F458264

General Info

Members Datasets Scaffolds Average Seq Length
518 302 1036 160

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10046379|Ga0207689_100463795
Length 184
Sequence MDSPKHQLSMTVLMTPDMANFSGNVHGGTILKLLDQVAYACAARYAGRYVVTLSVDQVMFREPIHVGELVTFLASVNHTGTSSMEVGIKVLAEEIRTQRTRHANSCFFTMVAVGDDRKPVAVPPLEPKTADERRRHQMAELRRGLRSDYRARYEALRPQTEGDDGGGPASSGATSRAWIFRGCE

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
192 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
193 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
202 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
203 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
249 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
270 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
273 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
274 2547132512 Azospira oryzae 6a3 Isolate Unclassified
275 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
276 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
277 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
278 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
279 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
280 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
281 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
282 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
283 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
284 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
285 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
286 2721755523 Delftia sp. HK171 Isolate Unclassified
287 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
288 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
289 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
290 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
291 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
292 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
293 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
294 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
295 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
296 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
297 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
298 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
299 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
300 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
301 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
302 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 0
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.2
Nodule 1.35
Rhizoplane 4.63
Rhizosphere 59.46
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10046379 3300025942 Bacteria 3592
2 JGI24740J21852_10013376 3300001979 Bacteria 3062
3 JGI25156J39149_1000175 3300002705 Bacteria 47051
4 JGI25156J39149_1017682 3300002705 Bacteria 1342
5 JGI25154J39366_1003891 3300002738 Bacteria 2901
6 JGI25157J39369_1000029 3300002741 Bacteria 146928
7 JGI25157J39369_1030130 3300002741 Bacteria 620
8 JGI25150J39212_1011329 3300002774 Bacteria 1621
9 JGI25153J46596_10001167 3300003215 Bacteria 15888
10 rootH1_10080354 3300003316 Bacteria 1500
11 rootH2_10050886 3300003320 Bacteria 3952
12 rootH1_10069326 3300003323 Bacteria 5218
13 rootH1_10069327 3300003323 Bacteria 2116
14 rootH1_10146338 3300003323 Bacteria 1916
15 Ga0055539_1000310 3300003752 Bacteria 25571
16 Ga0055539_1001425 3300003752 Bacteria 4480
17 Ga0055533_1000010 3300003756 Bacteria 491196
18 Ga0055533_1002953 3300003756 Bacteria 3647
19 Ga0055525_1000841 3300003759 Bacteria 9168
20 Ga0055525_1001256 3300003759 Bacteria 5371
21 Ga0055535_1000107 3300003761 Bacteria 89840
22 Ga0055529_1000111 3300003763 Bacteria 118734
23 Ga0055526_1003406 3300003771 Bacteria 10118
24 Ga0055524_1000203 3300003775 Bacteria 64635
25 Ga0055524_1001287 3300003775 Bacteria 14709
26 Ga0055534_1039687 3300003784 Bacteria 696
27 Ga0055528_1055169 3300003790 Bacteria 778
28 Ga0055530_10002154 3300003791 Bacteria 13044
29 Ga0055530_10016194 3300003791 Bacteria 2393
30 Ga0055540_1000357 3300003792 Bacteria 38830
31 Ga0055540_1067132 3300003792 Bacteria 706
32 Ga0055531_10020200 3300003794 Bacteria 2649
33 Ga0065165_1004882 3300005262 Bacteria 7926
34 Ga0070658_10360177 3300005327 Bacteria 1245
35 Ga0070658_10949865 3300005327 Bacteria 747
36 Ga0070676_10113727 3300005328 Bacteria 1689
37 Ga0070683_100031612 3300005329 Bacteria 4815
38 Ga0070683_100185442 3300005329 Bacteria 1975
39 Ga0070690_100028351 3300005330 Bacteria 3468
40 Ga0070690_100076543 3300005330 Bacteria 2183
41 Ga0068869_100717182 3300005334 Bacteria 854
42 Ga0070666_10257766 3300005335 Bacteria 1236
43 Ga0070682_100240103 3300005337 Bacteria 1300
44 Ga0068868_100051368 3300005338 Bacteria 3242
45 Ga0070660_100590586 3300005339 Bacteria 928
46 Ga0070661_100000791 3300005344 Bacteria 22707
47 Ga0070661_100652200 3300005344 Bacteria 854
48 Ga0070692_11058285 3300005345 Bacteria 570
49 Ga0070669_100160714 3300005353 Bacteria 1745
50 Ga0070669_100488820 3300005353 Bacteria 1019
51 Ga0070675_100359590 3300005354 Unclassified 1292
