3300053109 Bacteria 2914
212 Ga0500569_012857 3300053109 Bacteria 2034
213 Ga0500594_0003427 3300053118 Bacteria 3481
214 Ga0500594_0003775 3300053118 Bacteria 3333
215 Ga0500618_005245 3300053125 Bacteria 3979
216 Ga0500618_008003 3300053125 Bacteria 2978
217 Ga0500568_0001014 3300053139 Bacteria 19226
218 Ga0500577_0025247 3300053142 Bacteria 2008
219 Ga0500616_0000485 3300053153 Bacteria 51609
220 Ga0500616_0001671 3300053153 Bacteria 20448
221 Ga0500620_000159 3300053155 Bacteria 13636
222 Ga0500624_000129 3300053157 Bacteria 33362
223 Ga0500636_0068072 3300053177 Bacteria 2068
224 Ga0500645_035180 3300053730 Bacteria 1493
225 2958115822 2958115193 Bacteria 6923548
226 2510316668 2510065059 Bacteria 6847884
227 2511135912 2510917022 Bacteria 6504556
228 2511172061 2510917026 Bacteria 7046020
229 2511183263 2510917028 Bacteria 6185411
230 2512934938 2512875016 Bacteria 6529530
231 2512963300 2512875024 Bacteria 7195110
232 2512964252 2512875024 Bacteria 7195110
233 2513599486 2513237088 Bacteria 6927906
234 2513599994 2513237088 Bacteria 6927906
235 2513613057 2513237090 Bacteria 7096802
236 2513865809 2513237138 Bacteria 7368160
237 2513885701 2513237140 Bacteria 7076289
238 2513999141 2513237159 Bacteria 6810126
239 2514033998 2513237164 Bacteria 7563725
240 2514034417 2513237164 Bacteria 7563725
241 2514418872 2513237305 Bacteria 7293571
242 2514422158 2513237305 Bacteria 7293571
243 2514590654 2513237351 Bacteria 6968952
244 2515612711 2515154107 Bacteria 6795637
245 2516209973 2516143018 Bacteria 6951533
246 2524458715 2524023209 Bacteria 6679728
247 2524463129 2524023209 Bacteria 6679728
248 2535515505 2534681796 Bacteria 7146037
249 2535520868 2534681796 Bacteria 7146037
250 2585205409 2582581294 Bacteria 6626667
251 2585256817 2582581304 Bacteria 5831370
252 2585272004 2582581307 Bacteria 6597605
253 2585279691 2582581308 Bacteria 7413247
254 2585329030 2582581315 Bacteria 7318924
255 2585333932 2582581316 Bacteria 7774528
256 2585400334 2582581867 Bacteria 7184437
257 2585535771 2585427527 Bacteria 7273426
258 2585551147 2585427530 Bacteria 7383882
259 2585563450 2585427531 Bacteria 6992870
260 2585823058 2585427590 Bacteria 6824633
261 2585844256 2585427594 Bacteria 6180594
262 2585897123 2585427608 Bacteria 6544331
263 2585909047 2585427609 Bacteria 6667127
264 2585996782 2585427633 Bacteria 6413184
265 2586001367 2585427634 Bacteria 6455027
266 2587984461 2585428125 Bacteria 6662905
267 2588515036 2588253730 Bacteria 6881675
268 2599606394 2599185210 Bacteria 5624189
269 2599719207 2599185236 Bacteria 6875203
270 2600197762 2599185352 Bacteria 7228948
271 2616306480 2615840626 Bacteria 7921970
272 2616313073 2615840626 Bacteria 7921970
273 2617382260 2617270742 Bacteria 6808054
274 2643989193 2643221595 Bacteria 6565519
275 2644106258 2643221618 Bacteria 7717186
276 2644146754 2643221626 Bacteria 8069654
277 2644152390 2643221627 Bacteria 6761570
278 2644190972 2643221634 Bacteria 6705461
279 2644242683 2643221643 Bacteria 5749658
