F458316

General Info

Members Datasets Scaffolds Average Seq Length
518 275 518 180

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0103474|Ga0495674_0103474_1719_2336
Length 205
Sequence MVVPPPFLNRGHRAHSREYDRRILLQQTEPRGSYGVTAKIFHWLIFLLLAAQYAVGSIMPHIGRKTLNEGWVNWHLSIGAAILLVIVLRFVWRLLTPVALPTTLTPWEYHLSRFTHLMLYLLVLTMTLLGWAAANARGWDVKLLGLVTLPAIAPNGSSWGHEAGDIHNILVYVLLGFIVLHVAGALYHYFIRRDQVLQRMLPTPS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
14 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
104 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 3.86
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544919 2209111006 Bacteria 20284
2 ARcpr5oldR_c000002 3300000041 Bacteria 79314
3 ARSoilYngRDRAFT_c00003 3300000042 Bacteria 43678
4 ARcpr5yngRDRAFT_c000036 3300000043 Bacteria 21264
5 ARSoilOldRDRAFT_c000002 3300000044 Bacteria 66650
6 ARCol0oldRDRAFT_c01261 3300000045 Bacteria 1791
7 ARCol0yngRDRAFT_1000005 3300000652 Bacteria 47205
8 JGI24741J21665_1001146 3300001915 Bacteria 7835
9 JGI24737J22298_10012980 3300001990 Bacteria 2714
10 JGI25165J46597_1000036 3300003214 Bacteria 286380
11 JGI25153J46596_10000749 3300003215 Bacteria 19835
12 Ga0058863_11569301 3300004799 Bacteria 748
13 Ga0065717_1004119 3300005276 Bacteria 1096
14 Ga0065716_1001630 3300005277 Bacteria 4832
15 Ga0065714_10247510 3300005288 Bacteria 782
16 Ga0065704_10093501 3300005289 Bacteria 2594
17 Ga0065712_10195652 3300005290 Bacteria 1129
18 Ga0065715_10028878 3300005293 Bacteria 2024
19 Ga0065715_10216738 3300005293 Bacteria 1289
20 Ga0065707_10152070 3300005295 Bacteria 1648
21 Ga0070658_10012520 3300005327 Bacteria 6805
22 Ga0070658_10098376 3300005327 Bacteria 2417
23 Ga0070658_10804366 3300005327 Unclassified 817
24 Ga0070658_11248381 3300005327 Unclassified 646
25 Ga0070676_10005568 3300005328 Bacteria 6706
26 Ga0070676_10134842 3300005328 Bacteria 1565
27 Ga0070676_10208761 3300005328 Unclassified 1284
28 Ga0070676_10264452 3300005328 Unclassified 1153
29 Ga0070683_100533308 3300005329 Bacteria 1122
30 Ga0070690_100044297 3300005330 Bacteria 2823
31 Ga0070690_100138178 3300005330 Bacteria 1652
32 Ga0070690_100343378 3300005330 Unclassified 1082
33 Ga0070670_100275815 3300005331 Unclassified 1468
34 Ga0070670_100388600 3300005331 Bacteria 1230
35 Ga0070670_101087499 3300005331 Unclassified 729
36 Ga0068869_100004042 3300005334 Bacteria 9074
37 Ga0068869_100305001 3300005334 Bacteria 1287
38 Ga0068869_100464166 3300005334 Viruses 1052
39 Ga0070666_10011596 3300005335 Bacteria 5536
40 Ga0070666_10030835 3300005335 Bacteria 3535
41 Ga0070666_10306955 3300005335 Bacteria 1131
42 Ga0070680_100040530 3300005336 Bacteria 3771
43 Ga0070682_100025284 3300005337 Bacteria 3541
44 Ga0068868_100496255 3300005338 Unclassified 1068
45 Ga0070660_100250906 3300005339 Bacteria 1443
46 Ga0070689_100144157 3300005340 Bacteria 1917
47 Ga0070689_100210042 3300005340 Bacteria 1593
48 Ga0070687_100017172 3300005343 Bacteria 3320
49 Ga0070687_100512038 3300005343 Bacteria 810
50 Ga0070661_100506679 3300005344 Bacteria 967
51 Ga0070692_10052618 3300005345 Bacteria 2121
52 Ga0070692_10405656 3300005345 Bacteria 861
53 Ga0070668_100365897 3300005347 Bacteria 1224
54 Ga0070669_100838768 3300005353 Unclassified 783
55 Ga0070675_100034115 3300005354 Bacteria 4128
56 Ga0070671_100051866 3300005355 Bacteria 3411
57 Ga0070671_100242211 3300005355 Bacteria 1531
58 Ga0070674_100135155 3300005356 Bacteria 1843
59 Ga0070673_100006715 3300005364 Bacteria 7503
60 Ga0070659_100025520 3300005366 Bacteria 4540
61 Ga0070667_100019174 3300005367 Bacteria 5672
62 Ga0070667_100638624 3300005367 Bacteria 982
63 Ga0070709_10082283 3300005434 Unclassified 2103
64 Ga0070701_10035199 3300005438 Bacteria 2514
65 Ga0070700_100151921 3300005441 Bacteria 1584
66 Ga0070700_100557227 3300005441 Bacteria 891
67 Ga0070694_100062681 3300005444 Bacteria 2541
68 Ga0070694_100092775 3300005444 Bacteria 2121
69 Ga0070708_100932554 3300005445 Bacteria 815
70 Ga0070663_100147614 3300005455 Bacteria 1800
71 Ga0070663_100420549 3300005455 Bacteria 1096
72 Ga0070678_100014580 3300005456 Bacteria 4966
73 Ga0070678_100781031 3300005456 Bacteria 866
74 Ga0070678_101446793 3300005456 Unclassified 642
75 Ga0070662_100194159 3300005457 Bacteria 1607
76 Ga0070681_10025544 3300005458 Bacteria 5942
77 Ga0070681_10716540 3300005458 Bacteria 917
78 Ga0070681_10884231 3300005458 Bacteria 812
79 Ga0068867_100010143 3300005459 Bacteria 6643
80 Ga0070679_100017468 3300005530 Bacteria 6944
81 Ga0070679_100155859 3300005530 Bacteria 2259
82 Ga0070684_100013241 3300005535 Bacteria 6644
83 Ga0070684_100590971 3300005535 Bacteria 1032
84 Ga0068853_100080810 3300005539 Bacteria 2845
85 Ga0068853_100452608 3300005539 Unclassified 1207
86 Ga0070672_100430326 3300005543 Bacteria 1135
87 Ga0070686_100039790 3300005544 Bacteria 2931
88 Ga0070686_100203126 3300005544 Unclassified 1422
89 Ga0070686_100954469 3300005544 Unclassified 701
90 Ga0070695_100011498 3300005545 Bacteria 5295
91 Ga0070696_100039960 3300005546 Bacteria 3238
92 Ga0070693_100147309 3300005547 Bacteria 1488
93 Ga0070665_100016874 3300005548 Bacteria 7321
94 Ga0070665_100022162 3300005548 Bacteria 6390
95 Ga0070665_100325628 3300005548 Bacteria 1541
96 Ga0070665_100500823 3300005548 Bacteria 1226
97 Ga0070704_100583581 3300005549 Bacteria 980
98 Ga0070704_100616058 3300005549 Bacteria 955
99 Ga0070704_100893771 3300005549 Bacteria 798
100 Ga0068855_100367944 3300005563 Bacteria 1581
101 Ga0068855_100436505 3300005563 Unclassified 1431
102 Ga0070664_100354224 3300005564 Bacteria 1336
103 Ga0068857_100228862 3300005577 Bacteria 1700
104 Ga0068857_100356621 3300005577 Bacteria 1355
105 Ga0068857_100642607 3300005577 Bacteria 1005
106 Ga0068856_100030867 3300005614 Bacteria 5240
107 Ga0068852_100630550 3300005616 Unclassified 1078
108 Ga0068852_100875197 3300005616 Bacteria 915
109 Ga0068859_100211943 3300005617 Bacteria 2024
110 Ga0068864_100214246 3300005618 Bacteria 1775
111 Ga0068866_10016288 3300005718 Bacteria 3321
112 Ga0068861_100122421 3300005719 Bacteria 2101
113 Ga0068861_101479040 3300005719 Unclassified 666
114 Ga0068870_10077981 3300005840 Bacteria 1824
115 Ga0068863_100442596 3300005841 Unclassified 1274
116 Ga0068858_100038647 3300005842 Bacteria 4427
117 Ga0068858_100356430 3300005842 Bacteria 1402
118 Ga0068860_100027664 3300005843 Bacteria 5460
119 Ga0068860_100050261 3300005843 Bacteria 3969
120 Ga0068860_100076593 3300005843 Bacteria 3181
121 Ga0068860_100287302 3300005843 Bacteria 1608
122 Ga0068860_100698583 3300005843 Unclassified 1024
123 Ga0068862_100100343 3300005844 Bacteria 2531
124 Ga0068862_100100723 3300005844 Bacteria 2526
125 Ga0081540_1102008 3300005983 Unclassified 1233
126 Ga0075368_10004565 3300006042 Bacteria 4704
127 Ga0075368_10015178 3300006042 Bacteria 2853
128 Ga0075368_10084120 3300006042 Bacteria 1297
129 Ga0075363_100032631 3300006048 Bacteria 2706
130 Ga0075364_10141481 3300006051 Bacteria 1618
131 Ga0075367_10019913 3300006178 Bacteria 3728
132 Ga0075367_10081817 3300006178 Bacteria 1954
133 Ga0075367_10206000 3300006178 Bacteria 1229
134 Ga0097621_100013144 3300006237 Bacteria 6158
135 Ga0097621_100017838 3300006237 Bacteria 5404
136 Ga0097621_100206491 3300006237 Unclassified 1707
137 Ga0097621_100225882 3300006237 Bacteria 1633
138 Ga0097621_100500454 3300006237 Bacteria 1100