52 Ga0070675_100402339 3300005354 Bacteria 1221
53 Ga0070675_101491114 3300005354 Bacteria 624
54 Ga0070671_100440262 3300005355 Bacteria 1117
55 Ga0070671_100697307 3300005355 Bacteria 880
56 Ga0070674_100020018 3300005356 Bacteria 4264
57 Ga0070674_100251433 3300005356 Bacteria 1388
58 Ga0070674_100371407 3300005356 Bacteria 1161
59 Ga0070673_100313794 3300005364 Bacteria 1383
60 Ga0070688_100088709 3300005365 Bacteria 2017
61 Ga0070659_100009555 3300005366 Bacteria 7126
62 Ga0070659_100412922 3300005366 Bacteria 1141
63 Ga0070659_100610760 3300005366 Bacteria 938
64 Ga0070667_100077442 3300005367 Bacteria 2840
65 Ga0070667_100425228 3300005367 Bacteria 1211
66 Ga0070700_100758800 3300005441 Bacteria 777
67 Ga0070678_100123617 3300005456 Bacteria 2045
68 Ga0070662_100025445 3300005457 Bacteria 4087
69 Ga0070662_100148878 3300005457 Bacteria 1820
70 Ga0068867_100015012 3300005459 Bacteria 5492
71 Ga0068867_100142047 3300005459 Bacteria 1878
72 Ga0068867_100532565 3300005459 Bacteria 1015
73 Ga0068867_100792537 3300005459 Bacteria 844
74 Ga0068867_101086486 3300005459 Bacteria 730
75 Ga0070672_100046173 3300005543 Bacteria 3374
76 Ga0070672_100114802 3300005543 Bacteria 2199
77 Ga0070672_100398261 3300005543 Bacteria 1180
78 Ga0070672_100425818 3300005543 Bacteria 1141
79 Ga0070672_100646470 3300005543 Bacteria 923
80 Ga0070672_100860554 3300005543 Bacteria 799
81 Ga0070672_101103592 3300005543 Bacteria 705
82 Ga0070665_100802047 3300005548 Bacteria 955
83 Ga0068855_100052867 3300005563 Bacteria 4780
84 Ga0068855_100170534 3300005563 Bacteria 2465
85 Ga0070664_100000524 3300005564 Bacteria 29185
86 Ga0070664_100005230 3300005564 Bacteria 10411
87 Ga0070664_100024941 3300005564 Bacteria 4955
88 Ga0070664_100253896 3300005564 Bacteria 1581
89 Ga0070664_100336369 3300005564 Unclassified 1370
90 Ga0070664_100765674 3300005564 Bacteria 902
91 Ga0068857_100002542 3300005577 Bacteria 14936
92 Ga0068857_100098356 3300005577 Bacteria 2624
93 Ga0068857_100292624 3300005577 Bacteria 1500
94 Ga0068857_100548702 3300005577 Bacteria 1089
95 Ga0068857_100911846 3300005577 Bacteria 843
96 Ga0068854_100012169 3300005578 Bacteria 5630
97 Ga0068854_100041829 3300005578 Bacteria 3240
98 Ga0068854_100265671 3300005578 Bacteria 1376
99 Ga0068856_100003174 3300005614 Bacteria 16729
100 Ga0068856_100124594 3300005614 Bacteria 2579
101 Ga0068852_100103368 3300005616 Bacteria 2576
102 Ga0068852_100400552 3300005616 Bacteria 1350
103 Ga0068852_101304312 3300005616 Bacteria 748
104 Ga0068859_100004121 3300005617 Bacteria 14826
105 Ga0068859_100324312 3300005617 Bacteria 1634
106 Ga0068864_100008613 3300005618 Bacteria 8417
107 Ga0068864_100772751 3300005618 Unclassified 942
108 Ga0068861_100024717 3300005719 Bacteria 4347
109 Ga0068861_100181271 3300005719 Bacteria 1753
110 Ga0068851_10032475 3300005834 Bacteria 2597
111 Ga0068851_10153541 3300005834 Bacteria 1260
112 Ga0068863_100003333 3300005841 Bacteria 15866
113 Ga0068863_101140764 3300005841 Bacteria 785
114 Ga0068858_100490354 3300005842 Bacteria 1186
115 Ga0068860_100478602 3300005843 Bacteria 1241
116 Ga0075363_100014012 3300006048 Bacteria 3905
117 Ga0075363_100229064 3300006048 Bacteria 1066
118 Ga0075363_100363855 3300006048 Bacteria 846
119 Ga0075364_10124488 3300006051 Bacteria 1727
120 Ga0075364_10237150 3300006051 Bacteria 1239
121 Ga0075362_10016150 3300006177 Bacteria 3052
122 Ga0075362_10126565 3300006177 Bacteria 1212
123 Ga0075362_10130281 3300006177 Bacteria 1196
124 Ga0075362_10191718 3300006177 Bacteria 993
125 Ga0075362_10657083 3300006177 Bacteria 545
126 Ga0075367_10005093 3300006178 Bacteria 6487
127 Ga0075367_10021656 3300006178 Bacteria 3595
128 Ga0075367_10044931 3300006178 Bacteria 2591
129 Ga0075367_10050777 3300006178 Bacteria 2449
130 Ga0075367_10219474 3300006178 Bacteria 1190
131 Ga0075369_10022437 3300006186 Bacteria 2603
132 Ga0075369_10026047 3300006186 Bacteria 2435
133 Ga0075366_10004401 3300006195 Bacteria 7560
134 Ga0075366_10023724 3300006195 Bacteria 3574
135 Ga0075366_10029363 3300006195 Bacteria 3231
136 Ga0075366_10140195 3300006195 Bacteria 1461
137 Ga0075366_10212147 3300006195 Bacteria 1179
138 Ga0075366_10246271 3300006195 Bacteria 1090
139 Ga0097621_100062361 3300006237 Bacteria 3060
140 Ga0097621_100190134 3300006237 Bacteria 1778
141 Ga0075370_10001752 3300006353 Bacteria 9670
142 Ga0075370_10001759 3300006353 Bacteria 9658
143 Ga0075370_10002149 3300006353 Bacteria 9017
144 Ga0068871_101077942 3300006358 Bacteria 750
145 Ga0097620_100004121 3300006931 Bacteria 14826
146 Ga0097620_100324304 3300006931 Bacteria 1634
147 Ga0079104_1000003 3300006946 Bacteria 468966
148 Ga0079104_1000019 3300006946 Bacteria 269313
149 Ga0079104_1007180 3300006946 Bacteria 4080
150 Ga0105240_10009244 3300009093 Bacteria 13982
151 Ga0105240_10055149 3300009093 Bacteria 4977
152 Ga0105245_10814784 3300009098 Bacteria 972
153 Ga0105245_11800124 3300009098 Bacteria 665
154 Ga0105247_10878063 3300009101 Bacteria 691
155 Ga0105243_10150476 3300009148 Bacteria 1996
156 Ga0105243_10188234 3300009148 Bacteria 1801
157 Ga0105243_10328256 3300009148 Bacteria 1397