280 2644310869 2643221655 Bacteria 7722067
281 2644334328 2643221659 Bacteria 7890716
282 2644545459 2643221698 Bacteria 7756764
283 2644616703 2643221712 Bacteria 7729434
284 2671117148 2667528174 Bacteria 6435400
285 2688600491 2687453392 Bacteria 6880454
286 2694631400 2693429783 Bacteria 7019804
287 2694636621 2693429784 Bacteria 7241525
288 2723577767 2721755686 Bacteria 7343952
289 2738803533 2738541293 Bacteria 7065685
290 2738948006 2738541317 Bacteria 5340176
291 2756672950 2756170246 Bacteria 7451806
292 2756677657 2756170246 Bacteria 7451806
293 2778178768 2775507266 Bacteria 7392367
294 2792624290 2791355091 Bacteria 6135441
295 2792630430 2791355092 Bacteria 6248105
296 2792751001 2791355123 Bacteria 8049106
297 2792753064 2791355123 Bacteria 8049106
298 2819638547 2818991453 Bacteria 7181617
299 2819684320 2818991461 Bacteria 7026071
300 2838034234 2838029111 Bacteria 6603031
301 2838738983 2838736955 Bacteria 5760694
302 2839993948 2839993093 Bacteria 5512535
303 2841842881 2841840854 Bacteria 5761912
304 2842142662 2842140634 Bacteria 5759631
305 2842362887 2842357229 Bacteria 6485165
306 2842480980 2842475841 Bacteria 6603183
307 2842485213 2842482326 Bacteria 7212537
308 2842488781 2842482326 Bacteria 7212537
309 2842507591 2842502639 Bacteria 6604161
310 2842511448 2842509118 Bacteria 6850950
311 2842524885 2842521101 Bacteria 6569494
312 2844005410 2844002411 Bacteria 7168230
313 2844015817 2844009547 Bacteria 6728125
314 2844166042 2844163670 Bacteria 7266046
315 2847672150 2847670302 Bacteria 6165597
316 2847688495 2847686936 Bacteria 6278406
317 2852392015 2852387548 Bacteria 8025568
318 2852392636 2852387548 Bacteria 8025568
319 2856317067 2856314179 Bacteria 6477897
320 2856326564 2856320880 Bacteria 7263508
321 2856330384 2856328259 Bacteria 6528202
322 2856336814 2856334872 Bacteria 7037011
323 2856352632 2856349417 Bacteria 6230045
324 2857369908 2857367948 Bacteria 6965560
325 2857531549 2857531043 Bacteria 6754041
326 2869166120 2869162929 Bacteria 6399702
327 2869167087 2869162929 Bacteria 6399702
328 2869173972 2869169390 Bacteria 6659796
329 2869238192 2869234852 Bacteria 6654993
330 2869244278 2869242130 Bacteria 6609239
331 2869252164 2869249662 Bacteria 6868783
332 2869263107 2869256925 Bacteria 6981691
333 2869269793 2869264136 Bacteria 6880765
334 2869271921 2869271264 Bacteria 6908218
335 2869280322 2869278585 Bacteria 7077053
336 2871437818 2871435913 Bacteria 6880295
337 2871451825 2871444079 Bacteria 6423508
338 2871453238 2871451962 Bacteria 7336357
339 2871464233 2871459585 Bacteria 6866887
340 2871474809 2871474448 Bacteria 6806570
341 2871481908 2871481445 Bacteria 6700002
342 2871497420 2871495908 Bacteria 6935695
343 2874107474 2874102143 Bacteria 6342645
344 2874113978 2874109183 Bacteria 6517025
345 2874120343 2874116593 Bacteria 6674494
346 2874126620 2874123672 Bacteria 7238285
347 2874133237 2874131515 Bacteria 6820270
348 2874144431 2874139085 Bacteria 7021506
349 2874166998 2874162495 Bacteria 6174670