139 Ga0068871_100002366 3300006358 Bacteria 12857
140 Ga0068871_100029452 3300006358 Bacteria 4312
141 Ga0068871_100065339 3300006358 Bacteria 2980
142 Ga0068871_100070132 3300006358 Bacteria 2880
143 Ga0068871_100120619 3300006358 Unclassified 2214
144 Ga0075428_100030684 3300006844 Bacteria 5943
145 Ga0075431_100100106 3300006847 Bacteria 2990
146 Ga0075434_100379778 3300006871 Bacteria 1434
147 Ga0068865_100003964 3300006881 Bacteria 8879
148 Ga0068865_100050827 3300006881 Bacteria 2866
149 Ga0068865_100069138 3300006881 Bacteria 2498
150 Ga0068865_100116236 3300006881 Bacteria 1981
151 Ga0068865_101505273 3300006881 Unclassified 603
152 Ga0097620_100211943 3300006931 Bacteria 2024
153 Ga0105240_10004235 3300009093 Bacteria 21937
154 Ga0105240_10016143 3300009093 Bacteria 10121
155 Ga0105240_10088492 3300009093 Bacteria 3789
156 Ga0105240_10188526 3300009093 Bacteria 2427
157 Ga0105240_10262682 3300009093 Bacteria 1991
158 Ga0105240_10365393 3300009093 Bacteria 1633
159 Ga0105240_10443378 3300009093 Bacteria 1454
160 Ga0105240_10450864 3300009093 Bacteria 1440
161 Ga0105240_10764049 3300009093 Bacteria 1050
162 Ga0111539_10000114 3300009094 Bacteria 88757
163 Ga0111539_11400240 3300009094 Unclassified 811
164 Ga0105245_10016459 3300009098 Bacteria 6451
165 Ga0105245_10483578 3300009098 Bacteria 1252
166 Ga0105245_10565404 3300009098 Bacteria 1160
167 Ga0105247_10189707 3300009101 Bacteria 1376
168 Ga0105247_10272533 3300009101 Bacteria 1164
169 Ga0105247_10295039 3300009101 Bacteria 1123
170 Ga0114129_10025299 3300009147 Bacteria 8410
171 Ga0105243_10004109 3300009148 Bacteria 11569
172 Ga0105243_10005622 3300009148 Bacteria 9762
173 Ga0105243_11198210 3300009148 Unclassified 772
174 Ga0105241_10062101 3300009174 Bacteria 2879
175 Ga0105241_10062243 3300009174 Bacteria 2876
176 Ga0105241_10247126 3300009174 Bacteria 1511
177 Ga0105241_10324570 3300009174 Bacteria 1328
178 Ga0105241_10449743 3300009174 Bacteria 1139
179 Ga0105241_10468496 3300009174 Unclassified 1117
180 Ga0105242_10068091 3300009176 Bacteria 2944
181 Ga0105242_10332324 3300009176 Bacteria 1398
182 Ga0105242_10343336 3300009176 Unclassified 1376
183 Ga0105242_10468072 3300009176 Bacteria 1192
184 Ga0105242_10734732 3300009176 Bacteria 970
185 Ga0105242_11289584 3300009176 Unclassified 754
186 Ga0105248_10143301 3300009177 Bacteria 2696
187 Ga0105248_10729967 3300009177 Bacteria 1118
188 Ga0105237_10017383 3300009545 Bacteria 7455
189 Ga0105237_10064831 3300009545 Unclassified 3649
190 Ga0105237_10071537 3300009545 Bacteria 3463
191 Ga0105237_10879034 3300009545 Bacteria 903
192 Ga0105237_11058485 3300009545 Unclassified 818
193 Ga0105238_10018006 3300009551 Bacteria 7182
194 Ga0105238_10048838 3300009551 Bacteria 4263
195 Ga0105238_10058728 3300009551 Bacteria 3855
196 Ga0105238_10153826 3300009551 Bacteria 2275
197 Ga0105249_10123629 3300009553 Unclassified 2462
198 Ga0105249_10143225 3300009553 Bacteria 2294
199 Ga0105249_11463366 3300009553 Unclassified 755
200 Ga0105239_10045379 3300010375 Bacteria 4816
201 Ga0105239_10361614 3300010375 Bacteria 1639
202 Ga0105239_10431645 3300010375 Bacteria 1493
203 Ga0105239_10502911 3300010375 Unclassified 1378
204 Ga0105239_10674992 3300010375 Unclassified 1181
205 Ga0105239_10747028 3300010375 Unclassified 1120
206 Ga0105239_10831689 3300010375 Bacteria 1058
207 Ga0105239_11022825 3300010375 Unclassified 950
208 Ga0105239_11192646 3300010375 Bacteria 877
209 Ga0105239_11451878 3300010375 Unclassified 792
210 Ga0105246_10056091 3300011119 Bacteria 2722
211 Ga0157347_1000726 3300012502 Bacteria 2288
212 Ga0157339_1000999 3300012505 Bacteria 1613
213 Ga0157373_10048140 3300013100 Bacteria 3040
214 Ga0157373_10071561 3300013100 Bacteria 2449
215 Ga0157371_10414166 3300013102 Bacteria 987
216 Ga0157370_10031087 3300013104 Bacteria 5226
217 Ga0157369_10714991 3300013105 Bacteria 1031
218 Ga0157374_10045508 3300013296 Bacteria 4062
219 Ga0157374_10048422 3300013296 Bacteria 3944
220 Ga0157374_10384280 3300013296 Unclassified 1399
221 Ga0157374_10453760 3300013296 Bacteria 1284
222 Ga0157378_10015768 3300013297 Bacteria 6617
223 Ga0157378_10180011 3300013297 Unclassified 1988
224 Ga0157378_10286860 3300013297 Bacteria 1589
225 Ga0157378_11276595 3300013297 Bacteria 775
226 Ga0163162_10002587 3300013306 Bacteria 17132
227 Ga0163162_10016922 3300013306 Bacteria 7131
228 Ga0163162_10147826 3300013306 Bacteria 2466
229 Ga0163162_10212027 3300013306 Bacteria 2067
230 Ga0157372_10087470 3300013307 Unclassified 3536
231 Ga0157372_12138560 3300013307 Unclassified 643
232 Ga0157375_10009529 3300013308 Bacteria 8527
233 Ga0157375_10147113 3300013308 Bacteria 2487
234 Ga0163163_10008914 3300014325 Bacteria 8937
235 Ga0163163_10094749 3300014325 Bacteria 3004
236 Ga0163163_10227207 3300014325 Unclassified 1915
237 Ga0157380_10054953 3300014326 Bacteria 3161
238 Ga0157380_10292957 3300014326 Bacteria 1495
239 Ga0157380_10951027 3300014326 Unclassified 889
240 Ga0182008_10123780 3300014497 Bacteria 1286
241 Ga0157379_10000040 3300014968 Bacteria 79019
242 Ga0157379_10049147 3300014968 Bacteria 3766
243 Ga0157379_10064355 3300014968 Unclassified 3277
244 Ga0157379_10179881 3300014968 Bacteria 1910
245 Ga0157379_10222056 3300014968 Bacteria 1712
246 Ga0157379_10283380 3300014968 Bacteria 1508
247 Ga0157376_10037372 3300014969 Bacteria 3941
248 Ga0157376_11137197 3300014969 Unclassified 807
249 Ga0209233_1000015 3300025261 Bacteria 980563
250 Ga0209233_1002448 3300025261 Bacteria 6842
251 Ga0209758_1000013 3300025297 Bacteria 873003
252 Ga0207697_10165242 3300025315 Bacteria 966
253 Ga0207656_10123492 3300025321 Bacteria 1207
254 Ga0207642_10056340 3300025899 Unclassified 1803
255 Ga0207710_10019022 3300025900 Bacteria 2928
256 Ga0207680_10007310 3300025903 Bacteria 5376
257 Ga0207680_10170768 3300025903 Bacteria 1464
258 Ga0207680_10270123 3300025903 Bacteria 1179
259 Ga0207647_10099203 3300025904 Bacteria 1730
260 Ga0207699_10582884 3300025906 Bacteria 813
261 Ga0207645_10154189 3300025907 Unclassified 1500
262 Ga0207705_10038669 3300025909 Bacteria 3417
263 Ga0207705_10148386 3300025909 Unclassified 1756
264 Ga0207654_10057275 3300025911 Bacteria 2264
265 Ga0207654_10074194 3300025911 Unclassified 2030
266 Ga0207654_10086145 3300025911 Unclassified 1904
267 Ga0207654_10528608 3300025911 Bacteria 836
268 Ga0207707_10115985 3300025912 Bacteria 2340
269 Ga0207707_10188209 3300025912 Bacteria 1801
270 Ga0207695_10015721 3300025913 Bacteria 8897
271 Ga0207695_10058798 3300025913 Bacteria 3990
272 Ga0207695_10092065 3300025913 Bacteria 3043
273 Ga0207695_10388444 3300025913 Bacteria 1281
274 Ga0207695_10514454 3300025913 Bacteria 1079
275 Ga0207671_10076952 3300025914 Unclassified 2497
276 Ga0207671_10224643 3300025914 Bacteria 1472
277 Ga0207660_10114725 3300025917 Bacteria 2032
278 Ga0207660_10136457 3300025917 Bacteria 1872
279 Ga0207660_10254278 3300025917 Bacteria 1387
280 Ga0207662_10185158 3300025918 Bacteria 1341
281 Ga0207657_10007556 3300025919 Bacteria 11142
282 Ga0207657_10675848 3300025919 Unclassified 803
283 Ga0207652_10010243 3300025921 Bacteria 7544
284 Ga0207652_10697808 3300025921 Unclassified 906
285 Ga0207694_10021008 3300025924 Bacteria 4942
286 Ga0207694_10116918 3300025924 Bacteria 2125
287 Ga0207694_10118282 3300025924 Bacteria 2114
