F458086

General Info

Members Datasets Scaffolds Average Seq Length
517 271 1034 132

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10006960|JGI24737J22298_100069604
Length 154
Sequence MQLGKYIFIKIEVLSKLIMNKSNRRKFIATSASLAIGTATASAIPLVVTENKYPIVHHVFFWLKNPDSKEDRDKLVAGVKTLAKIETVRELRVGIVADTEKRDVVDKSWAVSELMFFSDLKGQAAYQNHPVHLEFIKNCSYLWEKVIVYDAVDA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
176 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
236 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
241 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
260 2738541284 Pedobacter sp. YR016 Isolate Unclassified
261 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
262 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
263 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
264 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
265 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
266 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
267 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
268 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
269 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
270 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
271 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.39
Isolates 2.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0
Rhizoplane 1.16
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10006960 3300001990 Bacteria 3834
2 SwRhRL2b_contig_2741210 2162886007 Bacteria 17720
3 SwRhRL2b_contig_798958 2162886007 Bacteria 1734
4 JGI24740J21852_10003411 3300001979 Bacteria 6992
5 JGI24739J22299_10005079 3300001989 Bacteria 5012
6 JGI25162J39368_1000213 3300002737 Bacteria 60963
7 JGI25162J39368_1006400 3300002737 Bacteria 2043
8 JGI25164J39214_1002448 3300002772 Bacteria 2840
9 JGI25165J46597_1000986 3300003214 Bacteria 19072
10 rootH1_10014099 3300003316 Bacteria 20359
11 rootH2_10001334 3300003320 Bacteria 238709
12 rootH2_10005669 3300003320 Bacteria 4952
13 rootH2_10043027 3300003320 Unclassified 1183
14 rootH1_10019846 3300003323 Bacteria 13232
15 rootH1_10034967 3300003323 Bacteria 11967
16 rootH1_10102515 3300003323 Bacteria 8322
17 rootH1_10151014 3300003323 Bacteria 1166
18 rootH1_10171706 3300003323 Bacteria 12863
19 rootH1_10212301 3300003323 Bacteria 2514
20 JGI25160J50197_1023237 3300003354 Bacteria 1795
21 Ga0065714_10004780 3300005288 Bacteria 13537
22 Ga0065714_10067106 3300005288 Bacteria 5881
23 Ga0065714_10067656 3300005288 Bacteria 5303
24 Ga0065704_10000206 3300005289 Bacteria 121672
25 Ga0065704_10082026 3300005289 Bacteria 3635
26 Ga0065704_10091660 3300005289 Bacteria 2702
27 Ga0070658_11130154 3300005327 Bacteria 681
28 Ga0070676_10000038 3300005328 Bacteria 39143
29 Ga0070676_10212667 3300005328 Bacteria 1273
30 Ga0070670_101110436 3300005331 Bacteria 721
31 Ga0070677_10007101 3300005333 Bacteria 3731
32 Ga0070677_10092885 3300005333 Bacteria 1316
33 Ga0070677_10157921 3300005333 Unclassified 1061
34 Ga0068869_100051735 3300005334 Bacteria 2980
35 Ga0068869_100175713 3300005334 Bacteria 1676
36 Ga0068869_100346440 3300005334 Bacteria 1210
37 Ga0068869_100464147 3300005334 Unclassified 1052
38 Ga0070680_101218890 3300005336 Bacteria 651
39 Ga0070682_100118083 3300005337 Bacteria 1777
40 Ga0070682_100198868 3300005337 Unclassified 1412
41 Ga0070682_100207926 3300005337 Bacteria 1385
42 Ga0068868_100022783 3300005338 Bacteria 4733
43 Ga0068868_100060510 3300005338 Unclassified 2999
44 Ga0068868_100870631 3300005338 Unclassified 817
45 Ga0068868_101386968 3300005338 Unclassified 655
46 Ga0070660_100716893 3300005339 Bacteria 839
47 Ga0070660_101208148 3300005339 Bacteria 641
48 Ga0070689_100001360 3300005340 Bacteria 15529
49 Ga0070689_100445702 3300005340 Bacteria 1101
50 Ga0070689_101694797 3300005340 Unclassified 575
51 Ga0070687_101521254 3300005343 Bacteria 504
52 Ga0070692_10579952 3300005345 Bacteria 739
53 Ga0070668_101086250 3300005347 Unclassified 722
54 Ga0070675_100033580 3300005354 Bacteria 4161
55 Ga0070675_100076729 3300005354 Bacteria 2780
56 Ga0070671_101448791 3300005355 Unclassified 607
57 Ga0070674_101391646 3300005356 Bacteria 628
58 Ga0070673_100005489 3300005364 Bacteria 8121
59 Ga0070673_100013174 3300005364 Bacteria 5707
60 Ga0070673_100107792 3300005364 Bacteria 2305
61 Ga0070673_100472041 3300005364 Bacteria 1131
62 Ga0070673_101203367 3300005364 Unclassified 710
63 Ga0070688_100170337 3300005365 Bacteria 1502
64 Ga0070659_100058210 3300005366 Bacteria 3049
65 Ga0070659_100225065 3300005366 Bacteria 1549
66 Ga0070659_100290725 3300005366 Bacteria 1361
67 Ga0070667_100285449 3300005367 Bacteria 1483
68 Ga0070667_100478753 3300005367 Bacteria 1139
69 Ga0070667_100644843 3300005367 Unclassified 977
70 Ga0070701_10072716 3300005438 Bacteria 1842
71 Ga0070701_10289518 3300005438 Unclassified 1003
72 Ga0070705_100119788 3300005440 Unclassified 1697
73 Ga0070700_100012357 3300005441 Bacteria 4761
74 Ga0070700_100114145 3300005441 Bacteria 1801