350 2876366981 2876363079 Bacteria 6544991
351 2876373772 2876369609 Bacteria 6807521
352 2876375887 2876369609 Bacteria 6807521
353 2876389047 2876386047 Bacteria 6698674
354 2876398957 2876392853 Bacteria 6660880
355 2876406818 2876399893 Bacteria 6927900
356 2876413474 2876406927 Bacteria 6191900
357 2876422363 2876420981 Bacteria 6687741
358 2878037298 2878035449 Bacteria 6555736
359 2878744194 2878738818 Bacteria 7136951
360 2878761638 2878760144 Bacteria 6823465
361 2878768605 2878767105 Bacteria 6898628
362 2878780233 2878774303 Bacteria 6108671
363 2878782659 2878781027 Bacteria 6834456
364 2881154107 2881147464 Bacteria 7779814
365 2881157842 2881155292 Bacteria 6461656
366 2881163173 2881161766 Bacteria 7127907
367 2881163903 2881161766 Bacteria 7127907
368 2881858733 2881853255 Bacteria 6698367
369 2882638022 2882632389 Bacteria 8154593
370 2882639967 2882632389 Bacteria 8154593
371 2885312136 2885305155 Bacteria 7348390
372 2885315793 2885312484 Bacteria 6415165
373 2885326787 2885326080 Bacteria 7134805
374 2885355648 2885350715 Bacteria 6787678
375 2888349152 2888343758 Bacteria 6611049
376 2888351617 2888350351 Bacteria 7372807
377 2903453551 2903448605 Bacteria 7357801
378 2903455838 2903448605 Bacteria 7357801
379 2903524848 2903521522 Bacteria 6525694
380 2903530909 2903528002 Bacteria 6586099
381 2903542215 2903540706 Bacteria 7062119
382 2904665489 2904659560 Bacteria 6685615
383 2906331657 2906328253 Bacteria 6585166
384 2906368903 2906363423 Bacteria 6856682
385 2906371823 2906370794 Bacteria 6881062
386 2906388784 2906386501 Bacteria 5977019
387 2906400155 2906393657 Bacteria 6790866
388 2906405496 2906401398 Bacteria 6693206
389 2906412586 2906408224 Bacteria 6162342
390 2906417127 2906414383 Bacteria 6580790
391 2906429625 2906427513 Bacteria 6375796
392 2913312784 2913308742 Bacteria 5350706
393 2919411359 2919408235 Bacteria 6149349
394 2922155130 2922151315 Bacteria 6902399
395 2922177159 2922172374 Bacteria 6167644
396 2922182950 2922178524 Bacteria 6025201
397 2923557759 2923556063 Bacteria 6793593
398 2924731035 2924726620 Bacteria 6271473
399 2924738664 2924733363 Bacteria 7574837
400 2924745930 2924741084 Bacteria 6661321
401 2924752519 2924748358 Bacteria 6154725
402 2924762094 2924754689 Bacteria 6774424
403 2924766168 2924762789 Bacteria 6561353
404 2924782111 2924776078 Bacteria 7492003
405 2937828553 2937822353 Bacteria 7290551
406 2937829474 2937822353 Bacteria 7290551
407 2937840358 2937836603 Bacteria 6811263
408 2937865992 2937861824 Bacteria 6660327
409 2937877761 2937877337 Bacteria 7246526
410 2937896783 2937891427 Bacteria 6357007
411 2937977831 2937972304 Bacteria 7532020
412 2937996068 2937994558 Bacteria 7036190
413 2958036191 2958034702 Bacteria 6989922
414 2958047615 2958041894 Bacteria 13082850
415 2958075858 2958071322 Bacteria 6815895
416 2958084869 2958084443 Bacteria 7312792
417 2958093252 2958092219 Bacteria 6861151
418 2958112282 2958108152 Bacteria 6681128
419 2958121807 2958115193 Bacteria 6923548