158 Ga0105241_10250188 3300009174 Bacteria 1502
159 Ga0105242_10014031 3300009176 Bacteria 6201
160 Ga0105242_10351936 3300009176 Bacteria 1361
161 Ga0105242_10994048 3300009176 Bacteria 846
162 Ga0105248_10597143 3300009177 Bacteria 1246
163 Ga0105237_10000076 3300009545 Bacteria 131773
164 Ga0105237_10009537 3300009545 Bacteria 10393
165 Ga0105238_10018911 3300009551 Bacteria 7016
166 Ga0105238_10471484 3300009551 Bacteria 1254
167 Ga0105238_10664400 3300009551 Bacteria 1053
168 Ga0105249_10072528 3300009553 Bacteria 3183
169 Ga0105249_10205158 3300009553 Bacteria 1931
170 Ga0105249_10899282 3300009553 Unclassified 952
171 Ga0105239_10001865 3300010375 Bacteria 27579
172 Ga0105239_10033884 3300010375 Bacteria 5606
173 Ga0105239_11556081 3300010375 Bacteria 764
174 Ga0105246_10481896 3300011119 Bacteria 1049
175 Ga0105246_10843494 3300011119 Bacteria 817
176 Ga0157369_10166927 3300013105 Bacteria 2321
177 Ga0157374_10136911 3300013296 Bacteria 2374
178 Ga0157374_10227796 3300013296 Bacteria 1830
179 Ga0157374_10946261 3300013296 Bacteria 880
180 Ga0157374_11968620 3300013296 Bacteria 610
181 Ga0157378_10042645 3300013297 Bacteria 4027
182 Ga0157378_10329596 3300013297 Bacteria 1485
183 Ga0157378_10508421 3300013297 Bacteria 1204
184 Ga0163162_10006216 3300013306 Bacteria 11572
185 Ga0163162_10434449 3300013306 Bacteria 1445
186 Ga0157372_10018330 3300013307 Bacteria 7524
187 Ga0157375_11193872 3300013308 Unclassified 892
188 Ga0163163_10156395 3300014325 Bacteria 2324
189 Ga0163163_10394924 3300014325 Bacteria 1441
190 Ga0157380_10037473 3300014326 Bacteria 3757
191 Ga0157380_10039918 3300014326 Bacteria 3653
192 Ga0157380_10054689 3300014326 Bacteria 3168
193 Ga0157379_10012758 3300014968 Bacteria 7348
194 Ga0157379_10721818 3300014968 Bacteria 936
195 Ga0157376_11190595 3300014969 Bacteria 790
196 Ga0182007_10049503 3300015262 Bacteria 1388
197 Ga0163161_10068263 3300017792 Bacteria 2597
198 Ga0213872_10021044 3300021361 Bacteria 3003
199 Ga0213872_10091453 3300021361 Bacteria 1361
200 Ga0209674_100003 3300025226 Bacteria 2196646
201 Ga0209674_102655 3300025226 Bacteria 3699
202 Ga0209563_100049 3300025230 Bacteria 358472
203 Ga0209563_102915 3300025230 Bacteria 3699
204 Ga0207427_100158 3300025231 Bacteria 76687
205 Ga0209258_100267 3300025242 Bacteria 89896
206 Ga0209258_100700 3300025242 Bacteria 22801
207 Ga0207425_1000511 3300025245 Bacteria 23911
208 Ga0209026_1000054 3300025250 Bacteria 242508
209 Ga0209026_1003501 3300025250 Bacteria 5110
210 Ga0209677_100050 3300025253 Bacteria 176828
211 Ga0209677_100316 3300025253 Bacteria 31473
212 Ga0209677_104861 3300025253 Bacteria 3699
213 Ga0209148_1001945 3300025254 Bacteria 8369
214 Ga0209759_1000043 3300025256 Bacteria 242513
215 Ga0209759_1000905 3300025256 Bacteria 22093
216 Ga0209759_1007464 3300025256 Bacteria 3513
217 Ga0209129_1000225 3300025258 Bacteria 63564
218 Ga0209565_1029496 3300025263 Bacteria 1077
219 Ga0209455_1000158 3300025272 Bacteria 118973
220 Ga0209673_1020546 3300025273 Bacteria 2336
221 Ga0207673_1037854 3300025290 Bacteria 675
222 Ga0209675_1009271 3300025291 Bacteria 3494
223 Ga0209564_1000196 3300025295 Bacteria 141368
224 Ga0209758_1000181 3300025297 Bacteria 140847
225 Ga0209758_1000207 3300025297 Bacteria 129217
226 Ga0209050_1000703 3300025298 Bacteria 49694
227 Ga0209050_1002192 3300025298 Bacteria 17608
228 Ga0209050_1024764 3300025298 Bacteria 2064
229 Ga0209256_1000024 3300025299 Bacteria 448909
230 Ga0209256_1059323 3300025299 Bacteria 897
231 Ga0209051_1000063 3300025303 Bacteria 249739
232 Ga0209051_1001539 3300025303 Bacteria 19182
233 Ga0209051_1003706 3300025303 Bacteria 9864
234 Ga0209051_1080560 3300025303 Bacteria 941
235 Ga0209257_1000118 3300025304 Bacteria 225963
236 Ga0207697_10023871 3300025315 Bacteria 2504
237 Ga0207656_10137632 3300025321 Bacteria 1149
238 Ga0207642_10136950 3300025899 Bacteria 1285
239 Ga0207680_10481620 3300025903 Bacteria 883
240 Ga0207645_10028011 3300025907 Bacteria 3637
241 Ga0207645_10240763 3300025907 Bacteria 1195
242 Ga0207643_10275534 3300025908 Bacteria 1042
243 Ga0207654_10132356 3300025911 Bacteria 1580
244 Ga0207695_10012360 3300025913 Bacteria 10255
245 Ga0207695_10016652 3300025913 Bacteria 8592
246 Ga0207695_10103587 3300025913 Bacteria 2837
247 Ga0207671_10008561 3300025914 Bacteria 8656
248 Ga0207671_10012329 3300025914 Bacteria 6880
249 Ga0207671_10247304 3300025914 Bacteria 1402
250 Ga0207657_10444599 3300025919 Bacteria 1017
251 Ga0207649_10001484 3300025920 Bacteria 13768
252 Ga0207681_10100757 3300025923 Bacteria 2082
253 Ga0207694_10007192 3300025924 Bacteria 8453
254 Ga0207694_10013700 3300025924 Bacteria 6111
255 Ga0207694_10717196 3300025924 Bacteria 844
256 Ga0207694_10931989 3300025924 Bacteria 735
257 Ga0207650_10032432 3300025925 Bacteria 3778
258 Ga0207650_10193563 3300025925 Bacteria 1626
259 Ga0207659_10002201 3300025926 Bacteria 11590
260 Ga0207687_10261586 3300025927 Bacteria 1379
261 Ga0207687_11192352 3300025927 Bacteria 654
262 Ga0207644_10342600 3300025931 Bacteria 1212
263 Ga0207644_10464266 3300025931 Bacteria 1041