75 Ga0070700_100129349 3300005441 Bacteria 1702
76 Ga0070694_100020137 3300005444 Bacteria 4250
77 Ga0070708_101402290 3300005445 Bacteria 652
78 Ga0070663_100244012 3300005455 Bacteria 1419
79 Ga0070663_100800200 3300005455 Bacteria 808
80 Ga0070663_101461329 3300005455 Unclassified 607
81 Ga0070678_100010849 3300005456 Bacteria 5588
82 Ga0070678_100158748 3300005456 Bacteria 1830
83 Ga0070662_100001815 3300005457 Bacteria 13127
84 Ga0070662_100239675 3300005457 Bacteria 1454
85 Ga0068867_100001131 3300005459 Bacteria 18214
86 Ga0068867_100196363 3300005459 Bacteria 1613
87 Ga0068867_101546372 3300005459 Unclassified 619
88 Ga0070685_10119570 3300005466 Bacteria 1634
89 Ga0070706_100761445 3300005467 Bacteria 897
90 Ga0070679_100123436 3300005530 Bacteria 2573
91 Ga0068853_100005741 3300005539 Bacteria 9769
92 Ga0068853_100014308 3300005539 Bacteria 6493
93 Ga0070672_100008364 3300005543 Bacteria 7074
94 Ga0070672_100014133 3300005543 Bacteria 5650
95 Ga0070672_100024627 3300005543 Bacteria 4452
96 Ga0070672_100562098 3300005543 Bacteria 991
97 Ga0070686_100012880 3300005544 Bacteria 4774
98 Ga0070686_100070339 3300005544 Bacteria 2288
99 Ga0070696_100512923 3300005546 Bacteria 956
100 Ga0070665_100000003 3300005548 Bacteria 811857
101 Ga0070665_100004183 3300005548 Bacteria 15181
102 Ga0070665_100045780 3300005548 Bacteria 4394
103 Ga0070665_101789179 3300005548 Unclassified 621
104 Ga0070704_100055524 3300005549 Bacteria 2809
105 Ga0068855_100093279 3300005563 Bacteria 3472
106 Ga0068857_100100807 3300005577 Bacteria 2591
107 Ga0068857_100575848 3300005577 Bacteria 1062
108 Ga0068857_100739033 3300005577 Bacteria 937
109 Ga0068854_100007939 3300005578 Bacteria 6794
110 Ga0068854_100337845 3300005578 Bacteria 1229
111 Ga0070702_100002604 3300005615 Bacteria 7851
112 Ga0070702_100473245 3300005615 Unclassified 914
113 Ga0070702_101047303 3300005615 Unclassified 649
114 Ga0068852_100003080 3300005616 Bacteria 11608
115 Ga0068852_102725898 3300005616 Bacteria 513
116 Ga0068859_100415133 3300005617 Bacteria 1442
117 Ga0068859_100471362 3300005617 Bacteria 1351
118 Ga0068859_101378952 3300005617 Bacteria 777
119 Ga0068864_100066841 3300005618 Bacteria 3121
120 Ga0068864_100269084 3300005618 Bacteria 1587
121 Ga0068866_10194968 3300005718 Bacteria 1206
122 Ga0068866_10703256 3300005718 Bacteria 693
123 Ga0068861_100001702 3300005719 Bacteria 14124
124 Ga0068861_100489280 3300005719 Unclassified 1110
125 Ga0068861_100578262 3300005719 Bacteria 1028
126 Ga0068861_100911922 3300005719 Bacteria 833
127 Ga0068851_10076139 3300005834 Bacteria 1745
128 Ga0068870_10199152 3300005840 Bacteria 1213
129 Ga0068870_10694401 3300005840 Bacteria 701
130 Ga0068863_100030783 3300005841 Bacteria 5125
131 Ga0068863_100031893 3300005841 Bacteria 5026
132 Ga0068863_100100494 3300005841 Bacteria 2749
133 Ga0068863_100126608 3300005841 Bacteria 2437
134 Ga0068863_100318144 3300005841 Bacteria 1511
135 Ga0068858_100573424 3300005842 Bacteria 1093
136 Ga0068860_100016428 3300005843 Bacteria 7217
137 Ga0068862_100192033 3300005844 Bacteria 1838
138 Ga0068862_100788459 3300005844 Bacteria 927
139 Ga0068862_101555768 3300005844 Unclassified 667
140 Ga0081455_10008486 3300005937 Bacteria 10677
141 Ga0081539_10045722 3300005985 Bacteria 2515
142 Ga0075366_10039629 3300006195 Bacteria 2785
143 Ga0097621_100000241 3300006237 Bacteria 36577
144 Ga0097621_100007161 3300006237 Bacteria 7952
145 Ga0097621_100249875 3300006237 Unclassified 1553
146 Ga0097621_100306216 3300006237 Bacteria 1404
147 Ga0097621_100546284 3300006237 Bacteria 1054
148 Ga0075370_10105063 3300006353 Bacteria 1637
149 Ga0068871_100000139 3300006358 Bacteria 46889
150 Ga0068871_100005168 3300006358 Bacteria 9126
151 Ga0068871_100095215 3300006358 Bacteria 2486
152 Ga0068871_100214621 3300006358 Bacteria 1665
153 Ga0068871_100302717 3300006358 Bacteria 1404
154 Ga0068865_100000022 3300006881 Bacteria 102976
155 Ga0068865_100095989 3300006881 Bacteria 2161
156 Ga0068865_100188664 3300006881 Bacteria 1592
157 Ga0068865_100390922 3300006881 Bacteria 1137
158 Ga0068865_100415123 3300006881 Unclassified 1105
159 Ga0097620_100415137 3300006931 Bacteria 1442
160 Ga0097620_100471371 3300006931 Bacteria 1351
161 Ga0097620_101379020 3300006931 Bacteria 777
162 Ga0105240_10002937 3300009093 Bacteria 26886
163 Ga0105240_10191238 3300009093 Bacteria 2406
164 Ga0105240_10285700 3300009093 Unclassified 1893
165 Ga0105240_11011463 3300009093 Bacteria 888
166 Ga0111539_10151273 3300009094 Bacteria 2716
167 Ga0105243_10722464 3300009148 Bacteria 973
168 Ga0105243_10934707 3300009148 Bacteria 865
169 Ga0105243_11819434 3300009148 Bacteria 640
170 Ga0105241_10003917 3300009174 Bacteria 11029
171 Ga0105241_10023343 3300009174 Bacteria 4586
172 Ga0105241_10572900 3300009174 Bacteria 1017
173 Ga0105242_10630658 3300009176 Unclassified 1040
174 Ga0105248_10374852 3300009177 Bacteria 1602
175 Ga0105237_10001288 3300009545 Bacteria 33371