420 2958122747 2958122699 Bacteria 7280457
421 2958151953 2958144490 Bacteria 6677056
422 2958160922 2958158011 Bacteria 6058449
423 2958166540 2958165035 Bacteria 6906348
424 2960672096 2960667422 Bacteria 6763020
425 2961120489 2961114664 Bacteria 6680456
426 2961132387 2961127735 Bacteria 7196641
427 2961165005 2961163497 Bacteria 6901077
428 2961185026 2961183825 Bacteria 6688536
429 2963649774 2963644680 Bacteria 6530403
430 2963650681 2963644680 Bacteria 6530403
431 2965019830 2965018300 Bacteria 6883036
432 2965026879 2965025482 Bacteria 6532201
433 2965032976 2965032056 Bacteria 6887443
434 2965043109 2965040258 Bacteria 6855979
435 2965052688 2965047637 Bacteria 6623551
436 2965066957 2965062239 Bacteria 7412989
437 2965093419 2965089291 Bacteria 6866420
438 2965109036 2965102966 Bacteria 6800987
439 2968085756 2968083720 Bacteria 7351627
440 2968086915 2968083720 Bacteria 7351627
441 2968094356 2968091066 Bacteria 6052692
442 2968095545 2968091066 Bacteria 6052692
443 2968103344 2968097103 Bacteria 6107094
444 2968116956 2968110612 Bacteria 6814636
445 2968123957 2968117919 Bacteria 6536078
446 2968132319 2968128360 Bacteria 6270294
447 2968173405 2968171901 Bacteria 6894245
448 2970494558 2970489779 Bacteria 6517260
449 2970512767 2970510686 Bacteria 7006402
450 2970537125 2970532167 Bacteria 6553173
451 2970549879 2970547951 Bacteria 6931819
452 2970556494 2970554993 Bacteria 6814252
453 2970594920 2970593180 Bacteria 7073582
454 2970624894 2970619444 Bacteria 6986144
455 2970632203 2970627176 Bacteria 6680862
456 2977853047 2977851361 Bacteria 6694324
457 2977860816 2977858184 Bacteria 6215359
458 2977866282 2977864932 Bacteria 7534097
459 2977870427 2977864932 Bacteria 7534097
460 2977875079 2977872689 Bacteria 7270173
461 2977913098 2977907340 Bacteria 6577984
462 2977916219 2977915119 Bacteria 6829656
463 2977936300 2977935797 Bacteria 6252826
464 2977957150 2977950692 Bacteria 6893264
465 2977962002 2977957713 Bacteria 6877875
466 2977987899 2977986579 Bacteria 6581278
467 2977992383 2977986579 Bacteria 6581278
468 2979751798 2979742915 Bacteria 7301278
469 2979769679 2979764755 Bacteria 6610066
470 2979772679 2979772303 Bacteria 6618277
471 2979781609 2979779861 Bacteria 6219781
472 2979798566 2979793036 Bacteria 6808957
473 2987661012 2987659509 Bacteria 6966464
474 2987670752 2987666974 Bacteria 6509233
475 2987674623 2987673487 Bacteria 6884027
476 2996354171 2996348954 Bacteria 7239054
477 2996387407 2996386984 Bacteria 6978667
478 2996889582 2996887358 Bacteria 5795980
479 3000141245 3000135777 Bacteria 6891109
480 3004171308 3004167301 Bacteria 8330599
481 3004174962 3004167301 Bacteria 8330599
482 3004190062 3004188549 Bacteria 6952365
483 3004200876 3004195979 Bacteria 6776956
484 3004213808 3004211236 Bacteria 7417683
485 3004223399 3004218560 Bacteria 7421728
486 3004237269 3004232784 Bacteria 6662140
487 3004242698 3004239961 Bacteria 6892290
488 3004249718 3004248173 Bacteria 6563236
489 3004270422 3004268573 Bacteria 7043476