288 Ga0207694_10212203 3300025924 Bacteria 1577
289 Ga0207650_10088828 3300025925 Unclassified 2358
290 Ga0207687_10067867 3300025927 Bacteria 2538
291 Ga0207687_10294057 3300025927 Bacteria 1306
292 Ga0207690_10066538 3300025932 Bacteria 2468
293 Ga0207706_10078096 3300025933 Bacteria 2912
294 Ga0207706_10154719 3300025933 Bacteria 2017
295 Ga0207686_10332756 3300025934 Bacteria 1138
296 Ga0207686_10994150 3300025934 Unclassified 680
297 Ga0207709_10013563 3300025935 Bacteria 4495
298 Ga0207709_10197141 3300025935 Bacteria 1435
299 Ga0207670_10117964 3300025936 Bacteria 1924
300 Ga0207670_10541935 3300025936 Unclassified 950
301 Ga0207704_10011340 3300025938 Bacteria 4384
302 Ga0207704_10106631 3300025938 Bacteria 1882
303 Ga0207704_10205505 3300025938 Bacteria 1445
304 Ga0207704_10267838 3300025938 Bacteria 1292
305 Ga0207691_10167868 3300025940 Bacteria 1923
306 Ga0207711_10016344 3300025941 Bacteria 6167
307 Ga0207711_10067307 3300025941 Unclassified 3100
308 Ga0207711_11270291 3300025941 Bacteria 678
309 Ga0207689_10013474 3300025942 Bacteria 6983
310 Ga0207689_10360652 3300025942 Bacteria 1209
311 Ga0207689_10664952 3300025942 Bacteria 878
312 Ga0207689_10736067 3300025942 Unclassified 832
313 Ga0207661_10278040 3300025944 Bacteria 1495
314 Ga0207661_10404147 3300025944 Bacteria 1239
315 Ga0207661_10616717 3300025944 Unclassified 996
316 Ga0207679_10769756 3300025945 Unclassified 876
317 Ga0207667_10381985 3300025949 Bacteria 1435
318 Ga0207667_10711216 3300025949 Bacteria 1006
319 Ga0207651_10038431 3300025960 Bacteria 3146
320 Ga0207712_10370691 3300025961 Bacteria 1195
321 Ga0207658_10055039 3300025986 Bacteria 2946
322 Ga0207658_10471398 3300025986 Bacteria 1114
323 Ga0207703_10011250 3300026035 Bacteria 6962
324 Ga0207703_10104326 3300026035 Bacteria 2408
325 Ga0207703_10457267 3300026035 Bacteria 1193
326 Ga0207639_10397506 3300026041 Unclassified 1241
327 Ga0207678_10110899 3300026067 Bacteria 2340
328 Ga0207678_10168792 3300026067 Bacteria 1868
329 Ga0207678_10389647 3300026067 Viruses 1205
330 Ga0207708_10064875 3300026075 Bacteria 2791
331 Ga0207708_10648007 3300026075 Bacteria 899
332 Ga0207641_10208019 3300026088 Unclassified 1808
333 Ga0207641_10281168 3300026088 Unclassified 1565
334 Ga0207641_10435325 3300026088 Unclassified 1265
335 Ga0207648_10016331 3300026089 Bacteria 6787
336 Ga0207648_10678172 3300026089 Unclassified 954
337 Ga0207676_10195586 3300026095 Bacteria 1783
338 Ga0207676_10799366 3300026095 Bacteria 920
339 Ga0207674_10024484 3300026116 Bacteria 6450
340 Ga0207674_11196197 3300026116 Unclassified 730
341 Ga0207675_100193794 3300026118 Bacteria 1950
342 Ga0207683_10031104 3300026121 Bacteria 4631
343 Ga0207683_11383652 3300026121 Unclassified 651
344 Ga0207698_10894157 3300026142 Unclassified 895
345 Ga0209966_1000715 3300027695 Bacteria 7059
346 Ga0209998_10001566 3300027717 Bacteria 5498
347 Ga0209813_10009195 3300027866 Bacteria 2519
348 Ga0209813_10077878 3300027866 Unclassified 1090
349 Ga0209813_10090630 3300027866 Bacteria 1026
350 Ga0209974_10107272 3300027876 Bacteria 980
351 Ga0207428_10000312 3300027907 Bacteria 64494
352 Ga0268266_10009169 3300028379 Bacteria 8734
353 Ga0268266_10011803 3300028379 Bacteria 7573
354 Ga0268266_10026592 3300028379 Bacteria 4924
355 Ga0268266_10110139 3300028379 Unclassified 2439
356 Ga0268266_10147846 3300028379 Unclassified 2114
357 Ga0268266_10241774 3300028379 Bacteria 1666
358 Ga0268266_10243248 3300028379 Bacteria 1661
359 Ga0268266_10434002 3300028379 Bacteria 1247
360 Ga0268266_10513242 3300028379 Bacteria 1145
361 Ga0268265_10269348 3300028380 Bacteria 1518
362 Ga0268264_10038353 3300028381 Bacteria 3954
363 Ga0268264_10041706 3300028381 Bacteria 3797
364 Ga0268264_10361753 3300028381 Bacteria 1384
365 Ga0265318_10000062 3300028577 Bacteria 107081
366 Ga0265338_10422807 3300028800 Unclassified 947
367 Ga0265325_10015043 3300031241 Bacteria 4361
368 Ga0265339_10005729 3300031249 Bacteria 8248
369 Ga0265339_10149722 3300031249 Bacteria 1181
370 Ga0265331_10011240 3300031250 Bacteria 4910
371 Ga0265331_10030306 3300031250 Bacteria 2693
372 Ga0265331_10056157 3300031250 Bacteria 1871
373 Ga0265316_10409220 3300031344 Unclassified 976
374 Ga0265316_10782748 3300031344 Unclassified 670
375 Ga0265314_10133492 3300031711 Bacteria 1545
376 Ga0307516_10024072 3300031730 Bacteria 6226
377 Ga0307516_10062949 3300031730 Bacteria 3593
378 Ga0373930_0070802 3300034816 Bacteria 792
379 Ga0373948_0000057 3300034817 Bacteria 11629
380 Ga0373959_0001333 3300034820 Bacteria 3946
381 Ga0373938_0000183 3300034957 Bacteria 9247
382 Ga0373928_0007054 3300035084 Bacteria 2165
383 Ga0373929_0001928 3300035085 Bacteria 3880
384 Ga0373940_0000441 3300035088 Bacteria 6342
385 Ga0373949_0005187 3300035090 Bacteria 2921
386 Ga0373951_0000340 3300035091 Bacteria 14349
387 Ga0373952_0001763 3300035092 Bacteria 3933
388 Ga0373932_0002354 3300035112 Bacteria 4796
389 Ga0373941_0000123 3300035115 Bacteria 13355
390 Ga0373960_0001052 3300035121 Bacteria 5956
391 Ga0373942_0001157 3300035207 Bacteria 6993
392 Ga0373961_0003676 3300035241 Bacteria 3757
393 Ga0373962_0001031 3300035242 Bacteria 6452
394 Ga0373962_0193594 3300035242 Bacteria 685
395 Ga0316574_0165594 3300035398 Bacteria 1424
396 Ga0373931_0023522 3300035691 Bacteria 3112
397 Ga0373931_0048851 3300035691 Bacteria 2244
398 Ga0373931_0170634 3300035691 Bacteria 1282
399 Ga0373937_0432209 3300036401 Bacteria 1250
400 Ga0395898_0523201 3300037466 Bacteria 1127
401 Ga0436360_0549383 3300039438 Bacteria 1597
402 Ga0439448_0047286 3300042005 Bacteria 1403
403 Ga0451577_0118237 3300042876 Bacteria 2374
404 Ga0453684_0087128 3300044712 Bacteria 3871
405 Ga0451576_0043535 3300045051 Bacteria 4736
406 Ga0495585_0137289 3300046492 Bacteria 1283
407 Ga0495630_0640500 3300046517 Unclassified 814
408 Ga0495621_0028117 3300046539 Bacteria 1910
409 Ga0495622_0010329 3300046557 Bacteria 4316
410 Ga0495656_0096075 3300046615 Unclassified 1363
411 Ga0495634_0172549 3300046642 Bacteria 1358
412 Ga0495634_0367724 3300046642 Unclassified 859
413 Ga0495669_0078171 3300046684 Bacteria 1516
414 Ga0495624_0198063 3300046690 Bacteria 1221
415 Ga0495589_0160149 3300046794 Bacteria 1072
416 Ga0495581_0362392 3300047315 Bacteria 846
417 Ga0495674_0103474 3300047319 Bacteria 2421
418 Ga0496101_0932106 3300048904 Bacteria 683
419 Ga0496102_0051431 3300048905 Bacteria 3753
420 Ga0496104_0000708 3300048907 Bacteria 28659
421 Ga0496105_0052333 3300048908 Bacteria 3373
422 Ga0496106_0022665 3300048909 Bacteria 4666
423 Ga0496107_0038731 3300048910 Bacteria 3418
424 Ga0496107_0209537 3300048910 Bacteria 1449
425 Ga0496108_0002753 3300048911 Bacteria 14079
426 Ga0496108_0373715 3300048911 Bacteria 1244
427 Ga0496109_0027728 3300048912 Bacteria 5060
428 Ga0496109_0046963 3300048912 Bacteria 3923
429 Ga0496110_0000532 3300048913 Bacteria 25909
430 Ga0496110_0172389 3300048913 Bacteria 1963
431 Ga0496111_0034152 3300048914 Bacteria 3630
432 Ga0496111_0188957 3300048914 Bacteria 1531
433 Ga0496112_0187205 3300048915 Bacteria 2033
434 Ga0496112_0207975 3300048915 Bacteria 1914
435 Ga0496113_0011072 3300048916 Bacteria 5998
436 Ga0496113_0069739 3300048916 Bacteria 2670
437 Ga0496113_0212919 3300048916 Bacteria 1539
438 Ga0496121_0010589 3300048924 Bacteria 10365
439 Ga0496126_0053449 3300048929 Bacteria 3665