176 Ga0105237_10005068 3300009545 Bacteria 14965
177 Ga0105237_10009241 3300009545 Bacteria 10573
178 Ga0105237_10106320 3300009545 Bacteria 2798
179 Ga0105237_10386798 3300009545 Bacteria 1404
180 Ga0105237_10498398 3300009545 Bacteria 1224
181 Ga0105238_10151108 3300009551 Bacteria 2297
182 Ga0105249_11684210 3300009553 Bacteria 707
183 Ga0105029_120845 3300009984 Unclassified 548
184 Ga0105239_10000032 3300010375 Bacteria 225528
185 Ga0105239_10039114 3300010375 Bacteria 5197
186 Ga0105239_10174303 3300010375 Bacteria 2406
187 Ga0105239_10441269 3300010375 Bacteria 1476
188 Ga0105239_10880449 3300010375 Bacteria 1027
189 Ga0105246_10045963 3300011119 Bacteria 2976
190 Ga0157373_10010741 3300013100 Bacteria 6738
191 Ga0157373_10071102 3300013100 Bacteria 2458
192 Ga0157373_10127676 3300013100 Bacteria 1788
193 Ga0157371_10002786 3300013102 Bacteria 16402
194 Ga0157371_10043019 3300013102 Bacteria 3219
195 Ga0157371_10251402 3300013102 Bacteria 1273
196 Ga0157370_10007087 3300013104 Bacteria 12244
197 Ga0157370_10380107 3300013104 Bacteria 1301
198 Ga0157370_10552733 3300013104 Bacteria 1055
199 Ga0157370_10585017 3300013104 Bacteria 1022
200 Ga0157369_10019092 3300013105 Bacteria 7674
201 Ga0157369_10444731 3300013105 Bacteria 1342
202 Ga0157369_10665812 3300013105 Bacteria 1073
203 Ga0157369_11273724 3300013105 Bacteria 750
204 Ga0157374_10000130 3300013296 Bacteria 68718
205 Ga0157374_10060401 3300013296 Bacteria 3547
206 Ga0157378_10105405 3300013297 Bacteria 2578
207 Ga0157378_10689816 3300013297 Unclassified 1040
208 Ga0163162_10000064 3300013306 Bacteria 103542
209 Ga0163162_10003444 3300013306 Bacteria 15107
210 Ga0163162_10352434 3300013306 Bacteria 1604
211 Ga0157372_10061667 3300013307 Unclassified 4200
212 Ga0157372_10317984 3300013307 Bacteria 1812
213 Ga0157375_10101297 3300013308 Bacteria 2963
214 Ga0157375_10202985 3300013308 Bacteria 2139
215 Ga0157375_10431855 3300013308 Bacteria 1483
216 Ga0157375_10688769 3300013308 Bacteria 1176
217 Ga0163163_10870143 3300014325 Unclassified 964
218 Ga0157380_10017505 3300014326 Bacteria 5304
219 Ga0157380_10048612 3300014326 Bacteria 3341
220 Ga0157380_10081204 3300014326 Bacteria 2651
221 Ga0157380_10175881 3300014326 Bacteria 1875
222 Ga0157380_10246520 3300014326 Bacteria 1614
223 Ga0157380_10468604 3300014326 Unclassified 1215
224 Ga0157380_11606036 3300014326 Bacteria 706
225 Ga0182008_10000020 3300014497 Bacteria 228333
226 Ga0182008_10005357 3300014497 Bacteria 7324
227 Ga0182008_10020505 3300014497 Bacteria 3403
228 Ga0182008_10036058 3300014497 Bacteria 2475
229 Ga0182008_10039454 3300014497 Bacteria 2360
230 Ga0182008_10197340 3300014497 Bacteria 1023
231 Ga0157377_10140932 3300014745 Bacteria 1482
232 Ga0157376_10046409 3300014969 Bacteria 3582
233 Ga0182006_1000239 3300015261 Bacteria 51541
234 Ga0182006_1003612 3300015261 Bacteria 7857
235 Ga0182007_10305702 3300015262 Bacteria 585
236 Ga0163161_10003277 3300017792 Bacteria 11380
237 Ga0163161_10198995 3300017792 Bacteria 1543
238 Ga0163161_11699767 3300017792 Bacteria 559
239 Ga0209436_104698 3300025208 Bacteria 3315
240 Ga0207427_100090 3300025231 Bacteria 133759
241 Ga0209437_100034 3300025233 Bacteria 494007
242 Ga0209437_100134 3300025233 Bacteria 178305
243 Ga0209233_1000038 3300025261 Bacteria 548972
244 Ga0209130_1001120 3300025284 Bacteria 19696
245 Ga0207426_1000448 3300025302 Bacteria 65983
246 Ga0207656_10465616 3300025321 Bacteria 640
247 Ga0207682_10007435 3300025893 Bacteria 4365
248 Ga0207682_10125279 3300025893 Unclassified 1143
249 Ga0207642_10539840 3300025899 Bacteria 719
250 Ga0207647_10000093 3300025904 Bacteria 68094
251 Ga0207647_10052413 3300025904 Bacteria 2518
252 Ga0207647_10369005 3300025904 Bacteria 811
253 Ga0207645_10009130 3300025907 Bacteria 6876
254 Ga0207643_10013128 3300025908 Bacteria 4482
255 Ga0207654_10005865 3300025911 Bacteria 6192
256 Ga0207654_10063710 3300025911 Bacteria 2165
257 Ga0207695_10001318 3300025913 Bacteria 42076
258 Ga0207695_10002972 3300025913 Bacteria 24457
259 Ga0207695_10631165 3300025913 Bacteria 952
260 Ga0207695_11326607 3300025913 Bacteria 600
261 Ga0207671_10004213 3300025914 Bacteria 13860
262 Ga0207671_10009633 3300025914 Bacteria 8052
263 Ga0207671_10032837 3300025914 Bacteria 3863
264 Ga0207652_10254188 3300025921 Bacteria 1585
265 Ga0207681_10054233 3300025923 Bacteria 2725
266 Ga0207681_10387356 3300025923 Bacteria 1126
267 Ga0207694_10071222 3300025924 Bacteria 2716
268 Ga0207650_10833106 3300025925 Bacteria 782
269 Ga0207659_10019980 3300025926 Bacteria 4420
270 Ga0207659_10030229 3300025926 Bacteria 3699
271 Ga0207690_10040030 3300025932 Bacteria 3062
272 Ga0207706_10000725 3300025933 Bacteria 34447
273 Ga0207706_10308040 3300025933 Bacteria 1379
274 Ga0207686_10068652 3300025934 Bacteria 2271
275 Ga0207670_10012031 3300025936 Bacteria 5044
276 Ga0207670_10098731 3300025936 Bacteria 2082
277 Ga0207670_11486672 3300025936 Unclassified 576
278 Ga0207669_10007115 3300025937 Bacteria 5152