490 3004280839 3004275668 Bacteria 7114440
491 3004338991 3004334049 Bacteria 8449246
492 3004341987 3004334049 Bacteria 8449246
493 637078177 637000159 Bacteria 7596297
494 649874942 649633066 Bacteria 6690028
495 8002287181 8002285264 Bacteria 6717907
496 8004303878 8004300914 Bacteria 6132239
497 8004318341 8004312739 Bacteria 7444653
498 8004365721 8004361976 Bacteria 6858373
499 8004400591 8004395343 Bacteria 6620908
500 8004446916 8004445564 Bacteria 6322258
501 8004638853 8004633249 Bacteria 6723080
502 8004645985 8004640170 Bacteria 6723001
503 8004704061 8004703790 Bacteria 8006957
504 8004712651 8004703790 Bacteria 8006957
505 8004731720 8004727605 Bacteria 6643904
506 8005324109 8005321885 Bacteria 5795980
507 8005544129 8005542996 Bacteria 7077758
508 8005549812 8005542996 Bacteria 7077758
509 8005662737 8005658619 Bacteria 4500593
510 8005687898 8005682033 Bacteria 6726518
511 8046767503 8046767195 Bacteria 7547379
512 8046770586 8046767195 Bacteria 7547379
513 8046773077 8046767195 Bacteria 7547379
514 8055623556 8055617313 Bacteria 7548464
515 8057579168 8057575449 Bacteria 7367519
516 8057581894 8057575449 Bacteria 7367519
517 JGI24735J21928_10055153
518 JGI25155J39150_1000199
519 JGI25156J39149_1000449
520 JGI25162J39368_1000201
521 JGI25162J39368_1001229
522 JGI25154J39366_1000369
523 JGI25157J39369_1000477
524 JGI25157J39369_1001050
525 JGI25152J39213_1001832
526 JGI25152J39213_1004525
527 JGI25150J39212_1000259
528 JGI25151J46595_10000574
529 JGI25165J46597_1000016
530 JGI25165J46597_1000274
531 JGI25165J46597_1001039
532 JGI25153J46596_10004695
533 Ga0055542_1000694
534 Ga0055526_1008674
535 Ga0055528_1006093
536 Ga0055531_10039503
537 Ga0058692_1000083
538 Ga0068853_100006235
539 Ga0070665_100048954
540 Ga0068855_100239372
541 Ga0068855_100569051
542 Ga0068854_100082855
543 Ga0068856_100021771
544 Ga0068852_100157607
545 Ga0068852_100320756
546 Ga0068851_10027494
547 Ga0075365_10030526
548 Ga0075365_10075216
549 Ga0075364_10164706
550 Ga0075367_10000071
551 Ga0075369_10003834
552 Ga0075369_10046950
553 Ga0075370_10038677
554 Ga0079104_1000010
555 Ga0105251_10039163
556 Ga0105240_10000142
557 Ga0105240_10099721
558 Ga0105243_10164904
559 Ga0105241_10053088
560 Ga0105237_10003634
561 Ga0105237_10073946
562 Ga0105238_10009417
563 Ga0105238_10875707
564 Ga0123342_1007959
565 Ga0105239_10028919
566 Ga0105239_10067431
567 Ga0105239_10187927
568 Ga0105239_10194940
569 Ga0157371_10320018
570 Ga0157370_10004401
571 Ga0157370_10272846
572 Ga0157369_10068638
573 Ga0182008_10048255
574 Ga0182007_10007138
575 Ga0182007_10040263
576 Ga0182005_1003386
577 Ga0163161_10216979
578 Ga0209435_100133
579 Ga0209437_100203
580 Ga0209437_100204
581 Ga0209437_102716
582 Ga0207425_1000335
583 Ga0209646_1000404
584 Ga0209646_1005230
585 Ga0209026_1000005
586 Ga0209026_1000558
587 Ga0209677_100553
588 Ga0209148_1000057
589 Ga0209148_1006485
590 Ga0209759_1000292
591 Ga0209759_1000800
592 Ga0209129_1000983
593 Ga0209129_1002141
594 Ga0209233_1000068