440 Ga0495682_0157303 3300049460 Unclassified 810
441 Ga0501031_0006701 3300049568 Bacteria 7514
442 Ga0501032_0019741 3300049569 Bacteria 4707
443 Ga0501032_0180617 3300049569 Unclassified 1382
444 Ga0501032_0193315 3300049569 Bacteria 1330
445 Ga0501032_0240338 3300049569 Bacteria 1177
446 Ga0501033_0003245 3300049570 Bacteria 13460
447 Ga0501033_0005017 3300049570 Bacteria 10534
448 Ga0501033_0155949 3300049570 Unclassified 1645
449 Ga0501033_0265455 3300049570 Unclassified 1214
450 Ga0501033_0379982 3300049570 Bacteria 987
451 Ga0501034_0012272 3300049571 Bacteria 8855
452 Ga0501034_0251639 3300049571 Bacteria 1711
453 Ga0501036_0008563 3300049572 Bacteria 8389
454 Ga0501036_0754907 3300049572 Unclassified 802
455 Ga0501037_0005971 3300049573 Bacteria 8895
456 Ga0501037_0558214 3300049573 Unclassified 772
457 Ga0501038_0062120 3300049574 Bacteria 3192
458 Ga0501039_0019546 3300049575 Bacteria 5193
459 Ga0501039_0101737 3300049575 Bacteria 2243
460 Ga0501042_0301075 3300049578 Bacteria 1158
461 Ga0501043_0031513 3300049579 Bacteria 4167
462 Ga0501043_0069055 3300049579 Bacteria 2775
463 Ga0501046_0009751 3300049580 Bacteria 8281
464 Ga0501047_0003686 3300049581 Bacteria 14429
465 Ga0501047_0143503 3300049581 Bacteria 2265
466 Ga0501047_0232993 3300049581 Bacteria 1694
467 Ga0501047_0540536 3300049581 Bacteria 990
468 Ga0501047_0557670 3300049581 Bacteria 969
469 Ga0501048_0016185 3300049582 Bacteria 5497
470 Ga0501067_0006874 3300049583 Bacteria 6311
471 Ga0501068_0066220 3300049584 Bacteria 2200
472 Ga0501069_0006001 3300049585 Bacteria 6339
473 Ga0501069_0109808 3300049585 Bacteria 1570
474 Ga0501070_0021516 3300049586 Bacteria 5410
475 Ga0501070_0134668 3300049586 Bacteria 2040
476 Ga0501072_0180030 3300049588 Bacteria 1686
477 Ga0501073_0027979 3300049589 Bacteria 4027
478 Ga0501074_0008997 3300049590 Bacteria 7248
479 Ga0501079_0032817 3300049741 Bacteria 3993
480 Ga0501080_0164088 3300049742 Bacteria 2050
481 Ga0501080_0652266 3300049742 Bacteria 931
482 Ga0501080_1043373 3300049742 Unclassified 708
483 Ga0501083_0068829 3300049744 Bacteria 2355
484 Ga0501035_0219382 3300049822 Bacteria 1624
485 Ga0501035_0264435 3300049822 Bacteria 1457
486 Ga0501035_0339660 3300049822 Bacteria 1258
487 Ga0501035_0442936 3300049822 Unclassified 1075
488 Ga0501044_0012791 3300049823 Bacteria 9088
489 Ga0501044_0025584 3300049823 Bacteria 6257
490 Ga0501044_0051194 3300049823 Bacteria 4258
491 Ga0501044_0299242 3300049823 Bacteria 1538
492 Ga0501044_0332767 3300049823 Unclassified 1441
493 Ga0501044_0438870 3300049823 Bacteria 1214
494 Ga0501044_0687402 3300049823 Bacteria 909
495 Ga0501045_0326647 3300049824 Bacteria 1141
496 nmdc:mga03n38_13522_c1 3300050490 Bacteria 3103
497 nmdc:mga03n38_18520_c1 3300050490 Bacteria 2750
498 nmdc:mga00v17_19459_c1 3300050491 Bacteria 3876
499 nmdc:mga06z11_23099_c1 3300050494 Bacteria 2916
500 nmdc:mga06z11_5829_c1 3300050494 Bacteria 4465
501 nmdc:mga04h51_10790_c1 3300050495 Bacteria 2519
502 nmdc:mga04h51_27767_c1 3300050495 Bacteria 1761
503 nmdc:mga04h51_93143_c1 3300050495 Bacteria 1087
504 nmdc:mga07m45_97141_c1 3300050496 Bacteria 941
505 nmdc:mga0qj67_109999_c1 3300050509 Bacteria 2224
506 nmdc:mga06r32_148493_c1 3300050510 Bacteria 2322
507 nmdc:mga08y16_1962_c1 3300050511 Bacteria 20974
508 nmdc:mga0n895_401064_c1 3300050512 Bacteria 1387
509 nmdc:mga0a205_260079_c2 3300050515 Bacteria 1163
510 Ga0495601_0462862 3300053077 Bacteria 820
511 Ga0500595_000495 3300053119 Bacteria 24037
512 Ga0500595_075291 3300053119 Bacteria 995
513 Ga0500595_103672 3300053119 Unclassified 813
514 Ga0500559_0084244 3300053136 Bacteria 1449
515 Ga0500573_0000002 3300053140 Bacteria 407088
516 Ga0501084_0014160 3300054114 Bacteria 6604
517 Ga0501082_0036248 3300060353 Bacteria 4249
518 Ga0501082_0513691 3300060353 Bacteria 1047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0069739 Ga0496113_0069739_22_489 146
2 3300035398 Ga0316574_0165594 Ga0316574_0165594_69_557 150
3 3300048911 Ga0496108_0373715 Ga0496108_0373715_722_1228 159
4 3300005563 Ga0068855_100436505 Ga0068855_1004365053 168
5 3300005614 Ga0068856_100030867 Ga0068856_1000308673 168
6 3300025321 Ga0207656_10123492 Ga0207656_101234923 168
7 3300025925 Ga0207650_10088828 Ga0207650_100888283 168
8 3300025941 Ga0207711_10067307 Ga0207711_100673073 168
9 3300025986 Ga0207658_10055039 Ga0207658_100550393 168
10 3300026035 Ga0207703_10104326 Ga0207703_101043263 168
11 3300028379 Ga0268266_10110139 Ga0268266_101101391 168
12 3300028381 Ga0268264_10041706 Ga0268264_100417065 168
13 3300009093 Ga0105240_10004235 Ga0105240_100042357 169
14 3300009545 Ga0105237_10064831 Ga0105237_100648314 169
15 3300010375 Ga0105239_10045379 Ga0105239_100453792 169
16 3300025913 Ga0207695_10015721 Ga0207695_100157211 169
17 3300025914 Ga0207671_10076952 Ga0207671_100769523 169
18 3300046557 Ga0495622_0010329 Ga0495622_0010329_2042_2575 170
19 3300005456 Ga0070678_101446793 Ga0070678_1014467931 172
20 3300009176 Ga0105242_11289584 Ga0105242_112895841 172
21 3300013306 Ga0163162_10212027 Ga0163162_102120272 172
22 3300014969 Ga0157376_11137197 Ga0157376_111371971 172
23 3300025934 Ga0207686_10994150 Ga0207686_109941501 172
24 3300026121 Ga0207683_11383652 Ga0207683_113836521 172
25 3300031241 Ga0265325_10015043 Ga0265325_100150433 172
26 3300031249 Ga0265339_10005729 Ga0265339_100057295 172
27 3300031250 Ga0265331_10030306 Ga0265331_100303063 172
28 3300031344 Ga0265316_10782748 Ga0265316_107827481 172
29 3300031711 Ga0265314_10133492 Ga0265314_101334922 172
30 3300053136 Ga0500559_0084244 Ga0500559_0084244_397_936 172
31 3300005328 Ga0070676_10005568 Ga0070676_100055684 173
32 3300005331 Ga0070670_100388600 Ga0070670_1003886003 173
33 3300005334 Ga0068869_100004042 Ga0068869_1000040428 173
34 3300005364 Ga0070673_100006715 Ga0070673_1000067156 173
35 3300005441 Ga0070700_100557227 Ga0070700_1005572272 173
36 3300005459 Ga0068867_100010143 Ga0068867_1000101435 173
37 3300005543 Ga0070672_100430326 Ga0070672_1004303262 173
38 3300005549 Ga0070704_100616058 Ga0070704_1006160582 173
39 3300005577 Ga0068857_100228862 Ga0068857_1002288622 173
40 3300006881 Ga0068865_100116236 Ga0068865_1001162363 173
41 3300009148 Ga0105243_10005622 Ga0105243_100056225 173
42 3300009176 Ga0105242_10332324 Ga0105242_103323242 173
43 3300013100 Ga0157373_10071561 Ga0157373_100715611 173
44 3300013297 Ga0157378_10286860 Ga0157378_102868603 173
45 3300014326 Ga0157380_10292957 Ga0157380_102929572 173
46 3300025934 Ga0207686_10332756 Ga0207686_103327562 173
47 3300025935 Ga0207709_10013563 Ga0207709_100135632 173
48 3300025938 Ga0207704_10106631 Ga0207704_101066311 173
49 3300025940 Ga0207691_10167868 Ga0207691_101678682 173
50 3300025942 Ga0207689_10013474 Ga0207689_100134743 173
51 3300025960 Ga0207651_10038431 Ga0207651_100384311 173
52 3300026075 Ga0207708_10648007 Ga0207708_106480072 173
53 3300026089 Ga0207648_10016331 Ga0207648_100163316 173
54 3300049568 Ga0501031_0006701 Ga0501031_0006701_2071_2601 173
55 3300049569 Ga0501032_0019741 Ga0501032_0019741_1224_1754 173
56 3300049569 Ga0501032_0240338 Ga0501032_0240338_440_970 173
57 3300049570 Ga0501033_0003245 Ga0501033_0003245_151_687 173
58 3300049570 Ga0501033_0005017 Ga0501033_0005017_3515_4045 173
59 3300049570 Ga0501033_0265455 Ga0501033_0265455_118_648 173
60 3300049570 Ga0501033_0379982 Ga0501033_0379982_260_796 173