279 Ga0207669_10156778 3300025937 Bacteria 1602
280 Ga0207669_10226695 3300025937 Bacteria 1376
281 Ga0207669_11947634 3300025937 Bacteria 502
282 Ga0207704_10000011 3300025938 Bacteria 180140
283 Ga0207704_10105378 3300025938 Bacteria 1891
284 Ga0207704_10311858 3300025938 Bacteria 1210
285 Ga0207691_10002967 3300025940 Bacteria 16561
286 Ga0207691_10010518 3300025940 Bacteria 8879
287 Ga0207691_10606341 3300025940 Bacteria 927
288 Ga0207689_10084970 3300025942 Bacteria 2601
289 Ga0207689_10352913 3300025942 Unclassified 1223
290 Ga0207689_10605256 3300025942 Bacteria 922
291 Ga0207689_10835150 3300025942 Bacteria 778
292 Ga0207689_11189510 3300025942 Bacteria 642
293 Ga0207689_11563920 3300025942 Bacteria 549
294 Ga0207667_10012796 3300025949 Bacteria 9639
295 Ga0207651_10403635 3300025960 Bacteria 1163
296 Ga0207651_10695268 3300025960 Bacteria 895
297 Ga0207651_11375468 3300025960 Bacteria 635
298 Ga0207668_10070557 3300025972 Bacteria 2492
299 Ga0207640_10014994 3300025981 Bacteria 4475
300 Ga0207640_10315792 3300025981 Bacteria 1242
301 Ga0207640_11693400 3300025981 Bacteria 571
302 Ga0207658_10235434 3300025986 Bacteria 1548
303 Ga0207658_10996098 3300025986 Unclassified 764
304 Ga0207658_10997577 3300025986 Bacteria 764
305 Ga0207677_10013300 3300026023 Bacteria 4764
306 Ga0207677_10036451 3300026023 Bacteria 3206
307 Ga0207677_10800268 3300026023 Unclassified 844
308 Ga0207677_11104355 3300026023 Unclassified 723
309 Ga0207703_10446160 3300026035 Bacteria 1208
310 Ga0207639_10090833 3300026041 Bacteria 2443
311 Ga0207678_10290369 3300026067 Bacteria 1404
312 Ga0207678_10378791 3300026067 Bacteria 1223
313 Ga0207678_10931399 3300026067 Bacteria 768
314 Ga0207708_10050713 3300026075 Bacteria 3159
315 Ga0207708_10063373 3300026075 Bacteria 2824
316 Ga0207641_10022428 3300026088 Bacteria 5198
317 Ga0207641_10075139 3300026088 Bacteria 2917
318 Ga0207641_10265781 3300026088 Bacteria 1608
319 Ga0207641_10485534 3300026088 Bacteria 1198
320 Ga0207648_10003739 3300026089 Bacteria 15911
321 Ga0207648_10340265 3300026089 Bacteria 1351
322 Ga0207648_10916975 3300026089 Bacteria 819
323 Ga0207676_10026999 3300026095 Bacteria 4273
324 Ga0207674_10082021 3300026116 Bacteria 3226
325 Ga0207674_10586144 3300026116 Bacteria 1077
326 Ga0207675_100001965 3300026118 Bacteria 20496
327 Ga0207675_100019691 3300026118 Bacteria 6299
328 Ga0207675_100029359 3300026118 Bacteria 5124
329 Ga0207675_100089806 3300026118 Bacteria 2888
330 Ga0207675_100217974 3300026118 Bacteria 1838
331 Ga0207675_100687066 3300026118 Bacteria 1032
332 Ga0207675_101154541 3300026118 Bacteria 795
333 Ga0207683_10002906 3300026121 Bacteria 14939
334 Ga0207683_10022918 3300026121 Bacteria 5366
335 Ga0207698_10001661 3300026142 Bacteria 12974
336 Ga0207698_11615729 3300026142 Bacteria 664
337 Ga0268266_10000078 3300028379 Bacteria 213632
338 Ga0268266_10003252 3300028379 Bacteria 16373
339 Ga0268266_10054598 3300028379 Bacteria 3433
340 Ga0268266_11533004 3300028379 Bacteria 642
341 Ga0268265_10026859 3300028380 Bacteria 4100
342 Ga0268265_11446232 3300028380 Unclassified 690
343 Ga0268264_10160550 3300028381 Bacteria 2024
344 Ga0268264_12084851 3300028381 Bacteria 576
345 Ga0307517_10001632 3300028786 Bacteria 37097
346 Ga0307517_10004342 3300028786 Bacteria 21830
347 Ga0316182_1265555 3300030745 Bacteria 577
348 Ga0316182_1449594 3300030745 Bacteria 818
349 Ga0307513_10011365 3300031456 Bacteria 11071
350 Ga0307513_10014812 3300031456 Bacteria 9486
351 Ga0307513_10135946 3300031456 Bacteria 2394
352 Ga0307513_10142731 3300031456 Bacteria 2318
353 Ga0307513_10201759 3300031456 Unclassified 1829
354 Ga0307509_10087205 3300031507 Bacteria 3207
355 Ga0307408_100103850 3300031548 Unclassified 2170
356 Ga0307408_101234606 3300031548 Bacteria 698
357 Ga0307408_101788601 3300031548 Bacteria 587
358 Ga0307516_10003109 3300031730 Bacteria 21594
359 Ga0307405_10950629 3300031731 Bacteria 730
360 Ga0307410_10055797 3300031852 Bacteria 2683
361 Ga0307410_10141185 3300031852 Unclassified 1782
362 Ga0307406_10859331 3300031901 Unclassified 770
363 Ga0307406_11661289 3300031901 Bacteria 565
364 Ga0307412_10000001 3300031911 Bacteria 822691
365 Ga0307412_10466713 3300031911 Bacteria 1044
366 Ga0307412_10565317 3300031911 Bacteria 957
367 Ga0307412_10619596 3300031911 Bacteria 919
368 Ga0307412_10728340 3300031911 Bacteria 854
369 Ga0307409_100076510 3300031995 Bacteria 2684
370 Ga0307409_100475093 3300031995 Bacteria 1212
371 Ga0307409_100682154 3300031995 Bacteria 1025
372 Ga0307416_100024344 3300032002 Bacteria 4417
373 Ga0307416_100037488 3300032002 Bacteria 3731
374 Ga0307416_101606709 3300032002 Bacteria 755
375 Ga0307414_10040203 3300032004 Bacteria 3157
376 Ga0307414_10043970 3300032004 Bacteria 3046
377 Ga0307414_10133116 3300032004 Bacteria 1933
378 Ga0307414_10402531 3300032004 Bacteria 1189
379 Ga0307411_10027630 3300032005 Bacteria 3436
380 Ga0307411_10578508 3300032005 Bacteria 962