264 Ga0207690_10002792 3300025932 Bacteria 10532
265 Ga0207690_10415501 3300025932 Bacteria 1075
266 Ga0207690_10850972 3300025932 Bacteria 755
267 Ga0207706_10010206 3300025933 Bacteria 8590
268 Ga0207706_10089307 3300025933 Bacteria 2709
269 Ga0207686_10039492 3300025934 Bacteria 2864
270 Ga0207686_10050285 3300025934 Bacteria 2591
271 Ga0207686_10225384 3300025934 Bacteria 1356
272 Ga0207709_10000032 3300025935 Bacteria 324478
273 Ga0207670_10077789 3300025936 Bacteria 2312
274 Ga0207669_10175324 3300025937 Bacteria 1531
275 Ga0207704_10099583 3300025938 Bacteria 1934
276 Ga0207691_10062074 3300025940 Bacteria 3393
277 Ga0207691_10139044 3300025940 Bacteria 2141
278 Ga0207691_10855040 3300025940 Bacteria 763
279 Ga0207689_10291868 3300025942 Bacteria 1351
280 Ga0207689_10977206 3300025942 Bacteria 714
281 Ga0207679_10000220 3300025945 Bacteria 45059
282 Ga0207679_10159795 3300025945 Bacteria 1844
283 Ga0207679_10281383 3300025945 Bacteria 1427
284 Ga0207679_11152859 3300025945 Bacteria 711
285 Ga0207667_10012561 3300025949 Bacteria 9742
286 Ga0207667_11242244 3300025949 Bacteria 723
287 Ga0207651_10500403 3300025960 Bacteria 1050
288 Ga0207668_10103311 3300025972 Bacteria 2122
289 Ga0207640_10323274 3300025981 Bacteria 1229
290 Ga0207658_10010682 3300025986 Bacteria 6242
291 Ga0207677_10004271 3300026023 Bacteria 7644
292 Ga0207703_10001921 3300026035 Bacteria 18419
293 Ga0207639_10096290 3300026041 Bacteria 2381
294 Ga0207639_10135921 3300026041 Bacteria 2041
295 Ga0207639_10279554 3300026041 Bacteria 1467
296 Ga0207639_10479552 3300026041 Bacteria 1133
297 Ga0207678_10088062 3300026067 Bacteria 2654
298 Ga0207678_10094880 3300026067 Bacteria 2549
299 Ga0207678_10147882 3300026067 Bacteria 2005
300 Ga0207702_10011854 3300026078 Bacteria 7255
301 Ga0207641_10011803 3300026088 Bacteria 7171
302 Ga0207648_10004326 3300026089 Bacteria 14627
303 Ga0207648_10013067 3300026089 Bacteria 7741
304 Ga0207648_10020746 3300026089 Bacteria 5915
305 Ga0207648_10037429 3300026089 Bacteria 4273
306 Ga0207648_10066241 3300026089 Bacteria 3150
307 Ga0207648_10844105 3300026089 Bacteria 854
308 Ga0207648_10992028 3300026089 Bacteria 786
309 Ga0207676_10061518 3300026095 Bacteria 2973
310 Ga0207674_10263634 3300026116 Bacteria 1670
311 Ga0207674_10310415 3300026116 Bacteria 1526
312 Ga0207674_10675043 3300026116 Bacteria 998
313 Ga0207675_100080990 3300026118 Bacteria 3044
314 Ga0207675_100089778 3300026118 Bacteria 2888
315 Ga0207698_10223969 3300026142 Bacteria 1702
316 Ga0207698_10612312 3300026142 Bacteria 1075
317 Ga0209281_1000002 3300027111 Bacteria 1924012
318 Ga0209281_1000149 3300027111 Bacteria 167880
319 Ga0268266_10637737 3300028379 Bacteria 1025
320 Ga0268265_10296442 3300028380 Bacteria 1454
321 Ga0268265_11040464 3300028380 Bacteria 810
322 Ga0268264_10260997 3300028381 Bacteria 1614
323 Ga0307517_10093811 3300028786 Bacteria 2430
324 Ga0307517_10418407 3300028786 Bacteria 704
325 Ga0307515_10000013 3300028794 Bacteria 568456
326 Ga0307515_10000109 3300028794 Bacteria 195895
327 Ga0307515_10002637 3300028794 Bacteria 38528
328 Ga0307515_10010767 3300028794 Bacteria 17455
329 Ga0307515_10062490 3300028794 Bacteria 5256
330 Ga0307515_10086733 3300028794 Bacteria 3986
331 Ga0307515_10405603 3300028794 Bacteria 987
332 Ga0265324_10021680 3300029957 Bacteria 2302
333 Ga0307512_10071793 3300030522 Bacteria 2567
334 Ga0265332_10000030 3300031238 Bacteria 175141
335 Ga0265327_10096503 3300031251 Bacteria 1433
336 Ga0307513_10000990 3300031456 Bacteria 41065
337 Ga0307513_10083360 3300031456 Bacteria 3288
338 Ga0307513_10362251 3300031456 Bacteria 1194
339 Ga0307513_10397742 3300031456 Bacteria 1113
340 Ga0307509_10043209 3300031507 Bacteria 4878
341 Ga0307509_10072228 3300031507 Bacteria 3596
342 Ga0307509_10167717 3300031507 Bacteria 2081
343 Ga0307509_10218829 3300031507 Bacteria 1720
344 Ga0307408_100000028 3300031548 Bacteria 233440
345 Ga0307408_100055431 3300031548 Bacteria 2870
346 Ga0307508_10000101 3300031616 Bacteria 100858
347 Ga0307514_10000533 3300031649 Bacteria 74078
348 Ga0307514_10008985 3300031649 Bacteria 8442
349 Ga0307516_10000193 3300031730 Bacteria 78825
350 Ga0307516_10001515 3300031730 Bacteria 31972
351 Ga0307516_10002784 3300031730 Bacteria 23086
352 Ga0307516_10011646 3300031730 Bacteria 9543
353 Ga0307516_10015133 3300031730 Bacteria 8127
354 Ga0307405_10124709 3300031731 Bacteria 1769
355 Ga0307412_10052632 3300031911 Bacteria 2697
356 Ga0307414_10105953 3300032004 Bacteria 2127
357 Ga0307507_10063204 3300033179 Bacteria 3430
358 Ga0307507_10081775 3300033179 Bacteria 2837
359 Ga0373931_0015905 3300035691 Bacteria 3695
360 Ga0373931_0234204 3300035691 Bacteria 1111
361 Ga0373925_0156871 3300037068 Bacteria 1790
362 Ga0395899_0335003 3300037312 Bacteria 1016
363 Ga0395900_1074324 3300037418 Bacteria 723
364 Ga0395905_0021000 3300037471 Bacteria 6182
365 Ga0395905_0535442 3300037471 Bacteria 1072
366 Ga0395905_0885749 3300037471 Bacteria 796
367 Ga0395901_0002847 3300038443 Bacteria 17464
368 Ga0436361_0256361 3300039447 Bacteria 5094