61 3300049571 Ga0501034_0012272 Ga0501034_0012272_4378_4908 173
62 3300049571 Ga0501034_0251639 Ga0501034_0251639_989_1519 173
63 3300049572 Ga0501036_0008563 Ga0501036_0008563_3931_4461 173
64 3300049573 Ga0501037_0005971 Ga0501037_0005971_3150_3680 173
65 3300049574 Ga0501038_0062120 Ga0501038_0062120_2253_2783 173
66 3300049575 Ga0501039_0019546 Ga0501039_0019546_4506_5036 173
67 3300049578 Ga0501042_0301075 Ga0501042_0301075_111_641 173
68 3300049579 Ga0501043_0031513 Ga0501043_0031513_2381_2911 173
69 3300049580 Ga0501046_0009751 Ga0501046_0009751_7133_7663 173
70 3300049581 Ga0501047_0003686 Ga0501047_0003686_7176_7712 173
71 3300049581 Ga0501047_0143503 Ga0501047_0143503_831_1361 173
72 3300049581 Ga0501047_0557670 Ga0501047_0557670_410_940 173
73 3300049582 Ga0501048_0016185 Ga0501048_0016185_1818_2348 173
74 3300049583 Ga0501067_0006874 Ga0501067_0006874_3691_4221 173
75 3300049584 Ga0501068_0066220 Ga0501068_0066220_1609_2139 173
76 3300049585 Ga0501069_0006001 Ga0501069_0006001_4265_4795 173
77 3300049585 Ga0501069_0109808 Ga0501069_0109808_666_1196 173
78 3300049586 Ga0501070_0021516 Ga0501070_0021516_3687_4217 173
79 3300049586 Ga0501070_0134668 Ga0501070_0134668_851_1381 173
80 3300049588 Ga0501072_0180030 Ga0501072_0180030_559_1089 173
81 3300049589 Ga0501073_0027979 Ga0501073_0027979_410_940 173
82 3300049590 Ga0501074_0008997 Ga0501074_0008997_2828_3358 173
83 3300049741 Ga0501079_0032817 Ga0501079_0032817_1382_1912 173
84 3300049742 Ga0501080_0164088 Ga0501080_0164088_874_1404 173
85 3300049742 Ga0501080_0652266 Ga0501080_0652266_378_908 173
86 3300049742 Ga0501080_1043373 Ga0501080_1043373_128_664 173
87 3300049744 Ga0501083_0068829 Ga0501083_0068829_350_880 173
88 3300049822 Ga0501035_0339660 Ga0501035_0339660_571_1101 173
89 3300049822 Ga0501035_0442936 Ga0501035_0442936_501_1037 173
90 3300049823 Ga0501044_0012791 Ga0501044_0012791_6526_7062 173
91 3300049823 Ga0501044_0025584 Ga0501044_0025584_4270_4806 173
92 3300049823 Ga0501044_0051194 Ga0501044_0051194_3082_3612 173
93 3300049823 Ga0501044_0299242 Ga0501044_0299242_233_763 173
94 3300049824 Ga0501045_0326647 Ga0501045_0326647_362_892 173
95 3300054114 Ga0501084_0014160 Ga0501084_0014160_3879_4409 173
96 3300060353 Ga0501082_0036248 Ga0501082_0036248_489_1019 173
97 3300060353 Ga0501082_0513691 Ga0501082_0513691_309_839 173
98 3300005327 Ga0070658_10804366 Ga0070658_108043661 174
99 3300005330 Ga0070690_100138178 Ga0070690_1001381783 174
100 3300005331 Ga0070670_100275815 Ga0070670_1002758152 174
101 3300005335 Ga0070666_10011596 Ga0070666_100115963 174
102 3300005355 Ga0070671_100051866 Ga0070671_1000518662 174
103 3300005367 Ga0070667_100019174 Ga0070667_1000191744 174
104 3300005458 Ga0070681_10716540 Ga0070681_107165402 174
105 3300005535 Ga0070684_100013241 Ga0070684_1000132412 174
106 3300005544 Ga0070686_100954469 Ga0070686_1009544691 174
107 3300005616 Ga0068852_100875197 Ga0068852_1008751972 174
108 3300005842 Ga0068858_100038647 Ga0068858_1000386472 174
109 3300005843 Ga0068860_100076593 Ga0068860_1000765932 174
110 3300006358 Ga0068871_100065339 Ga0068871_1000653392 174
111 3300009093 Ga0105240_10262682 Ga0105240_102626821 174
112 3300009098 Ga0105245_10565404 Ga0105245_105654042 174
113 3300009148 Ga0105243_11198210 Ga0105243_111982101 174
114 3300009551 Ga0105238_10153826 Ga0105238_101538264 174
115 3300011119 Ga0105246_10056091 Ga0105246_100560911 174
116 3300013296 Ga0157374_10048422 Ga0157374_100484223 174
117 3300013296 Ga0157374_10384280 Ga0157374_103842801 174
118 3300013306 Ga0163162_10147826 Ga0163162_101478263 174
119 3300013307 Ga0157372_10087470 Ga0157372_100874701 174
120 3300014325 Ga0163163_10008914 Ga0163163_1000891410 174
121 3300025903 Ga0207680_10007310 Ga0207680_100073106 174
122 3300025924 Ga0207694_10116918 Ga0207694_101169182 174
123 3300025927 Ga0207687_10067867 Ga0207687_100678673 174
124 3300025942 Ga0207689_10664952 Ga0207689_106649521 174
125 3300025944 Ga0207661_10616717 Ga0207661_106167172 174
126 3300025945 Ga0207679_10769756 Ga0207679_107697561 174
127 3300025949 Ga0207667_10711216 Ga0207667_107112161 174
128 3300031730 Ga0307516_10024072 Ga0307516_100240725 174
129 3300048924 Ga0496121_0010589 Ga0496121_0010589_3532_4065 174
130 3300048929 Ga0496126_0053449 Ga0496126_0053449_1322_1858 174
131 3300003215 JGI25153J46596_10000749 JGI25153J46596_1000074918 175
132 3300005327 Ga0070658_10012520 Ga0070658_100125207 175
133 3300005327 Ga0070658_10098376 Ga0070658_100983762 175
134 3300005327 Ga0070658_11248381 Ga0070658_112483811 175
135 3300005328 Ga0070676_10264452 Ga0070676_102644521 175
136 3300005335 Ga0070666_10306955 Ga0070666_103069552 175
137 3300005338 Ga0068868_100496255 Ga0068868_1004962552 175
138 3300005339 Ga0070660_100250906 Ga0070660_1002509061 175
139 3300005458 Ga0070681_10025544 Ga0070681_100255443 175
140 3300005530 Ga0070679_100017468 Ga0070679_1000174687 175
141 3300005539 Ga0068853_100452608 Ga0068853_1004526081 175
142 3300005548 Ga0070665_100016874 Ga0070665_1000168745 175
143 3300005548 Ga0070665_100500823 Ga0070665_1005008232 175
144 3300005563 Ga0068855_100367944 Ga0068855_1003679442 175
145 3300005616 Ga0068852_100630550 Ga0068852_1006305502 175
146 3300006237 Ga0097621_100017838 Ga0097621_1000178384 175
147 3300006237 Ga0097621_100206491 Ga0097621_1002064913 175
148 3300006358 Ga0068871_100002366 Ga0068871_1000023668 175
149 3300006358 Ga0068871_100029452 Ga0068871_1000294524 175
150 3300006358 Ga0068871_100070132 Ga0068871_1000701323 175
151 3300006881 Ga0068865_100050827 Ga0068865_1000508272 175
152 3300009093 Ga0105240_10016143 Ga0105240_100161438 175
153 3300009093 Ga0105240_10188526 Ga0105240_101885263 175
154 3300009093 Ga0105240_10450864 Ga0105240_104508642 175
155 3300009093 Ga0105240_10764049 Ga0105240_107640492 175
156 3300009174 Ga0105241_10247126 Ga0105241_102471262 175
157 3300009174 Ga0105241_10324570 Ga0105241_103245702 175
158 3300009174 Ga0105241_10468496 Ga0105241_104684962 175
159 3300009176 Ga0105242_10734732 Ga0105242_107347322 175
160 3300009545 Ga0105237_10017383 Ga0105237_100173838 175
161 3300009545 Ga0105237_10879034 Ga0105237_108790342 175
162 3300009545 Ga0105237_11058485 Ga0105237_110584851 175
163 3300009551 Ga0105238_10048838 Ga0105238_100488387 175
164 3300009551 Ga0105238_10058728 Ga0105238_100587284 175
165 3300010375 Ga0105239_10502911 Ga0105239_105029112 175
166 3300010375 Ga0105239_10747028 Ga0105239_107470282 175
167 3300010375 Ga0105239_11192646 Ga0105239_111926462 175
168 3300013104 Ga0157370_10031087 Ga0157370_100310874 175
169 3300013296 Ga0157374_10453760 Ga0157374_104537602 175
170 3300013297 Ga0157378_10180011 Ga0157378_101800112 175
171 3300013307 Ga0157372_12138560 Ga0157372_121385601 175
172 3300025297 Ga0209758_1000013 Ga0209758_1000013194 175
173 3300025903 Ga0207680_10170768 Ga0207680_101707683 175
174 3300025909 Ga0207705_10038669 Ga0207705_100386693 175
175 3300025909 Ga0207705_10148386 Ga0207705_101483862 175
176 3300025911 Ga0207654_10057275 Ga0207654_100572753 175
177 3300025911 Ga0207654_10528608 Ga0207654_105286082 175
178 3300025912 Ga0207707_10188209 Ga0207707_101882093 175
179 3300025913 Ga0207695_10092065 Ga0207695_100920652 175
180 3300025913 Ga0207695_10514454 Ga0207695_105144541 175
181 3300025914 Ga0207671_10224643 Ga0207671_102246432 175