381 Ga0307415_100224934 3300032126 Bacteria 1507
382 Ga0307415_100689131 3300032126 Bacteria 921
383 Ga0307510_10008251 3300033180 Bacteria 12411
384 Ga0373941_0247168 3300035115 Bacteria 695
385 Ga0373937_0358395 3300036401 Bacteria 1382
386 Ga0395900_0000014 3300037418 Bacteria 386513
387 Ga0395898_0002626 3300037466 Bacteria 20893
388 Ga0395905_0000037 3300037471 Bacteria 261808
389 Ga0395901_0000117 3300038443 Bacteria 105071
390 Ga0439465_0001425 3300041413 Bacteria 7735
391 Ga0451793_0446017 3300041452 Bacteria 1376
392 Ga0451802_1890635 3300041460 Bacteria 859
393 Ga0451807_0204085 3300041486 Unclassified 584
394 Ga0451807_1195179 3300041486 Unclassified 1705
395 Ga0451807_1250729 3300041486 Bacteria 3666
396 Ga0451843_1108106 3300041509 Unclassified 1201
397 Ga0451853_3169696 3300041512 Bacteria 811
398 Ga0439445_0064864 3300042004 Bacteria 1003
399 Ga0439448_0001474 3300042005 Bacteria 6105
400 Ga0439432_091729 3300042006 Bacteria 914
401 Ga0439449_0000016 3300042007 Bacteria 49059
402 Ga0450917_011810 3300042120 Bacteria 705
403 Ga0439464_0188827 3300042439 Bacteria 654
404 Ga0451577_0060031 3300042876 Bacteria 3390
405 Ga0466972_0065633 3300044658 Bacteria 1736
406 Ga0453683_0258596 3300044673 Bacteria 1110
407 Ga0453684_0003109 3300044712 Bacteria 38229
408 Ga0466959_0025719 3300045049 Bacteria 4365
409 Ga0451576_0011029 3300045051 Bacteria 10320
410 Ga0495617_080551 3300046452 Bacteria 1067
411 Ga0495638_0043874 3300046460 Bacteria 2819
412 Ga0495650_0000081 3300046471 Bacteria 240957
413 Ga0495596_0208948 3300046500 Unclassified 758
414 Ga0495596_0385500 3300046500 Bacteria 546
415 Ga0495583_0116762 3300046506 Bacteria 1126
416 Ga0495606_0000034 3300046507 Bacteria 247705
417 Ga0495606_0036712 3300046507 Bacteria 3335
418 Ga0495606_0044211 3300046507 Bacteria 2964
419 Ga0495606_0361784 3300046507 Bacteria 767
420 Ga0495610_0001393 3300046512 Bacteria 21452
421 Ga0495610_0102831 3300046512 Bacteria 1277
422 Ga0495616_0007814 3300046513 Bacteria 6382
423 Ga0495616_0052646 3300046513 Bacteria 2026
424 Ga0495620_0231796 3300046515 Unclassified 706
425 Ga0495620_0248918 3300046515 Bacteria 678
426 Ga0495620_0425802 3300046515 Bacteria 502
427 Ga0495631_0040351 3300046518 Bacteria 2068
428 Ga0495648_0032109 3300046524 Bacteria 3450
429 Ga0495652_0222908 3300046529 Bacteria 1416
430 Ga0495609_0010061 3300046538 Bacteria 4552
431 Ga0495633_0004766 3300046558 Bacteria 8509
432 Ga0495668_0069228 3300046616 Bacteria 1941
433 Ga0495668_0611848 3300046616 Unclassified 602
434 Ga0495625_0000049 3300046660 Bacteria 197646
435 Ga0495625_0002768 3300046660 Bacteria 18517
436 Ga0495625_0008211 3300046660 Bacteria 8934
437 Ga0495625_0019211 3300046660 Bacteria 5308
438 Ga0495625_0037016 3300046660 Bacteria 3582
439 Ga0495625_0119759 3300046660 Bacteria 1792
440 Ga0495625_0144268 3300046660 Bacteria 1604
441 Ga0495625_0291084 3300046660 Bacteria 1048
442 Ga0495661_0003920 3300046665 Bacteria 10865
443 Ga0495661_0314394 3300046665 Bacteria 780
444 Ga0495671_0114641 3300046692 Bacteria 1316
445 Ga0495649_0000014 3300046694 Bacteria 287408
446 Ga0495649_0002042 3300046694 Bacteria 14568
447 Ga0495649_0174989 3300046694 Bacteria 1122
448 Ga0495660_0035685 3300046810 Bacteria 2777
449 Ga0495683_0087032 3300047323 Unclassified 1518
450 Ga0495687_000793 3300047443 Bacteria 33985
451 Ga0495687_005676 3300047443 Bacteria 7884
452 Ga0495687_031241 3300047443 Bacteria 2445
453 Ga0495677_0063255 3300047445 Unclassified 1374
454 Ga0495679_034182 3300047446 Bacteria 1620
455 Ga0495685_048426 3300047447 Unclassified 1445
456 Ga0495673_0021652 3300047469 Bacteria 3169
457 Ga0495686_0026682 3300047472 Bacteria 3779
458 Ga0495686_0064223 3300047472 Bacteria 2273
459 Ga0495686_0075395 3300047472 Bacteria 2068
460 Ga0496122_0002408 3300048925 Bacteria 26652
461 Ga0496122_0003882 3300048925 Bacteria 19164
462 Ga0496123_0002515 3300048926 Bacteria 22532
463 Ga0496123_0140654 3300048926 Bacteria 1320
464 Ga0496125_0086301 3300048928 Bacteria 2374
465 Ga0496126_0029181 3300048929 Bacteria 5242
466 Ga0501309_011617 3300049129 Bacteria 1150
467 Ga0495678_026771 3300049459 Bacteria 2455
468 Ga0495682_0031081 3300049460 Bacteria 1975
469 Ga0501298_032076 3300049521 Bacteria 1036
470 Ga0501323_006411 3300049539 Bacteria 1314
471 Ga0501068_0471434 3300049584 Unclassified 813
472 Ga0501070_0354308 3300049586 Unclassified 1191
473 Ga0501071_0131529 3300049587 Bacteria 1859
474 Ga0501073_0117059 3300049589 Bacteria 1847
475 Ga0501076_0022985 3300049592 Bacteria 4799
476 Ga0501077_0299494 3300049593 Unclassified 1024
477 Ga0501233_126182 3300049668 Unclassified 696
478 Ga0501236_001154 3300049670 Unclassified 3000
479 Ga0501257_001504 3300049686 Unclassified 4864
480 Ga0501079_0005024 3300049741 Bacteria 9816
481 Ga0501080_0007110 3300049742 Bacteria 10104
482 Ga0501083_0045694 3300049744 Bacteria 2962
483 Ga0501241_033108 3300049758 Bacteria 982
484 Ga0501264_000088 3300049761 Bacteria 13397