369 Ga0439466_0194917 3300041411 Bacteria 617
370 Ga0451791_1934572 3300041451 Bacteria 1328
371 Ga0451793_0125591 3300041452 Bacteria 1185
372 Ga0451793_1753075 3300041452 Bacteria 700
373 Ga0451797_0545602 3300041453 Bacteria 906
374 Ga0451795_0646682 3300041456 Bacteria 566
375 Ga0451795_1537189 3300041456 Bacteria 2196
376 Ga0451798_0706099 3300041458 Bacteria 867
377 Ga0451800_1243688 3300041459 Bacteria 631
378 Ga0451800_1338090 3300041459 Bacteria 2068
379 Ga0451800_1496088 3300041459 Bacteria 834
380 Ga0451802_0277119 3300041460 Bacteria 1352
381 Ga0451804_0771933 3300041463 Bacteria 1272
382 Ga0451807_2456877 3300041486 Bacteria 2036
383 Ga0451849_0711165 3300041505 Bacteria 1469
384 Ga0451853_0606631 3300041512 Bacteria 1830
385 Ga0439431_0003056 3300041997 Bacteria 3673
386 Ga0439462_0134718 3300042015 Bacteria 691
387 Ga0450919_000730 3300042121 Bacteria 4162
388 Ga0450908_026940 3300042184 Bacteria 1003
389 Ga0450918_001092 3300042531 Bacteria 5589
390 Ga0451577_0003346 3300042876 Bacteria 17953
391 Ga0451577_0189917 3300042876 Bacteria 1853
392 Ga0466969_0013679 3300044656 Bacteria 4270
393 Ga0466965_0001496 3300044683 Bacteria 9471
394 Ga0466966_0011578 3300044684 Bacteria 5848
395 Ga0466961_0047056 3300044693 Bacteria 2758
396 Ga0466964_0030855 3300044706 Bacteria 2123
397 Ga0453684_0014644 3300044712 Bacteria 12518
398 Ga0453684_0263474 3300044712 Bacteria 1973
399 Ga0453684_0375708 3300044712 Bacteria 1597
400 Ga0466971_0006274 3300044719 Bacteria 5162
401 Ga0466957_0052177 3300044842 Bacteria 2490
402 Ga0466957_0110699 3300044842 Bacteria 1741
403 Ga0466957_0303550 3300044842 Bacteria 1073
404 Ga0466959_0021762 3300045049 Bacteria 4733
405 Ga0466958_0119727 3300045836 Bacteria 1647
406 Ga0466967_0374944 3300045976 Bacteria 1381
407 Ga0466967_1304451 3300045976 Bacteria 723
408 Ga0495639_0025341 3300046475 Bacteria 2615
409 Ga0495639_0093229 3300046475 Bacteria 1415
410 Ga0495585_0009167 3300046492 Bacteria 5955
411 Ga0495585_0070688 3300046492 Bacteria 1903
412 Ga0495610_0222178 3300046512 Bacteria 762
413 Ga0495620_0276536 3300046515 Bacteria 639
414 Ga0495628_0168006 3300046516 Bacteria 1664
415 Ga0495632_0001710 3300046519 Bacteria 17844
416 Ga0495632_0107519 3300046519 Bacteria 1311
417 Ga0495643_0084198 3300046522 Bacteria 1650
418 Ga0495652_0001279 3300046529 Bacteria 28174
419 Ga0495652_0427474 3300046529 Bacteria 932
420 Ga0495652_0565654 3300046529 Bacteria 780
421 Ga0495621_0437344 3300046539 Bacteria 558
422 Ga0495645_0012072 3300046543 Bacteria 6087
423 Ga0495633_0417865 3300046558 Bacteria 606
424 Ga0495611_0166214 3300046648 Bacteria 1031
425 Ga0495625_0012039 3300046660 Bacteria 7020
426 Ga0495588_0028282 3300046674 Bacteria 2804
427 Ga0495646_0000288 3300046680 Bacteria 25753
428 Ga0495658_0240542 3300046683 Bacteria 1137
429 Ga0495604_0967518 3300047317 Bacteria 528
430 Ga0495686_0242602 3300047472 Bacteria 1015
431 Ga0495626_0275893 3300048091 Bacteria 669
432 Ga0496103_0021982 3300048906 Bacteria 3839
433 Ga0496104_0400250 3300048907 Bacteria 1285
434 Ga0496104_0613210 3300048907 Bacteria 998
435 Ga0496105_0549749 3300048908 Bacteria 901
436 Ga0496107_0428110 3300048910 Bacteria 984
437 Ga0496108_1350970 3300048911 Bacteria 598
438 Ga0496109_0034703 3300048912 Bacteria 4546
439 Ga0496114_0070795 3300048917 Bacteria 2930
440 Ga0496114_0101077 3300048917 Bacteria 2461
441 Ga0496121_0046103 3300048924 Bacteria 3735
442 Ga0496123_0143219 3300048926 Bacteria 1303
443 Ga0496124_0000089 3300048927 Bacteria 192423
444 Ga0496125_0007669 3300048928 Bacteria 11438
445 Ga0496125_0079099 3300048928 Bacteria 2524
446 Ga0496126_0011097 3300048929 Bacteria 9361
447 Ga0501198_000318 3300049649 Bacteria 6101
448 Ga0501222_000134 3300049662 Bacteria 15759
449 nmdc:mga03683_127687_c1 3300050489 Bacteria 1135
450 nmdc:mga03683_213856_c1 3300050489 Bacteria 888
451 nmdc:mga03n38_140075_c1 3300050490 Bacteria 1207
452 nmdc:mga03n38_609588_c1 3300050490 Bacteria 622
453 nmdc:mga00v17_341302_c1 3300050491 Bacteria 974
454 nmdc:mga00v17_86973_c1 3300050491 Bacteria 1959
455 nmdc:mga0k408_203324_c1 3300050493 Bacteria 1182
456 nmdc:mga0k408_24788_c1 3300050493 Bacteria 3394
457 nmdc:mga0k408_321586_c1 3300050493 Bacteria 923
458 nmdc:mga0k408_36268_c1 3300050493 Bacteria 2830
459 nmdc:mga0k408_36991_c1 3300050493 Bacteria 2801
460 nmdc:mga0k408_3802_c1 3300050493 Bacteria 8000
461 nmdc:mga0k408_504_c1 3300050493 Bacteria 21443
462 nmdc:mga06z11_511544_c1 3300050494 Bacteria 728
463 nmdc:mga06z11_746691_c1 3300050494 Bacteria 596
464 nmdc:mga06z11_86510_c1 3300050494 Bacteria 1693
465 nmdc:mga06z11_92414_c1 3300050494 Bacteria 1645
466 nmdc:mga07m45_11604_c1 3300050496 Bacteria 4633
467 nmdc:mga07m45_202587_c1 3300050496 Bacteria 1155
468 nmdc:mga07m45_334916_c1 3300050496 Bacteria 880
469 nmdc:mga07m45_34906_c1 3300050496 Bacteria 2797
470 nmdc:mga07m45_4996_c1 3300050496 Bacteria 6551
471 nmdc:mga07m45_569_c2 3300050496 Bacteria 10196
472 nmdc:mga0sz30_14436_c1 3300050516 Bacteria 3109
473 Ga0500578_0000224 3300053086 Bacteria 70358
474 Ga0500644_0026739 3300053088 Bacteria 1788