182 3300025924 Ga0207694_10118282 Ga0207694_101182823 175
183 3300025924 Ga0207694_10212203 Ga0207694_102122032 175
184 3300025932 Ga0207690_10066538 Ga0207690_100665383 175
185 3300025938 Ga0207704_10205505 Ga0207704_102055052 175
186 3300025942 Ga0207689_10736067 Ga0207689_107360671 175
187 3300025949 Ga0207667_10381985 Ga0207667_103819852 175
188 3300026041 Ga0207639_10397506 Ga0207639_103975062 175
189 3300026089 Ga0207648_10678172 Ga0207648_106781722 175
190 3300026142 Ga0207698_10894157 Ga0207698_108941572 175
191 3300028379 Ga0268266_10147846 Ga0268266_101478462 175
192 3300028379 Ga0268266_10241774 Ga0268266_102417742 175
193 3300028379 Ga0268266_10243248 Ga0268266_102432482 175
194 3300028379 Ga0268266_10513242 Ga0268266_105132422 175
195 3300037466 Ga0395898_0523201 Ga0395898_0523201_280_819 175
196 3300046642 Ga0495634_0367724 Ga0495634_0367724_188_727 175
197 3300049569 Ga0501032_0193315 Ga0501032_0193315_632_1180 175
198 3300049575 Ga0501039_0101737 Ga0501039_0101737_1648_2196 175
199 3300049579 Ga0501043_0069055 Ga0501043_0069055_2213_2761 175
200 3300049581 Ga0501047_0540536 Ga0501047_0540536_329_877 175
201 3300049822 Ga0501035_0264435 Ga0501035_0264435_135_683 175
202 3300049823 Ga0501044_0438870 Ga0501044_0438870_251_799 175
203 3300049823 Ga0501044_0687402 Ga0501044_0687402_28_576 175
204 3300053119 Ga0500595_075291 Ga0500595_075291_122_658 175
205 3300053119 Ga0500595_103672 Ga0500595_103672_55_597 175
206 3300003214 JGI25165J46597_1000036 JGI25165J46597_1000036133 176
207 3300005328 Ga0070676_10208761 Ga0070676_102087613 176
208 3300005329 Ga0070683_100533308 Ga0070683_1005333082 176
209 3300005331 Ga0070670_101087499 Ga0070670_1010874991 176
210 3300005334 Ga0068869_100464166 Ga0068869_1004641661 176
211 3300005355 Ga0070671_100242211 Ga0070671_1002422113 176
212 3300005434 Ga0070709_10082283 Ga0070709_100822831 176
213 3300005456 Ga0070678_100014580 Ga0070678_1000145805 176
214 3300005548 Ga0070665_100022162 Ga0070665_1000221623 176
215 3300005548 Ga0070665_100325628 Ga0070665_1003256283 176
216 3300005577 Ga0068857_100642607 Ga0068857_1006426072 176
217 3300005718 Ga0068866_10016288 Ga0068866_100162882 176
218 3300005719 Ga0068861_101479040 Ga0068861_1014790401 176
219 3300005840 Ga0068870_10077981 Ga0068870_100779813 176
220 3300005841 Ga0068863_100442596 Ga0068863_1004425961 176
221 3300005843 Ga0068860_100027664 Ga0068860_1000276642 176
222 3300006237 Ga0097621_100013144 Ga0097621_1000131446 176
223 3300006237 Ga0097621_100225882 Ga0097621_1002258823 176
224 3300006237 Ga0097621_100500454 Ga0097621_1005004542 176
225 3300006358 Ga0068871_100120619 Ga0068871_1001206193 176
226 3300006881 Ga0068865_100003964 Ga0068865_1000039646 176
227 3300006881 Ga0068865_101505273 Ga0068865_1015052731 176
228 3300009093 Ga0105240_10088492 Ga0105240_100884922 176
229 3300009093 Ga0105240_10365393 Ga0105240_103653932 176
230 3300009093 Ga0105240_10443378 Ga0105240_104433781 176
231 3300009098 Ga0105245_10016459 Ga0105245_100164598 176
232 3300009101 Ga0105247_10272533 Ga0105247_102725331 176
233 3300009174 Ga0105241_10062101 Ga0105241_100621013 176
234 3300009174 Ga0105241_10062243 Ga0105241_100622433 176
235 3300009174 Ga0105241_10449743 Ga0105241_104497432 176
236 3300009176 Ga0105242_10068091 Ga0105242_100680913 176
237 3300009176 Ga0105242_10343336 Ga0105242_103433361 176
238 3300009545 Ga0105237_10071537 Ga0105237_100715372 176
239 3300009551 Ga0105238_10018006 Ga0105238_100180066 176
240 3300009553 Ga0105249_10123629 Ga0105249_101236293 176
241 3300009553 Ga0105249_11463366 Ga0105249_114633662 176
242 3300010375 Ga0105239_10361614 Ga0105239_103616142 176
243 3300010375 Ga0105239_10431645 Ga0105239_104316452 176
244 3300010375 Ga0105239_10674992 Ga0105239_106749922 176
245 3300010375 Ga0105239_11022825 Ga0105239_110228251 176
246 3300010375 Ga0105239_11451878 Ga0105239_114518781 176
247 3300013296 Ga0157374_10045508 Ga0157374_100455084 176
248 3300013297 Ga0157378_10015768 Ga0157378_100157684 176
249 3300013306 Ga0163162_10016922 Ga0163162_100169225 176
250 3300013308 Ga0157375_10009529 Ga0157375_100095295 176
251 3300014325 Ga0163163_10094749 Ga0163163_100947492 176
252 3300014968 Ga0157379_10000040 Ga0157379_1000004068 176
253 3300014968 Ga0157379_10049147 Ga0157379_100491474 176
254 3300014968 Ga0157379_10064355 Ga0157379_100643552 176
255 3300014968 Ga0157379_10222056 Ga0157379_102220561 176
256 3300014969 Ga0157376_10037372 Ga0157376_100373723 176
257 3300025261 Ga0209233_1000015 Ga0209233_1000015911 176
258 3300025261 Ga0209233_1002448 Ga0209233_10024484 176
259 3300025899 Ga0207642_10056340 Ga0207642_100563402 176
260 3300025906 Ga0207699_10582884 Ga0207699_105828841 176
261 3300025907 Ga0207645_10154189 Ga0207645_101541892 176
262 3300025911 Ga0207654_10074194 Ga0207654_100741943 176
263 3300025911 Ga0207654_10086145 Ga0207654_100861452 176
264 3300025913 Ga0207695_10058798 Ga0207695_100587985 176
265 3300025913 Ga0207695_10388444 Ga0207695_103884441 176
266 3300025919 Ga0207657_10675848 Ga0207657_106758481 176
267 3300025924 Ga0207694_10021008 Ga0207694_100210083 176
268 3300025927 Ga0207687_10294057 Ga0207687_102940572 176
269 3300025936 Ga0207670_10541935 Ga0207670_105419352 176
270 3300025938 Ga0207704_10011340 Ga0207704_100113404 176
271 3300025941 Ga0207711_10016344 Ga0207711_100163446 176
272 3300025944 Ga0207661_10404147 Ga0207661_104041472 176
273 3300025961 Ga0207712_10370691 Ga0207712_103706912 176
274 3300026035 Ga0207703_10011250 Ga0207703_100112502 176
275 3300026067 Ga0207678_10389647 Ga0207678_103896473 176
276 3300026088 Ga0207641_10281168 Ga0207641_102811682 176
277 3300026088 Ga0207641_10435325 Ga0207641_104353253 176
278 3300026095 Ga0207676_10799366 Ga0207676_107993662 176
279 3300026116 Ga0207674_11196197 Ga0207674_111961971 176
280 3300026121 Ga0207683_10031104 Ga0207683_100311046 176
281 3300028379 Ga0268266_10009169 Ga0268266_100091692 176
282 3300028379 Ga0268266_10011803 Ga0268266_100118035 176
283 3300028379 Ga0268266_10026592 Ga0268266_100265923 176
284 3300028381 Ga0268264_10038353 Ga0268264_100383537 176
285 3300028577 Ga0265318_10000062 Ga0265318_1000006266 176
286 3300028800 Ga0265338_10422807 Ga0265338_104228071 176
287 3300031249 Ga0265339_10149722 Ga0265339_101497222 176
288 3300031250 Ga0265331_10011240 Ga0265331_100112403 176
289 3300031250 Ga0265331_10056157 Ga0265331_100561571 176
290 3300031344 Ga0265316_10409220 Ga0265316_104092202 176
291 3300031730 Ga0307516_10062949 Ga0307516_100629494 176
292 3300035691 Ga0373931_0023522 Ga0373931_0023522_2135_2680 176
293 3300039438 Ga0436360_0549383 Ga0436360_0549383_89_655 176
294 3300046492 Ga0495585_0137289 Ga0495585_0137289_693_1238 176
295 3300046517 Ga0495630_0640500 Ga0495630_0640500_207_752 176
296 3300046539 Ga0495621_0028117 Ga0495621_0028117_849_1394 176
297 3300046615 Ga0495656_0096075 Ga0495656_0096075_47_592 176
298 3300046642 Ga0495634_0172549 Ga0495634_0172549_746_1318 176
299 3300046684 Ga0495669_0078171 Ga0495669_0078171_936_1481 176
300 3300046690 Ga0495624_0198063 Ga0495624_0198063_297_905 176
301 3300046794 Ga0495589_0160149 Ga0495589_0160149_316_861 176
302 3300047315 Ga0495581_0362392 Ga0495581_0362392_169_741 176
303 3300047319 Ga0495674_0103474 Ga0495674_0103474_1719_2336 176
304 3300049460 Ga0495682_0157303 Ga0495682_0157303_237_791 176