485 nmdc:mga0k408_25586_c1 3300050493 Bacteria 3343
486 nmdc:mga08y16_941631_c1 3300050511 Bacteria 847
487 Ga0495655_0244289 3300053083 Unclassified 602
488 Ga0500644_0004303 3300053088 Bacteria 3559
489 Ga0500644_0052211 3300053088 Bacteria 1407
490 Ga0500651_0000130 3300053093 Bacteria 46487
491 Ga0500650_0207432 3300053098 Bacteria 891
492 Ga0500650_0310761 3300053098 Bacteria 696
493 Ga0500608_003331 3300053122 Bacteria 6008
494 Ga0500618_000079 3300053125 Bacteria 79415
495 Ga0500628_011744 3300053129 Bacteria 1599
496 Ga0500564_190748 3300053138 Bacteria 848
497 Ga0500568_0039098 3300053139 Bacteria 1917
498 Ga0500568_0044209 3300053139 Bacteria 1778
499 Ga0500616_0214261 3300053153 Bacteria 844
500 Ga0500622_0019552 3300053156 Bacteria 3597
501 Ga0500611_064269 3300053727 Bacteria 878
502 Ga0501084_0546538 3300054114 Bacteria 979
503 Ga0590074_088376 3300059423 Bacteria 597
504 Ga0501082_0075842 3300060353 Bacteria 2897
505 2599481602 2599185184 Bacteria 6430550
506 2738761405 2738541284 Bacteria 5199923
507 2776615985 2775506987 Bacteria 5373360
508 2819680378 2818991460 Bacteria 7595395
509 2852688696 2852684882 Bacteria 5463342
510 2896089838 2896085136 Bacteria 6129793
511 2928083166 2928078545 Bacteria 6534839
512 2928152990 2928147474 Bacteria 6512076
513 2929182665 2929177148 Bacteria 7883697
514 2929195486 2929195423 Bacteria 5325372
515 2932086633 2932082852 Bacteria 6563563
516 2945978591 2945977869 Bacteria 7777518
517 2946015546 2946013367 Bacteria 7766675
518 JGI24737J22298_10006960
519 SwRhRL2b_contig_2741210
520 SwRhRL2b_contig_798958
521 JGI24740J21852_10003411
522 JGI24739J22299_10005079
523 JGI25162J39368_1000213
524 JGI25162J39368_1006400
525 JGI25164J39214_1002448
526 JGI25165J46597_1000986
527 rootH1_10014099
528 rootH2_10001334
529 rootH2_10005669
530 rootH2_10043027
531 rootH1_10019846
532 rootH1_10034967
533 rootH1_10102515
534 rootH1_10151014
535 rootH1_10171706
536 rootH1_10212301
537 JGI25160J50197_1023237
538 Ga0065714_10004780
539 Ga0065714_10067106
540 Ga0065714_10067656
541 Ga0065704_10000206
542 Ga0065704_10082026
543 Ga0065704_10091660
544 Ga0070658_11130154
545 Ga0070676_10000038
546 Ga0070676_10212667
547 Ga0070670_101110436
548 Ga0070677_10007101
549 Ga0070677_10092885
550 Ga0070677_10157921
551 Ga0068869_100051735
552 Ga0068869_100175713
553 Ga0068869_100346440
554 Ga0068869_100464147
555 Ga0070680_101218890
556 Ga0070682_100118083
557 Ga0070682_100198868
558 Ga0070682_100207926
559 Ga0068868_100022783
560 Ga0068868_100060510
561 Ga0068868_100870631
562 Ga0068868_101386968
563 Ga0070660_100716893
564 Ga0070660_101208148
565 Ga0070689_100001360
566 Ga0070689_100445702
567 Ga0070689_101694797
568 Ga0070687_101521254
569 Ga0070692_10579952
570 Ga0070668_101086250
571 Ga0070675_100033580
572 Ga0070675_100076729
573 Ga0070671_101448791
574 Ga0070674_101391646
575 Ga0070673_100005489
576 Ga0070673_100013174
577 Ga0070673_100107792
578 Ga0070673_100472041
579 Ga0070673_101203367
580 Ga0070688_100170337
581 Ga0070659_100058210
582 Ga0070659_100225065
583 Ga0070659_100290725
584 Ga0070667_100285449
585 Ga0070667_100478753
586 Ga0070667_100644843
587 Ga0070701_10072716
588 Ga0070701_10289518
589 Ga0070705_100119788
590 Ga0070700_100012357
591 Ga0070700_100114145
592 Ga0070700_100129349
593 Ga0070694_100020137
594 Ga0070708_101402290
595 Ga0070663_100244012
596 Ga0070663_100800200
597 Ga0070663_101461329
598 Ga0070678_100010849
599 Ga0070678_100158748
600 Ga0070662_100001815
601 Ga0070662_100239675
602 Ga0068867_100001131
603 Ga0068867_100196363
604 Ga0068867_101546372
605 Ga0070685_10119570
606 Ga0070706_100761445
607 Ga0070679_100123436
608 Ga0068853_100005741
609 Ga0068853_100014308
610 Ga0070672_100008364
611 Ga0070672_100014133
612 Ga0070672_100024627
613 Ga0070672_100562098
614 Ga0070686_100012880
615 Ga0070686_100070339
616 Ga0070696_100512923
617 Ga0070665_100000003
618 Ga0070665_100004183
619 Ga0070665_100045780
620 Ga0070665_101789179
621 Ga0070704_100055524
622 Ga0068855_100093279
623 Ga0068857_100100807
624 Ga0068857_100575848
625 Ga0068857_100739033
626 Ga0068854_100007939
627 Ga0068854_100337845
628 Ga0070702_100002604
629 Ga0070702_100473245
630 Ga0070702_101047303
631 Ga0068852_100003080
632 Ga0068852_102725898
633 Ga0068859_100415133
634 Ga0068859_100471362
635 Ga0068859_101378952
636 Ga0068864_100066841
637 Ga0068864_100269084
638 Ga0068866_10194968
639 Ga0068866_10703256
640 Ga0068861_100001702
641 Ga0068861_100489280
642 Ga0068861_100578262
643 Ga0068861_100911922
644 Ga0068851_10076139
645 Ga0068870_10199152
646 Ga0068870_10694401
647 Ga0068863_100030783
648 Ga0068863_100031893
649 Ga0068863_100100494
650 Ga0068863_100126608
651 Ga0068863_100318144
652 Ga0068858_100573424
653 Ga0068860_100016428
654 Ga0068862_100192033
655 Ga0068862_100788459
656 Ga0068862_101555768
657 Ga0081455_10008486
658 Ga0081539_10045722
659 Ga0075366_10039629
660 Ga0097621_100000241
661 Ga0097621_100007161
662 Ga0097621_100249875