475 Ga0500651_0200210 3300053093 Bacteria 1178
476 Ga0500650_0014279 3300053098 Bacteria 3357
477 Ga0500562_022841 3300053108 Bacteria 1631
478 Ga0500628_023070 3300053129 Bacteria 1279
479 Ga0500642_0004823 3300053130 Bacteria 4271
480 Ga0500652_004746 3300053131 Bacteria 4227
481 Ga0500564_021746 3300053138 Bacteria 2940
482 Ga0500568_0137478 3300053139 Bacteria 906
483 Ga0500604_0015614 3300053151 Bacteria 2082
484 Ga0500622_0001670 3300053156 Bacteria 17337
485 Ga0500627_0157921 3300053158 Bacteria 1024
486 Ga0500587_001372 3300053739 Bacteria 3433
487 Ga0466962_0004546 3300061719 Bacteria 6654
488 2511252379 2511231003 Bacteria 5606035
489 2511385202 2511231026 Bacteria 5225445
490 2548848132 2547132512 Bacteria 3416496
491 2550692724 2548876994 Bacteria 4904866
492 2587730682 2585428057 Bacteria 6737412
493 2587732102 2585428058 Bacteria 6853932
494 2587759888 2585428062 Bacteria 6842168
495 2588291159 2588253510 Bacteria 6901809
496 2600446216 2600254954 Bacteria 5100516
497 2602007982 2600255389 Bacteria 5275336
498 2643969226 2643221592 Bacteria 6608788
499 2644140800 2643221625 Bacteria 6512927
500 2644243277 2643221644 Bacteria 6865017
501 2644272177 2643221648 Bacteria 6521465
502 2722884948 2721755523 Bacteria 6430384
503 2739612321 2739367655 Bacteria 4051151
504 2808981870 2808606386 Bacteria 4471946
505 2809131492 2808606415 Bacteria 4576710
506 2809151114 2808606419 Bacteria 4576925
507 2816519441 2816332141 Bacteria 4436036
508 2819591768 2818991445 Bacteria 4955017
509 2839139575 2839138175 Bacteria 6549354
510 2852622606 2852618963 Bacteria 4577824
511 2884853860 2884852848 Bacteria 5221161
512 2896155023 2896154374 Bacteria 5221518
513 2904603383 2904601388 Bacteria 5884906
514 2919502993 2919501602 Bacteria 5286340
515 2919706896 2919704043 Bacteria 5560311
516 2926064666 2926063275 Bacteria 5285848
517 2939632750 2939631187 Bacteria 6118131
518 8034965544 8034962539 Bacteria 4884839
519 Ga0207689_10046379
520 JGI24740J21852_10013376
521 JGI25156J39149_1000175
522 JGI25156J39149_1017682
523 JGI25154J39366_1003891
524 JGI25157J39369_1000029
525 JGI25157J39369_1030130
526 JGI25150J39212_1011329
527 JGI25153J46596_10001167
528 rootH1_10080354
529 rootH2_10050886
530 rootH1_10069326
531 rootH1_10069327
532 rootH1_10146338
533 Ga0055539_1000310
534 Ga0055539_1001425
535 Ga0055533_1000010
536 Ga0055533_1002953
537 Ga0055525_1000841
538 Ga0055525_1001256
539 Ga0055535_1000107
540 Ga0055529_1000111
541 Ga0055526_1003406
542 Ga0055524_1000203
543 Ga0055524_1001287
544 Ga0055534_1039687
545 Ga0055528_1055169
546 Ga0055530_10002154
547 Ga0055530_10016194
548 Ga0055540_1000357
549 Ga0055540_1067132
550 Ga0055531_10020200
551 Ga0065165_1004882
552 Ga0070658_10360177
553 Ga0070658_10949865
554 Ga0070676_10113727
555 Ga0070683_100031612
556 Ga0070683_100185442
557 Ga0070690_100028351
558 Ga0070690_100076543
559 Ga0068869_100717182
560 Ga0070666_10257766
561 Ga0070682_100240103
562 Ga0068868_100051368
563 Ga0070660_100590586
564 Ga0070661_100000791
565 Ga0070661_100652200
566 Ga0070692_11058285
567 Ga0070669_100160714
568 Ga0070669_100488820
569 Ga0070675_100359590
570 Ga0070675_100402339
571 Ga0070675_101491114
572 Ga0070671_100440262
573 Ga0070671_100697307
574 Ga0070674_100020018
575 Ga0070674_100251433
576 Ga0070674_100371407
577 Ga0070673_100313794
578 Ga0070688_100088709
579 Ga0070659_100009555
580 Ga0070659_100412922
581 Ga0070659_100610760
582 Ga0070667_100077442
583 Ga0070667_100425228
584 Ga0070700_100758800
585 Ga0070678_100123617
586 Ga0070662_100025445
587 Ga0070662_100148878
588 Ga0068867_100015012
589 Ga0068867_100142047
590 Ga0068867_100532565
591 Ga0068867_100792537
592 Ga0068867_101086486
593 Ga0070672_100046173
594 Ga0070672_100114802
595 Ga0070672_100398261
596 Ga0070672_100425818
597 Ga0070672_100646470
598 Ga0070672_100860554
599 Ga0070672_101103592
600 Ga0070665_100802047
601 Ga0068855_100052867
602 Ga0068855_100170534
603 Ga0070664_100000524
604 Ga0070664_100005230
605 Ga0070664_100024941
606 Ga0070664_100253896
607 Ga0070664_100336369
608 Ga0070664_100765674
609 Ga0068857_100002542
610 Ga0068857_100098356
611 Ga0068857_100292624
612 Ga0068857_100548702
613 Ga0068857_100911846
614 Ga0068854_100012169
615 Ga0068854_100041829
616 Ga0068854_100265671
617 Ga0068856_100003174
618 Ga0068856_100124594
619 Ga0068852_100103368
620 Ga0068852_100400552
621 Ga0068852_101304312
622 Ga0068859_100004121
623 Ga0068859_100324312
624 Ga0068864_100008613
625 Ga0068864_100772751
626 Ga0068861_100024717
627 Ga0068861_100181271
628 Ga0068851_10032475
629 Ga0068851_10153541
630 Ga0068863_100003333
631 Ga0068863_101140764
632 Ga0068858_100490354
633 Ga0068860_100478602
634 Ga0075363_100014012
635 Ga0075363_100229064
636 Ga0075363_100363855
637 Ga0075364_10124488
638 Ga0075364_10237150
639 Ga0075362_10016150
640 Ga0075362_10126565
641 Ga0075362_10130281
642 Ga0075362_10191718
643 Ga0075362_10657083
644 Ga0075367_10005093
645 Ga0075367_10021656
646 Ga0075367_10044931
647 Ga0075367_10050777
648 Ga0075367_10219474
649 Ga0075369_10022437
650 Ga0075369_10026047
651 Ga0075366_10004401