595 Ga0209233_1000205
596 Ga0209233_1000280
597 Ga0209233_1000582
598 Ga0209233_1008107
599 Ga0209455_1000240
600 Ga0209673_1003950
601 Ga0209025_1001361
602 Ga0209025_1020597
603 Ga0209025_1042309
604 Ga0209564_1017425
605 Ga0209758_1001195
606 Ga0209758_1003476
607 Ga0209256_1012578
608 Ga0207426_1001369
609 Ga0209051_1002708
610 Ga0207713_1038439
611 Ga0207647_10007663
612 Ga0207695_10000234
613 Ga0207671_10000043
614 Ga0207671_10012327
615 Ga0207644_10087850
616 Ga0207706_10019343
617 Ga0207706_10425083
618 Ga0207704_10111019
619 Ga0207667_10077362
620 Ga0207639_10033417
621 Ga0207702_10039210
622 Ga0207702_10076251
623 Ga0207702_10237169
624 Ga0207698_10112016
625 Ga0209281_1000078
626 Ga0209371_1000251
627 Ga0209371_1002781
628 Ga0268256_1000475
629 Ga0268256_1002490
630 Ga0265330_10013038
631 Ga0307405_10002764
632 Ga0395900_0175467
633 Ga0439436_0004729
634 Ga0439447_035913
635 Ga0439462_0018583
636 Ga0450918_004841
637 Ga0466966_0087772
638 Ga0466970_0075969
639 Ga0466959_0093900
640 Ga0495638_0000281
641 Ga0495650_0024139
642 Ga0495605_0000415
643 Ga0495585_0002302
644 Ga0495607_0010747
645 Ga0495583_0005684
646 Ga0495606_0075855
647 Ga0495610_0001567
648 Ga0495610_0076559
649 Ga0495620_0031205
650 Ga0495631_0000853
651 Ga0495632_0003102
652 Ga0495632_0019189
653 Ga0495643_0034832
654 Ga0495643_0046282
655 Ga0495644_0104084
656 Ga0495654_0063383
657 Ga0495622_0151090
658 Ga0495633_0039043
659 Ga0495656_0010629
660 Ga0495668_0002430
661 Ga0495611_0007278
662 Ga0495625_0002937
663 Ga0495625_0016487
664 Ga0495670_0012771
665 Ga0495660_0024043
666 Ga0495636_0089456
667 Ga0495672_0010573
668 Ga0495686_0005577
669 Ga0495686_0045549
670 Ga0496100_0024941
671 Ga0496101_0123497
672 Ga0496102_0028693
673 Ga0496103_0072045
674 Ga0496111_0001273
675 Ga0496112_0016728
676 Ga0496116_0001086
677 Ga0496116_0004225
678 Ga0496116_0006901
679 Ga0496117_0005406
680 Ga0496117_0010623
681 Ga0496117_0015868
682 Ga0496117_0168283
683 Ga0496118_0006076
684 Ga0496118_0070890
685 Ga0496118_0090742
686 Ga0496119_0020683
687 Ga0496119_0237910
688 Ga0496122_0008549
689 Ga0496122_0015191
690 Ga0496122_0022839
691 Ga0496122_0030368
692 Ga0496122_0064062
693 Ga0496122_0154023
694 Ga0496123_0005656
695 Ga0496123_0025344
696 Ga0496123_0053877
697 Ga0496123_0061030
698 Ga0496123_0089869
699 Ga0496124_0002303
700 Ga0496124_0028841
701 Ga0496124_0095392
702 Ga0496124_0157488
703 Ga0496125_0007469
704 Ga0496125_0102093
705 Ga0496126_0044310
706 Ga0496126_0066171
707 Ga0496126_0106001
708 Ga0496126_0204245
709 Ga0496126_0270525
710 Ga0495682_0049235
711 Ga0501073_0295380
712 Ga0501080_0276280
713 Ga0501083_0115923
714 Ga0501044_0274633
715 nmdc:mga03n38_17268_c1
716 nmdc:mga0yw44_24926_c1
717 nmdc:mga0yw44_88446_c1
718 nmdc:mga06z11_59683_c1
719 nmdc:mga06z11_76787_c1
720 nmdc:mga07m45_140685_c1
721 nmdc:mga0sz30_14426_c1
722 Ga0500610_0002978
723 Ga0500610_0018626
724 Ga0500578_0183849
725 Ga0500557_000235
726 Ga0500557_000320
727 Ga0500569_004583
728 Ga0500569_012857