663 Ga0097621_100306216
664 Ga0097621_100546284
665 Ga0075370_10105063
666 Ga0068871_100000139
667 Ga0068871_100005168
668 Ga0068871_100095215
669 Ga0068871_100214621
670 Ga0068871_100302717
671 Ga0068865_100000022
672 Ga0068865_100095989
673 Ga0068865_100188664
674 Ga0068865_100390922
675 Ga0068865_100415123
676 Ga0097620_100415137
677 Ga0097620_100471371
678 Ga0097620_101379020
679 Ga0105240_10002937
680 Ga0105240_10191238
681 Ga0105240_10285700
682 Ga0105240_11011463
683 Ga0111539_10151273
684 Ga0105243_10722464
685 Ga0105243_10934707
686 Ga0105243_11819434
687 Ga0105241_10003917
688 Ga0105241_10023343
689 Ga0105241_10572900
690 Ga0105242_10630658
691 Ga0105248_10374852
692 Ga0105237_10001288
693 Ga0105237_10005068
694 Ga0105237_10009241
695 Ga0105237_10106320
696 Ga0105237_10386798
697 Ga0105237_10498398
698 Ga0105238_10151108
699 Ga0105249_11684210
700 Ga0105029_120845
701 Ga0105239_10000032
702 Ga0105239_10039114
703 Ga0105239_10174303
704 Ga0105239_10441269
705 Ga0105239_10880449
706 Ga0105246_10045963
707 Ga0157373_10010741
708 Ga0157373_10071102
709 Ga0157373_10127676
710 Ga0157371_10002786
711 Ga0157371_10043019
712 Ga0157371_10251402
713 Ga0157370_10007087
714 Ga0157370_10380107
715 Ga0157370_10552733
716 Ga0157370_10585017
717 Ga0157369_10019092
718 Ga0157369_10444731
719 Ga0157369_10665812
720 Ga0157369_11273724
721 Ga0157374_10000130
722 Ga0157374_10060401
723 Ga0157378_10105405
724 Ga0157378_10689816
725 Ga0163162_10000064
726 Ga0163162_10003444
727 Ga0163162_10352434
728 Ga0157372_10061667
729 Ga0157372_10317984
730 Ga0157375_10101297
731 Ga0157375_10202985
732 Ga0157375_10431855
733 Ga0157375_10688769
734 Ga0163163_10870143
735 Ga0157380_10017505
736 Ga0157380_10048612
737 Ga0157380_10081204
738 Ga0157380_10175881
739 Ga0157380_10246520
740 Ga0157380_10468604
741 Ga0157380_11606036
742 Ga0182008_10000020
743 Ga0182008_10005357
744 Ga0182008_10020505
745 Ga0182008_10036058
746 Ga0182008_10039454
747 Ga0182008_10197340
748 Ga0157377_10140932
749 Ga0157376_10046409
750 Ga0182006_1000239
751 Ga0182006_1003612
752 Ga0182007_10305702
753 Ga0163161_10003277
754 Ga0163161_10198995
755 Ga0163161_11699767
756 Ga0209436_104698
757 Ga0207427_100090
758 Ga0209437_100034
759 Ga0209437_100134
760 Ga0209233_1000038
761 Ga0209130_1001120
762 Ga0207426_1000448
763 Ga0207656_10465616
764 Ga0207682_10007435
765 Ga0207682_10125279
766 Ga0207642_10539840
767 Ga0207647_10000093
768 Ga0207647_10052413
769 Ga0207647_10369005
770 Ga0207645_10009130
771 Ga0207643_10013128
772 Ga0207654_10005865
773 Ga0207654_10063710
774 Ga0207695_10001318
775 Ga0207695_10002972
776 Ga0207695_10631165
777 Ga0207695_11326607
778 Ga0207671_10004213
779 Ga0207671_10009633
780 Ga0207671_10032837
781 Ga0207652_10254188
782 Ga0207681_10054233
783 Ga0207681_10387356
784 Ga0207694_10071222
785 Ga0207650_10833106
786 Ga0207659_10019980
787 Ga0207659_10030229
788 Ga0207690_10040030
789 Ga0207706_10000725
790 Ga0207706_10308040
791 Ga0207686_10068652
792 Ga0207670_10012031
793 Ga0207670_10098731
794 Ga0207670_11486672
795 Ga0207669_10007115
796 Ga0207669_10156778
797 Ga0207669_10226695
798 Ga0207669_11947634
799 Ga0207704_10000011
800 Ga0207704_10105378
801 Ga0207704_10311858
802 Ga0207691_10002967
803 Ga0207691_10010518
804 Ga0207691_10606341
805 Ga0207689_10084970
806 Ga0207689_10352913
807 Ga0207689_10605256
808 Ga0207689_10835150
809 Ga0207689_11189510
810 Ga0207689_11563920
811 Ga0207667_10012796
812 Ga0207651_10403635
813 Ga0207651_10695268
814 Ga0207651_11375468
815 Ga0207668_10070557
816 Ga0207640_10014994
817 Ga0207640_10315792
818 Ga0207640_11693400
819 Ga0207658_10235434
820 Ga0207658_10996098
821 Ga0207658_10997577
822 Ga0207677_10013300
823 Ga0207677_10036451
824 Ga0207677_10800268
825 Ga0207677_11104355
826 Ga0207703_10446160
827 Ga0207639_10090833
828 Ga0207678_10290369
829 Ga0207678_10378791
830 Ga0207678_10931399
831 Ga0207708_10050713
832 Ga0207708_10063373
833 Ga0207641_10022428
834 Ga0207641_10075139
835 Ga0207641_10265781
836 Ga0207641_10485534
837 Ga0207648_10003739
838 Ga0207648_10340265
839 Ga0207648_10916975
840 Ga0207676_10026999
841 Ga0207674_10082021
842 Ga0207674_10586144
843 Ga0207675_100001965
844 Ga0207675_100019691
845 Ga0207675_100029359
846 Ga0207675_100089806
847 Ga0207675_100217974
848 Ga0207675_100687066
849 Ga0207675_101154541
850 Ga0207683_10002906
851 Ga0207683_10022918
852 Ga0207698_10001661
853 Ga0207698_11615729
854 Ga0268266_10000078
855 Ga0268266_10003252
856 Ga0268266_10054598
857 Ga0268266_11533004
858 Ga0268265_10026859
859 Ga0268265_11446232
860 Ga0268264_10160550
861 Ga0268264_12084851
862 Ga0307517_10001632
863 Ga0307517_10004342
864 Ga0316182_1265555
865 Ga0316182_1449594
866 Ga0307513_10011365
867 Ga0307513_10014812
868 Ga0307513_10135946
869 Ga0307513_10142731
870 Ga0307513_10201759
871 Ga0307509_10087205
872 Ga0307408_100103850
873 Ga0307408_101234606
874 Ga0307408_101788601
875 Ga0307516_10003109
876 Ga0307405_10950629
877 Ga0307410_10055797