652 Ga0075366_10023724
653 Ga0075366_10029363
654 Ga0075366_10140195
655 Ga0075366_10212147
656 Ga0075366_10246271
657 Ga0097621_100062361
658 Ga0097621_100190134
659 Ga0075370_10001752
660 Ga0075370_10001759
661 Ga0075370_10002149
662 Ga0068871_101077942
663 Ga0097620_100004121
664 Ga0097620_100324304
665 Ga0079104_1000003
666 Ga0079104_1000019
667 Ga0079104_1007180
668 Ga0105240_10009244
669 Ga0105240_10055149
670 Ga0105245_10814784
671 Ga0105245_11800124
672 Ga0105247_10878063
673 Ga0105243_10150476
674 Ga0105243_10188234
675 Ga0105243_10328256
676 Ga0105241_10250188
677 Ga0105242_10014031
678 Ga0105242_10351936
679 Ga0105242_10994048
680 Ga0105248_10597143
681 Ga0105237_10000076
682 Ga0105237_10009537
683 Ga0105238_10018911
684 Ga0105238_10471484
685 Ga0105238_10664400
686 Ga0105249_10072528
687 Ga0105249_10205158
688 Ga0105249_10899282
689 Ga0105239_10001865
690 Ga0105239_10033884
691 Ga0105239_11556081
692 Ga0105246_10481896
693 Ga0105246_10843494
694 Ga0157369_10166927
695 Ga0157374_10136911
696 Ga0157374_10227796
697 Ga0157374_10946261
698 Ga0157374_11968620
699 Ga0157378_10042645
700 Ga0157378_10329596
701 Ga0157378_10508421
702 Ga0163162_10006216
703 Ga0163162_10434449
704 Ga0157372_10018330
705 Ga0157375_11193872
706 Ga0163163_10156395
707 Ga0163163_10394924
708 Ga0157380_10037473
709 Ga0157380_10039918
710 Ga0157380_10054689
711 Ga0157379_10012758
712 Ga0157379_10721818
713 Ga0157376_11190595
714 Ga0182007_10049503
715 Ga0163161_10068263
716 Ga0213872_10021044
717 Ga0213872_10091453
718 Ga0209674_100003
719 Ga0209674_102655
720 Ga0209563_100049
721 Ga0209563_102915
722 Ga0207427_100158
723 Ga0209258_100267
724 Ga0209258_100700
725 Ga0207425_1000511
726 Ga0209026_1000054
727 Ga0209026_1003501
728 Ga0209677_100050
729 Ga0209677_100316
730 Ga0209677_104861
731 Ga0209148_1001945
732 Ga0209759_1000043
733 Ga0209759_1000905
734 Ga0209759_1007464
735 Ga0209129_1000225
736 Ga0209565_1029496
737 Ga0209455_1000158
738 Ga0209673_1020546
739 Ga0207673_1037854
740 Ga0209675_1009271
741 Ga0209564_1000196
742 Ga0209758_1000181
743 Ga0209758_1000207
744 Ga0209050_1000703
745 Ga0209050_1002192
746 Ga0209050_1024764
747 Ga0209256_1000024
748 Ga0209256_1059323
749 Ga0209051_1000063
750 Ga0209051_1001539
751 Ga0209051_1003706
752 Ga0209051_1080560
753 Ga0209257_1000118
754 Ga0207697_10023871
755 Ga0207656_10137632
756 Ga0207642_10136950
757 Ga0207680_10481620
758 Ga0207645_10028011
759 Ga0207645_10240763
760 Ga0207643_10275534
761 Ga0207654_10132356
762 Ga0207695_10012360
763 Ga0207695_10016652
764 Ga0207695_10103587
765 Ga0207671_10008561
766 Ga0207671_10012329
767 Ga0207671_10247304
768 Ga0207657_10444599
769 Ga0207649_10001484
770 Ga0207681_10100757
771 Ga0207694_10007192
772 Ga0207694_10013700
773 Ga0207694_10717196
774 Ga0207694_10931989
775 Ga0207650_10032432
776 Ga0207650_10193563
777 Ga0207659_10002201
778 Ga0207687_10261586
779 Ga0207687_11192352
780 Ga0207644_10342600
781 Ga0207644_10464266
782 Ga0207690_10002792
783 Ga0207690_10415501
784 Ga0207690_10850972
785 Ga0207706_10010206
786 Ga0207706_10089307
787 Ga0207686_10039492
788 Ga0207686_10050285
789 Ga0207686_10225384
790 Ga0207709_10000032
791 Ga0207670_10077789
792 Ga0207669_10175324
793 Ga0207704_10099583
794 Ga0207691_10062074
795 Ga0207691_10139044
796 Ga0207691_10855040
797 Ga0207689_10291868
798 Ga0207689_10977206
799 Ga0207679_10000220
800 Ga0207679_10159795
801 Ga0207679_10281383
802 Ga0207679_11152859
803 Ga0207667_10012561
804 Ga0207667_11242244
805 Ga0207651_10500403
806 Ga0207668_10103311
807 Ga0207640_10323274
808 Ga0207658_10010682
809 Ga0207677_10004271
810 Ga0207703_10001921
811 Ga0207639_10096290
812 Ga0207639_10135921
813 Ga0207639_10279554
814 Ga0207639_10479552
815 Ga0207678_10088062
816 Ga0207678_10094880
817 Ga0207678_10147882
818 Ga0207702_10011854
819 Ga0207641_10011803
820 Ga0207648_10004326
821 Ga0207648_10013067
822 Ga0207648_10020746
823 Ga0207648_10037429
824 Ga0207648_10066241
825 Ga0207648_10844105
826 Ga0207648_10992028
827 Ga0207676_10061518
828 Ga0207674_10263634
829 Ga0207674_10310415
830 Ga0207674_10675043
831 Ga0207675_100080990
832 Ga0207675_100089778
833 Ga0207698_10223969
834 Ga0207698_10612312
835 Ga0209281_1000002
836 Ga0209281_1000149
837 Ga0268266_10637737
838 Ga0268265_10296442
839 Ga0268265_11040464
840 Ga0268264_10260997
841 Ga0307517_10093811
842 Ga0307517_10418407
843 Ga0307515_10000013
844 Ga0307515_10000109
845 Ga0307515_10002637
846 Ga0307515_10010767
847 Ga0307515_10062490
848 Ga0307515_10086733
849 Ga0307515_10405603
850 Ga0265324_10021680
851 Ga0307512_10071793
852 Ga0265332_10000030
853 Ga0265327_10096503
854 Ga0307513_10000990
855 Ga0307513_10083360
856 Ga0307513_10362251
857 Ga0307513_10397742
858 Ga0307509_10043209
859 Ga0307509_10072228
860 Ga0307509_10167717
861 Ga0307509_10218829
862 Ga0307408_100000028
863 Ga0307408_100055431
864 Ga0307508_10000101
865 Ga0307514_10000533
866 Ga0307514_10008985
867 Ga0307516_10000193
868 Ga0307516_10001515
869 Ga0307516_10002784
870 Ga0307516_10011646
871 Ga0307516_10015133
872 Ga0307405_10124709
873 Ga0307412_10052632
874 Ga0307414_10105953