729 Ga0500594_0003427
730 Ga0500594_0003775
731 Ga0500618_005245
732 Ga0500618_008003
733 Ga0500568_0001014
734 Ga0500577_0025247
735 Ga0500616_0000485
736 Ga0500616_0001671
737 Ga0500620_000159
738 Ga0500624_000129
739 Ga0500636_0068072
740 Ga0500645_035180
741 2958115822
742 2510316668
743 2511135912
744 2511172061
745 2511183263
746 2512934938
747 2512963300
748 2512964252
749 2513599486
750 2513599994
751 2513613057
752 2513865809
753 2513885701
754 2513999141
755 2514033998
756 2514034417
757 2514418872
758 2514422158
759 2514590654
760 2515612711
761 2516209973
762 2524458715
763 2524463129
764 2535515505
765 2535520868
766 2585205409
767 2585256817
768 2585272004
769 2585279691
770 2585329030
771 2585333932
772 2585400334
773 2585535771
774 2585551147
775 2585563450
776 2585823058
777 2585844256
778 2585897123
779 2585909047
780 2585996782
781 2586001367
782 2587984461
783 2588515036
784 2599606394
785 2599719207
786 2600197762
787 2616306480
788 2616313073
789 2617382260
790 2643989193
791 2644106258
792 2644146754
793 2644152390
794 2644190972
795 2644242683
796 2644310869
797 2644334328
798 2644545459
799 2644616703
800 2671117148
801 2688600491
802 2694631400
803 2694636621
804 2723577767
805 2738803533
806 2738948006
807 2756672950
808 2756677657
809 2778178768
810 2792624290
811 2792630430
812 2792751001
813 2792753064
814 2819638547
815 2819684320
816 2838034234
817 2838738983
818 2839993948
819 2841842881
820 2842142662
821 2842362887
822 2842480980
823 2842485213
824 2842488781
825 2842507591
826 2842511448
827 2842524885
828 2844005410
829 2844015817
830 2844166042
831 2847672150
832 2847688495
833 2852392015
834 2852392636
835 2856317067
836 2856326564
837 2856330384
838 2856336814
839 2856352632
840 2857369908
841 2857531549
842 2869166120
843 2869167087
844 2869173972
845 2869238192
846 2869244278
847 2869252164
848 2869263107
849 2869269793
850 2869271921
851 2869280322
852 2871437818
853 2871451825
854 2871453238
855 2871464233
856 2871474809
857 2871481908
858 2871497420
859 2874107474
860 2874113978
861 2874120343
862 2874126620
863 2874133237
864 2874144431
865 2874166998
866 2876366981
867 2876373772
868 2876375887
869 2876389047
870 2876398957
871 2876406818
872 2876413474
873 2876422363
874 2878037298
875 2878744194
876 2878761638
877 2878768605
878 2878780233
879 2878782659
880 2881154107
881 2881157842
882 2881163173
883 2881163903
884 2881858733
885 2882638022
886 2882639967
887 2885312136
888 2885315793
889 2885326787
890 2885355648
891 2888349152
892 2888351617
893 2903453551
894 2903455838
895 2903524848
896 2903530909
897 2903542215
898 2904665489
899 2906331657
900 2906368903
901 2906371823
902 2906388784
903 2906400155
904 2906405496
905 2906412586
906 2906417127
907 2906429625
908 2913312784
909 2919411359
910 2922155130
911 2922177159
912 2922182950
913 2923557759
914 2924731035
915 2924738664
916 2924745930
917 2924752519
918 2924762094
919 2924766168
920 2924782111
921 2937828553
922 2937829474
923 2937840358
924 2937865992