878 Ga0307410_10141185
879 Ga0307406_10859331
880 Ga0307406_11661289
881 Ga0307412_10000001
882 Ga0307412_10466713
883 Ga0307412_10565317
884 Ga0307412_10619596
885 Ga0307412_10728340
886 Ga0307409_100076510
887 Ga0307409_100475093
888 Ga0307409_100682154
889 Ga0307416_100024344
890 Ga0307416_100037488
891 Ga0307416_101606709
892 Ga0307414_10040203
893 Ga0307414_10043970
894 Ga0307414_10133116
895 Ga0307414_10402531
896 Ga0307411_10027630
897 Ga0307411_10578508
898 Ga0307415_100224934
899 Ga0307415_100689131
900 Ga0307510_10008251
901 Ga0373941_0247168
902 Ga0373937_0358395
903 Ga0395900_0000014
904 Ga0395898_0002626
905 Ga0395905_0000037
906 Ga0395901_0000117
907 Ga0439465_0001425
908 Ga0451793_0446017
909 Ga0451802_1890635
910 Ga0451807_0204085
911 Ga0451807_1195179
912 Ga0451807_1250729
913 Ga0451843_1108106
914 Ga0451853_3169696
915 Ga0439445_0064864
916 Ga0439448_0001474
917 Ga0439432_091729
918 Ga0439449_0000016
919 Ga0450917_011810
920 Ga0439464_0188827
921 Ga0451577_0060031
922 Ga0466972_0065633
923 Ga0453683_0258596
924 Ga0453684_0003109
925 Ga0466959_0025719
926 Ga0451576_0011029
927 Ga0495617_080551
928 Ga0495638_0043874
929 Ga0495650_0000081
930 Ga0495596_0208948
931 Ga0495596_0385500
932 Ga0495583_0116762
933 Ga0495606_0000034
934 Ga0495606_0036712
935 Ga0495606_0044211
936 Ga0495606_0361784
937 Ga0495610_0001393
938 Ga0495610_0102831
939 Ga0495616_0007814
940 Ga0495616_0052646
941 Ga0495620_0231796
942 Ga0495620_0248918
943 Ga0495620_0425802
944 Ga0495631_0040351
945 Ga0495648_0032109
946 Ga0495652_0222908
947 Ga0495609_0010061
948 Ga0495633_0004766
949 Ga0495668_0069228
950 Ga0495668_0611848
951 Ga0495625_0000049
952 Ga0495625_0002768
953 Ga0495625_0008211
954 Ga0495625_0019211
955 Ga0495625_0037016
956 Ga0495625_0119759
957 Ga0495625_0144268
958 Ga0495625_0291084
959 Ga0495661_0003920
960 Ga0495661_0314394
961 Ga0495671_0114641
962 Ga0495649_0000014
963 Ga0495649_0002042
964 Ga0495649_0174989
965 Ga0495660_0035685
966 Ga0495683_0087032
967 Ga0495687_000793
968 Ga0495687_005676
969 Ga0495687_031241
970 Ga0495677_0063255
971 Ga0495679_034182
972 Ga0495685_048426
973 Ga0495673_0021652
974 Ga0495686_0026682
975 Ga0495686_0064223
976 Ga0495686_0075395
977 Ga0496122_0002408
978 Ga0496122_0003882
979 Ga0496123_0002515
980 Ga0496123_0140654
981 Ga0496125_0086301
982 Ga0496126_0029181
983 Ga0501309_011617
984 Ga0495678_026771
985 Ga0495682_0031081
986 Ga0501298_032076
987 Ga0501323_006411
988 Ga0501068_0471434
989 Ga0501070_0354308
990 Ga0501071_0131529
991 Ga0501073_0117059
992 Ga0501076_0022985
993 Ga0501077_0299494
994 Ga0501233_126182
995 Ga0501236_001154
996 Ga0501257_001504
997 Ga0501079_0005024
998 Ga0501080_0007110
999 Ga0501083_0045694
1000 Ga0501241_033108
1001 Ga0501264_000088
1002 nmdc:mga0k408_25586_c1
1003 nmdc:mga08y16_941631_c1
1004 Ga0495655_0244289
1005 Ga0500644_0004303
1006 Ga0500644_0052211
1007 Ga0500651_0000130
1008 Ga0500650_0207432
1009 Ga0500650_0310761
1010 Ga0500608_003331
1011 Ga0500618_000079
1012 Ga0500628_011744
1013 Ga0500564_190748
1014 Ga0500568_0039098
1015 Ga0500568_0044209
1016 Ga0500616_0214261
1017 Ga0500622_0019552
1018 Ga0500611_064269
1019 Ga0501084_0546538
1020 Ga0590074_088376
1021 Ga0501082_0075842
1022 2599481602
1023 2738761405
1024 2776615985
1025 2819680378
1026 2852688696
1027 2896089838
1028 2928083166
1029 2928152990
1030 2929182665
1031 2929195486
1032 2932086633
1033 2945978591
1034 2946015546

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

55

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bn7-assembly1.cif.gz_A-2 crystal structure of a dimeric ferredoxin-like protein (cc_2267) from caulobacter crescentus cb15 at 1.64 a resolution 0.9562 36 135
3bn7-assembly1.cif.gz_A-2 crystal structure of a dimeric ferredoxin-like protein (cc_2267) from caulobacter crescentus cb15 at 1.64 a resolution 0.9292 36 135
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.863 36 135
5b0b-assembly2.cif.gz_D polyketide cyclase oac from cannabis sativa, i7f mutant 0.8437 36 135
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.8374 36 135
ID Description Score Start End Superfamily
3bn7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9583 36 132 3.30.70.100
3bn7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9211 36 132 3.30.70.100
af_I1LY42_1_101_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8449 36 132 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8437 36 135 3.30.70.100
af_Q9SYD8_1_102_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8254 36 133 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3M9NEI3-F1-model_v4 Dabb family protein 0.962 36 134
AF-A0A4Q5YUW8-F1-model_v4 Dabb family protein 0.9619 36 134
AF-A0A2W6T1F3-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein 0.9569 37 135
AF-A0A258D1E3-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein 0.9561 36 135
AF-A0A0D3LL30-F1-model_v4 Stress responsive alpha-beta barrel domain-containing protein 0.9497 36 134

Map