875 Ga0307507_10063204
876 Ga0307507_10081775
877 Ga0373931_0015905
878 Ga0373931_0234204
879 Ga0373925_0156871
880 Ga0395899_0335003
881 Ga0395900_1074324
882 Ga0395905_0021000
883 Ga0395905_0535442
884 Ga0395905_0885749
885 Ga0395901_0002847
886 Ga0436361_0256361
887 Ga0439466_0194917
888 Ga0451791_1934572
889 Ga0451793_0125591
890 Ga0451793_1753075
891 Ga0451797_0545602
892 Ga0451795_0646682
893 Ga0451795_1537189
894 Ga0451798_0706099
895 Ga0451800_1243688
896 Ga0451800_1338090
897 Ga0451800_1496088
898 Ga0451802_0277119
899 Ga0451804_0771933
900 Ga0451807_2456877
901 Ga0451849_0711165
902 Ga0451853_0606631
903 Ga0439431_0003056
904 Ga0439462_0134718
905 Ga0450919_000730
906 Ga0450908_026940
907 Ga0450918_001092
908 Ga0451577_0003346
909 Ga0451577_0189917
910 Ga0466969_0013679
911 Ga0466965_0001496
912 Ga0466966_0011578
913 Ga0466961_0047056
914 Ga0466964_0030855
915 Ga0453684_0014644
916 Ga0453684_0263474
917 Ga0453684_0375708
918 Ga0466971_0006274
919 Ga0466957_0052177
920 Ga0466957_0110699
921 Ga0466957_0303550
922 Ga0466959_0021762
923 Ga0466958_0119727
924 Ga0466967_0374944
925 Ga0466967_1304451
926 Ga0495639_0025341
927 Ga0495639_0093229
928 Ga0495585_0009167
929 Ga0495585_0070688
930 Ga0495610_0222178
931 Ga0495620_0276536
932 Ga0495628_0168006
933 Ga0495632_0001710
934 Ga0495632_0107519
935 Ga0495643_0084198
936 Ga0495652_0001279
937 Ga0495652_0427474
938 Ga0495652_0565654
939 Ga0495621_0437344
940 Ga0495645_0012072
941 Ga0495633_0417865
942 Ga0495611_0166214
943 Ga0495625_0012039
944 Ga0495588_0028282
945 Ga0495646_0000288
946 Ga0495658_0240542
947 Ga0495604_0967518
948 Ga0495686_0242602
949 Ga0495626_0275893
950 Ga0496103_0021982
951 Ga0496104_0400250
952 Ga0496104_0613210
953 Ga0496105_0549749
954 Ga0496107_0428110
955 Ga0496108_1350970
956 Ga0496109_0034703
957 Ga0496114_0070795
958 Ga0496114_0101077
959 Ga0496121_0046103
960 Ga0496123_0143219
961 Ga0496124_0000089
962 Ga0496125_0007669
963 Ga0496125_0079099
964 Ga0496126_0011097
965 Ga0501198_000318
966 Ga0501222_000134
967 nmdc:mga03683_127687_c1
968 nmdc:mga03683_213856_c1
969 nmdc:mga03n38_140075_c1
970 nmdc:mga03n38_609588_c1
971 nmdc:mga00v17_341302_c1
972 nmdc:mga00v17_86973_c1
973 nmdc:mga0k408_203324_c1
974 nmdc:mga0k408_24788_c1
975 nmdc:mga0k408_321586_c1
976 nmdc:mga0k408_36268_c1
977 nmdc:mga0k408_36991_c1
978 nmdc:mga0k408_3802_c1
979 nmdc:mga0k408_504_c1
980 nmdc:mga06z11_511544_c1
981 nmdc:mga06z11_746691_c1
982 nmdc:mga06z11_86510_c1
983 nmdc:mga06z11_92414_c1
984 nmdc:mga07m45_11604_c1
985 nmdc:mga07m45_202587_c1
986 nmdc:mga07m45_334916_c1
987 nmdc:mga07m45_34906_c1
988 nmdc:mga07m45_4996_c1
989 nmdc:mga07m45_569_c2
990 nmdc:mga0sz30_14436_c1
991 Ga0500578_0000224
992 Ga0500644_0026739
993 Ga0500651_0200210
994 Ga0500650_0014279
995 Ga0500562_022841
996 Ga0500628_023070
997 Ga0500642_0004823
998 Ga0500652_004746
999 Ga0500564_021746
1000 Ga0500568_0137478
1001 Ga0500604_0015614
1002 Ga0500622_0001670
1003 Ga0500627_0157921
1004 Ga0500587_001372
1005 Ga0466962_0004546
1006 2511252379
1007 2511385202
1008 2548848132
1009 2550692724
1010 2587730682
1011 2587732102
1012 2587759888
1013 2588291159
1014 2600446216
1015 2602007982
1016 2643969226
1017 2644140800
1018 2644243277
1019 2644272177
1020 2722884948
1021 2739612321
1022 2808981870
1023 2809131492
1024 2809151114
1025 2816519441
1026 2819591768
1027 2839139575
1028 2852622606
1029 2884853860
1030 2896155023
1031 2904603383
1032 2919502993
1033 2919706896
1034 2926064666
1035 2939632750
1036 8034965544

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

22

98

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ien-assembly1.cif.gz_A crystal structure of acyl-coa hydrolase from neisseria meningitidis fam18 0.9869 1 145
5t02-assembly1.cif.gz_F structural characterisation of mutant asp39ala of thioesterase (nmach) from neisseria meningitidis 0.9865 3 145
5szu-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9859 2 148
5szv-assembly2.cif.gz_D novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9795 2 149
5szy-assembly1.cif.gz_A novel structural insights into gdp-mediated regulation of acyl-coa thioesterases 0.9793 1 149
ID Description Score Start End Superfamily
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9869 1 145 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9675 7 148 3.10.129.10
af_F1R1X8_276_424_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9643 7 142 3.10.129.10
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9539 7 145 3.10.129.10
af_Q91V12_220_381_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9537 7 151 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2Z3IDM6-F1-model_v4 Acyl-CoA thioesterase 0.9971 5 150 GO:0005829
GO:0006637
GO:0052816
AF-D0LD77-F1-model_v4 Thioesterase superfamily protein 0.9953 5 149 GO:0005829
GO:0006637
GO:0052816
AF-F6EKZ5-F1-model_v4 Putative acyl-coA thioester hydrolase 0.9947 6 156 GO:0005829
GO:0006637
GO:0052816
AF-A0A2E1GD44-F1-model_v4 deleted 0.9947 5 149
AF-A0A7C9G8B4-F1-model_v4 Acyl-CoA thioesterase 0.9947 3 148 GO:0005829
GO:0006637
GO:0052816

Map