925 2937877761
926 2937896783
927 2937977831
928 2937996068
929 2958036191
930 2958047615
931 2958075858
932 2958084869
933 2958093252
934 2958112282
935 2958121807
936 2958122747
937 2958151953
938 2958160922
939 2958166540
940 2960672096
941 2961120489
942 2961132387
943 2961165005
944 2961185026
945 2963649774
946 2963650681
947 2965019830
948 2965026879
949 2965032976
950 2965043109
951 2965052688
952 2965066957
953 2965093419
954 2965109036
955 2968085756
956 2968086915
957 2968094356
958 2968095545
959 2968103344
960 2968116956
961 2968123957
962 2968132319
963 2968173405
964 2970494558
965 2970512767
966 2970537125
967 2970549879
968 2970556494
969 2970594920
970 2970624894
971 2970632203
972 2977853047
973 2977860816
974 2977866282
975 2977870427
976 2977875079
977 2977913098
978 2977916219
979 2977936300
980 2977957150
981 2977962002
982 2977987899
983 2977992383
984 2979751798
985 2979769679
986 2979772679
987 2979781609
988 2979798566
989 2987661012
990 2987670752
991 2987674623
992 2996354171
993 2996387407
994 2996889582
995 3000141245
996 3004171308
997 3004174962
998 3004190062
999 3004200876
1000 3004213808
1001 3004223399
1002 3004237269
1003 3004242698
1004 3004249718
1005 3004270422
1006 3004280839
1007 3004338991
1008 3004341987
1009 637078177
1010 649874942
1011 8002287181
1012 8004303878
1013 8004318341
1014 8004365721
1015 8004400591
1016 8004446916
1017 8004638853
1018 8004645985
1019 8004704061
1020 8004712651
1021 8004731720
1022 8005324109
1023 8005544129
1024 8005549812
1025 8005662737
1026 8005687898
1027 8046767503
1028 8046770586
1029 8046773077
1030 8055623556
1031 8057579168
1032 8057581894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zm2-assembly1.cif.gz_B fe(ii)/(alpha)ketoglutarate-dependent dioxygenase anda 0.7519 82 305
5zm2-assembly2.cif.gz_D-2 fe(ii)/(alpha)ketoglutarate-dependent dioxygenase anda 0.7474 82 313
7wpy-assembly1.cif.gz_C anda_m119a_n121v variant 0.7449 82 309
5zm2-assembly2.cif.gz_C fe(ii)/(alpha)ketoglutarate-dependent dioxygenase anda 0.7433 82 313
7wpy-assembly2.cif.gz_B anda_m119a_n121v variant 0.7414 82 309
ID Description Score Start End Superfamily
5zm2D00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7474 82 313 2.60.120.620
af_C7FZX0_9_206_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7367 143 304 2.60.120.620
5m0tB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7122 79 309 2.60.120.620
af_Q4D4M7_1_169_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.693 205 303 2.60.120.620
1zz7B02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6841 174 302 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A5R2N6F7-F1-model_v4 Uncharacterized protein 0.9786 94 285
AF-A0A7W7EJY5-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9777 77 321
AF-A0A376ABH2-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9691 48 321
AF-A0A531KJ33-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9673 125 313
AF-A0A528BN08-F1-model_v4 Uncharacterized protein 0.9667 60 285

Map