305 3300049569 Ga0501032_0180617 Ga0501032_0180617_817_1356 176
306 3300049570 Ga0501033_0155949 Ga0501033_0155949_207_746 176
307 3300049572 Ga0501036_0754907 Ga0501036_0754907_182_721 176
308 3300049573 Ga0501037_0558214 Ga0501037_0558214_58_597 176
309 3300049581 Ga0501047_0232993 Ga0501047_0232993_886_1452 176
310 3300049822 Ga0501035_0219382 Ga0501035_0219382_17_583 176
311 3300049823 Ga0501044_0332767 Ga0501044_0332767_195_734 176
312 3300053119 Ga0500595_000495 Ga0500595_000495_3866_4411 176
313 3300053140 Ga0500573_0000002 Ga0500573_0000002_266829_267374 176
314 3300005719 Ga0068861_100122421 Ga0068861_1001224212 177
315 3300005843 Ga0068860_100698583 Ga0068860_1006985832 177
316 3300005844 Ga0068862_100100723 Ga0068862_1001007232 177
317 3300005983 Ga0081540_1102008 Ga0081540_11020081 177
318 3300006042 Ga0075368_10004565 Ga0075368_100045653 177
319 3300006042 Ga0075368_10015178 Ga0075368_100151783 177
320 3300006042 Ga0075368_10084120 Ga0075368_100841202 177
321 3300006048 Ga0075363_100032631 Ga0075363_1000326313 177
322 3300006051 Ga0075364_10141481 Ga0075364_101414811 177
323 3300006178 Ga0075367_10019913 Ga0075367_100199134 177
324 3300006178 Ga0075367_10081817 Ga0075367_100818172 177
325 3300006178 Ga0075367_10206000 Ga0075367_102060002 177
326 3300006844 Ga0075428_100030684 Ga0075428_1000306843 177
327 3300006847 Ga0075431_100100106 Ga0075431_1001001063 177
328 3300009094 Ga0111539_11400240 Ga0111539_114002402 177
329 3300009147 Ga0114129_10025299 Ga0114129_100252995 177
330 3300014326 Ga0157380_10951027 Ga0157380_109510272 177
331 3300026118 Ga0207675_100193794 Ga0207675_1001937943 177
332 3300027866 Ga0209813_10009195 Ga0209813_100091952 177
333 3300027866 Ga0209813_10077878 Ga0209813_100778782 177
334 3300027866 Ga0209813_10090630 Ga0209813_100906302 177
335 3300028379 Ga0268266_10434002 Ga0268266_104340021 177
336 3300035691 Ga0373931_0170634 Ga0373931_0170634_400_972 177
337 3300048907 Ga0496104_0000708 Ga0496104_0000708_21158_21730 177
338 3300048908 Ga0496105_0052333 Ga0496105_0052333_2405_2977 177
339 3300048913 Ga0496110_0000532 Ga0496110_0000532_14691_15263 177
340 3300048914 Ga0496111_0034152 Ga0496111_0034152_2912_3484 177
341 3300048915 Ga0496112_0187205 Ga0496112_0187205_1069_1641 177
342 3300050490 nmdc:mga03n38_13522_c1 nmdc:mga03n38_13522_c1_501_1073 177
343 3300050490 nmdc:mga03n38_18520_c1 nmdc:mga03n38_18520_c1_1691_2263 177
344 3300050491 nmdc:mga00v17_19459_c1 nmdc:mga00v17_19459_c1_346_918 177
345 3300050494 nmdc:mga06z11_23099_c1 nmdc:mga06z11_23099_c1_493_1065 177
346 3300050494 nmdc:mga06z11_5829_c1 nmdc:mga06z11_5829_c1_2231_2803 177
347 3300050495 nmdc:mga04h51_10790_c1 nmdc:mga04h51_10790_c1_384_956 177
348 3300050495 nmdc:mga04h51_27767_c1 nmdc:mga04h51_27767_c1_376_948 177
349 3300050495 nmdc:mga04h51_93143_c1 nmdc:mga04h51_93143_c1_80_652 177
350 3300050496 nmdc:mga07m45_97141_c1 nmdc:mga07m45_97141_c1_213_785 177
351 3300050509 nmdc:mga0qj67_109999_c1 nmdc:mga0qj67_109999_c1_629_1207 177
352 3300050510 nmdc:mga06r32_148493_c1 nmdc:mga06r32_148493_c1_1463_2041 177
353 3300001915 JGI24741J21665_1001146 JGI24741J21665_10011468 178
354 3300004799 Ga0058863_11569301 Ga0058863_115693011 178
355 3300005345 Ga0070692_10052618 Ga0070692_100526183 178
356 3300005535 Ga0070684_100590971 Ga0070684_1005909711 178
357 3300013100 Ga0157373_10048140 Ga0157373_100481403 178
358 3300025917 Ga0207660_10114725 Ga0207660_101147252 178
359 3300025917 Ga0207660_10254278 Ga0207660_102542782 178
360 3300025921 Ga0207652_10010243 Ga0207652_100102432 178
361 3300025944 Ga0207661_10278040 Ga0207661_102780401 178
362 3300026116 Ga0207674_10024484 Ga0207674_100244847 178
363 3300042005 Ga0439448_0047286 Ga0439448_0047286_582_1118 178
364 2209111006 2214544919 2213593372 179
365 3300000041 ARcpr5oldR_c000002 ARcpr5oldR_00000260 179
366 3300000042 ARSoilYngRDRAFT_c00003 ARSoilYngRDRAFT_0000342 179
367 3300000043 ARcpr5yngRDRAFT_c000036 ARcpr5yngRDRAFT_0000366 179
368 3300000044 ARSoilOldRDRAFT_c000002 ARSoilOldRDRAFT_00000218 179
369 3300000045 ARCol0oldRDRAFT_c01261 ARCol0oldRDRAFT_012612 179
370 3300000652 ARCol0yngRDRAFT_1000005 ARCol0yngRDRAFT_100000529 179
371 3300001990 JGI24737J22298_10012980 JGI24737J22298_100129804 179
372 3300005276 Ga0065717_1004119 Ga0065717_10041192 179
373 3300005277 Ga0065716_1001630 Ga0065716_10016303 179
374 3300005288 Ga0065714_10247510 Ga0065714_102475101 179
375 3300005289 Ga0065704_10093501 Ga0065704_100935013 179
376 3300005290 Ga0065712_10195652 Ga0065712_101956522 179
377 3300005293 Ga0065715_10028878 Ga0065715_100288781 179
378 3300005293 Ga0065715_10216738 Ga0065715_102167383 179
379 3300005295 Ga0065707_10152070 Ga0065707_101520702 179
380 3300005328 Ga0070676_10134842 Ga0070676_101348422 179
381 3300005330 Ga0070690_100044297 Ga0070690_1000442972 179
382 3300005330 Ga0070690_100343378 Ga0070690_1003433781 179
383 3300005334 Ga0068869_100305001 Ga0068869_1003050012 179
384 3300005335 Ga0070666_10030835 Ga0070666_100308351 179
385 3300005336 Ga0070680_100040530 Ga0070680_1000405304 179
386 3300005337 Ga0070682_100025284 Ga0070682_1000252845 179
387 3300005340 Ga0070689_100144157 Ga0070689_1001441573 179
388 3300005340 Ga0070689_100210042 Ga0070689_1002100422 179
389 3300005343 Ga0070687_100017172 Ga0070687_1000171725 179
390 3300005343 Ga0070687_100512038 Ga0070687_1005120381 179
391 3300005344 Ga0070661_100506679 Ga0070661_1005066792 179
392 3300005345 Ga0070692_10405656 Ga0070692_104056561 179
393 3300005347 Ga0070668_100365897 Ga0070668_1003658972 179
394 3300005353 Ga0070669_100838768 Ga0070669_1008387681 179
395 3300005354 Ga0070675_100034115 Ga0070675_1000341155 179
396 3300005356 Ga0070674_100135155 Ga0070674_1001351552 179
397 3300005366 Ga0070659_100025520 Ga0070659_1000255204 179
398 3300005367 Ga0070667_100638624 Ga0070667_1006386241 179
399 3300005438 Ga0070701_10035199 Ga0070701_100351994 179
400 3300005441 Ga0070700_100151921 Ga0070700_1001519212 179
401 3300005444 Ga0070694_100062681 Ga0070694_1000626813 179
402 3300005444 Ga0070694_100092775 Ga0070694_1000927753 179
403 3300005445 Ga0070708_100932554 Ga0070708_1009325542 179
404 3300005455 Ga0070663_100147614 Ga0070663_1001476142 179
405 3300005455 Ga0070663_100420549 Ga0070663_1004205492 179
406 3300005456 Ga0070678_100781031 Ga0070678_1007810312 179
407 3300005457 Ga0070662_100194159 Ga0070662_1001941592 179
408 3300005458 Ga0070681_10884231 Ga0070681_108842311 179
409 3300005530 Ga0070679_100155859 Ga0070679_1001558592 179
410 3300005539 Ga0068853_100080810 Ga0068853_1000808102 179
411 3300005544 Ga0070686_100039790 Ga0070686_1000397904 179
412 3300005544 Ga0070686_100203126 Ga0070686_1002031262 179
413 3300005545 Ga0070695_100011498 Ga0070695_1000114983 179
414 3300005546 Ga0070696_100039960 Ga0070696_1000399604 179
415 3300005547 Ga0070693_100147309 Ga0070693_1001473092 179
416 3300005549 Ga0070704_100583581 Ga0070704_1005835812 179
417 3300005549 Ga0070704_100893771 Ga0070704_1008937711 179
418 3300005564 Ga0070664_100354224 Ga0070664_1003542242 179
419 3300005577 Ga0068857_100356621 Ga0068857_1003566212 179
420 3300005617 Ga0068859_100211943 Ga0068859_1002119432 179
421 3300005618 Ga0068864_100214246 Ga0068864_1002142462 179
422 3300005842 Ga0068858_100356430 Ga0068858_1003564302 179
423 3300005843 Ga0068860_100050261 Ga0068860_1000502616 179
424 3300005843 Ga0068860_100287302 Ga0068860_1002873022 179
425 3300005844 Ga0068862_100100343 Ga0068862_1001003432 179
426 3300006871 Ga0075434_100379778 Ga0075434_1003797783 179
427 3300006881 Ga0068865_100069138 Ga0068865_1000691384 179
428 3300006931 Ga0097620_100211943 Ga0097620_1002119432 179
429 3300009094 Ga0111539_10000114 Ga0111539_1000011482 179
430 3300009098 Ga0105245_10483578 Ga0105245_104835782 179
431 3300009101 Ga0105247_10189707 Ga0105247_101897072 179
432 3300009101 Ga0105247_10295039 Ga0105247_102950393 179
433 3300009148 Ga0105243_10004109 Ga0105243_1000410914 179
434 3300009176 Ga0105242_10468072 Ga0105242_104680723 179
435 3300009177 Ga0105248_10143301 Ga0105248_101433012 179
436 3300009177 Ga0105248_10729967 Ga0105248_107299671 179
437 3300009553 Ga0105249_10143225 Ga0105249_101432252 179
438 3300010375 Ga0105239_10831689 Ga0105239_108316892 179
439 3300012502 Ga0157347_1000726 Ga0157347_10007263 179
440 3300012505 Ga0157339_1000999 Ga0157339_10009992 179
441 3300013102 Ga0157371_10414166 Ga0157371_104141661 179
442 3300013105 Ga0157369_10714991 Ga0157369_107149912 179
443 3300013297 Ga0157378_11276595 Ga0157378_112765952 179
444 3300013306 Ga0163162_10002587 Ga0163162_1000258717 179
445 3300013308 Ga0157375_10147113 Ga0157375_101471133 179
446 3300014325 Ga0163163_10227207 Ga0163163_102272073 179
447 3300014326 Ga0157380_10054953 Ga0157380_100549532 179
448 3300014497 Ga0182008_10123780 Ga0182008_101237802 179
449 3300014968 Ga0157379_10179881 Ga0157379_101798812 179
450 3300014968 Ga0157379_10283380 Ga0157379_102833802 179
451 3300025315 Ga0207697_10165242 Ga0207697_101652422 179
452 3300025900 Ga0207710_10019022 Ga0207710_100190222 179
453 3300025903 Ga0207680_10270123 Ga0207680_102701232 179
454 3300025904 Ga0207647_10099203 Ga0207647_100992032 179
455 3300025912 Ga0207707_10115985 Ga0207707_101159853 179
456 3300025917 Ga0207660_10136457 Ga0207660_101364573 179
457 3300025918 Ga0207662_10185158 Ga0207662_101851582 179
458 3300025919 Ga0207657_10007556 Ga0207657_100075564 179
459 3300025921 Ga0207652_10697808 Ga0207652_106978082 179
460 3300025933 Ga0207706_10078096 Ga0207706_100780962 179
461 3300025933 Ga0207706_10154719 Ga0207706_101547193 179
462 3300025935 Ga0207709_10197141 Ga0207709_101971412 179
463 3300025936 Ga0207670_10117964 Ga0207670_101179642 179
464 3300025938 Ga0207704_10267838 Ga0207704_102678383 179
465 3300025941 Ga0207711_11270291 Ga0207711_112702912 179
466 3300025942 Ga0207689_10360652 Ga0207689_103606522 179
467 3300025986 Ga0207658_10471398 Ga0207658_104713982 179
468 3300026035 Ga0207703_10457267 Ga0207703_104572672 179
469 3300026067 Ga0207678_10110899 Ga0207678_101108994 179
470 3300026067 Ga0207678_10168792 Ga0207678_101687922 179
471 3300026075 Ga0207708_10064875 Ga0207708_100648752 179
472 3300026088 Ga0207641_10208019 Ga0207641_102080193 179
473 3300026095 Ga0207676_10195586 Ga0207676_101955862 179
474 3300027695 Ga0209966_1000715 Ga0209966_10007154 179
475 3300027717 Ga0209998_10001566 Ga0209998_100015667 179
476 3300027876 Ga0209974_10107272 Ga0209974_101072721 179
477 3300027907 Ga0207428_10000312 Ga0207428_1000031250 179
478 3300028380 Ga0268265_10269348 Ga0268265_102693482 179
479 3300028381 Ga0268264_10361753 Ga0268264_103617533 179
480 3300034816 Ga0373930_0070802 Ga0373930_0070802_171_710 179
481 3300034817 Ga0373948_0000057 Ga0373948_0000057_10358_10897 179
482 3300034820 Ga0373959_0001333 Ga0373959_0001333_1217_1756 179
483 3300034957 Ga0373938_0000183 Ga0373938_0000183_4667_5206 179
484 3300035084 Ga0373928_0007054 Ga0373928_0007054_740_1279 179
485 3300035085 Ga0373929_0001928 Ga0373929_0001928_492_1031 179
486 3300035088 Ga0373940_0000441 Ga0373940_0000441_3097_3636 179
487 3300035090 Ga0373949_0005187 Ga0373949_0005187_2069_2608 179
488 3300035091 Ga0373951_0000340 Ga0373951_0000340_7136_7675 179
489 3300035092 Ga0373952_0001763 Ga0373952_0001763_87_626 179
490 3300035112 Ga0373932_0002354 Ga0373932_0002354_3013_3552 179
491 3300035115 Ga0373941_0000123 Ga0373941_0000123_2119_2658 179
492 3300035121 Ga0373960_0001052 Ga0373960_0001052_2967_3506 179
493 3300035207 Ga0373942_0001157 Ga0373942_0001157_2839_3378 179
494 3300035241 Ga0373961_0003676 Ga0373961_0003676_2707_3246 179
495 3300035242 Ga0373962_0001031 Ga0373962_0001031_4837_5376 179
496 3300035242 Ga0373962_0193594 Ga0373962_0193594_87_626 179
497 3300035691 Ga0373931_0048851 Ga0373931_0048851_589_1128 179
498 3300036401 Ga0373937_0432209 Ga0373937_0432209_333_875 179
499 3300042876 Ga0451577_0118237 Ga0451577_0118237_79_618 179
500 3300044712 Ga0453684_0087128 Ga0453684_0087128_626_1165 179
501 3300045051 Ga0451576_0043535 Ga0451576_0043535_2991_3530 179
502 3300048904 Ga0496101_0932106 Ga0496101_0932106_128_667 179
503 3300048905 Ga0496102_0051431 Ga0496102_0051431_2718_3257 179
504 3300048909 Ga0496106_0022665 Ga0496106_0022665_2556_3095 179
505 3300048910 Ga0496107_0038731 Ga0496107_0038731_187_726 179
506 3300048910 Ga0496107_0209537 Ga0496107_0209537_445_984 179
507 3300048911 Ga0496108_0002753 Ga0496108_0002753_13260_13799 179
508 3300048912 Ga0496109_0027728 Ga0496109_0027728_1436_1975 179
509 3300048912 Ga0496109_0046963 Ga0496109_0046963_3214_3753 179
510 3300048913 Ga0496110_0172389 Ga0496110_0172389_802_1341 179
511 3300048914 Ga0496111_0188957 Ga0496111_0188957_550_1089 179
512 3300048915 Ga0496112_0207975 Ga0496112_0207975_103_642 179
513 3300048916 Ga0496113_0011072 Ga0496113_0011072_933_1472 179
514 3300048916 Ga0496113_0212919 Ga0496113_0212919_323_862 179
515 3300050511 nmdc:mga08y16_1962_c1 nmdc:mga08y16_1962_c1_3887_4426 179
516 3300050512 nmdc:mga0n895_401064_c1 nmdc:mga0n895_401064_c1_664_1203 179
517 3300050515 nmdc:mga0a205_260079_c2 nmdc:mga0a205_260079_c2_486_1025 179
518 3300053077 Ga0495601_0462862 Ga0495601_0462862_94_636 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

33

203

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.8597 7 179
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.8412 7 179
7e1v-assembly1.cif.gz_N cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.5645 5 156
6g94-assembly1.cif.gz_A structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.5414 7 160
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.5367 1 168
ID Description Score Start End Superfamily
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8739 7 176 1.20.950.20
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8679 7 176 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8593 7 176 1.20.950.20
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8535 7 176 1.20.950.20
af_A0A0R0K1X7_1_165_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6131 18 172 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A345ZXR5-F1-model_v4 Cytochrome b 0.9787 5 178 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A345ZXR5-F1-model_v4 Cytochrome b 0.9623 5 178 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A2M7J430-F1-model_v4 Cytochrome b 0.9516 44 179 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A1V3PW98-F1-model_v4 Cytochrome b561 bacterial/Ni-hydrogenase domain-containing protein 0.9482 1 179 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A371B846-F1-model_v4 Cytochrome b 0.9458 1 178 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.15 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map