F458437

General Info

Members Datasets Scaffolds Average Seq Length
519 228 519 284

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0182660|Ga0466969_0182660_31_885
Length 284
Sequence MPTISRRKFLHAASAVAAASAVTRIAHADPLGVPIGCQTWPVRQSIAKDFPGTLKQLAAAGFKSIEMCSPVGYADSGFGGLQKYSGAELRKIINDAGLTCVSSHYSMNELRKDQPARIAWAKEMGMTQMLVASLGGPKHPTTDDVKRAADEYNQIGERAHQAGITQGLHNEDFECSTTPDGKRVYDLLFELLDPRYVKFQFQVSNIQYGFDAAEYFTKYPGRFISMHVQGWSAPQKKIAAVGQDTLDWKKIFTAAKTGGIQNYFVEMDLPLMQASVPYLHQLQV

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
146 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 1.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.5
Rhizosphere 96.34
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10328943 3300003320 Bacteria 1335
2 rootH1_10307865 3300003323 Bacteria 2728
3 Ga0058863_10037519 3300004799 Unclassified 1747
4 Ga0065707_10279664 3300005295 Bacteria 1051
5 Ga0070676_10165993 3300005328 Bacteria 1424
6 Ga0070683_100104832 3300005329 Bacteria 2665
7 Ga0070683_100257449 3300005329 Bacteria 1660
8 Ga0070683_100325347 3300005329 Bacteria 1463
9 Ga0070666_10018221 3300005335 Bacteria 4512
10 Ga0070680_100059597 3300005336 Bacteria 3124
11 Ga0070682_100091395 3300005337 Unclassified 1992
12 Ga0070682_100127790 3300005337 Unclassified 1716
13 Ga0068868_100009551 3300005338 Bacteria 6992
14 Ga0068868_100057583 3300005338 Unclassified 3071
15 Ga0070660_100366532 3300005339 Bacteria 1188
16 Ga0070691_10006654 3300005341 Bacteria 5290
17 Ga0070661_100027500 3300005344 Bacteria 4096
18 Ga0070671_100233121 3300005355 Unclassified 1562
19 Ga0070659_100091817 3300005366 Unclassified 2434
20 Ga0070703_10001782 3300005406 Bacteria 6383
21 Ga0070703_10055878 3300005406 Bacteria 1276
22 Ga0070709_10045677 3300005434 Bacteria 2720
23 Ga0070709_10055134 3300005434 Unclassified 2509
24 Ga0070714_100000060 3300005435 Bacteria 100913
25 Ga0070714_100004520 3300005435 Bacteria 10489
26 Ga0070714_100250036 3300005435 Unclassified 1639
27 Ga0070713_100000118 3300005436 Bacteria 51698
28 Ga0070713_100024188 3300005436 Bacteria 4728
29 Ga0070713_100033366 3300005436 Bacteria 4122
30 Ga0070713_100236003 3300005436 Bacteria 1664
31 Ga0070713_100402533 3300005436 Bacteria 1278
32 Ga0070710_10009712 3300005437 Unclassified 4714
33 Ga0070701_10000500 3300005438 Bacteria 13424
34 Ga0070711_100000168 3300005439 Bacteria 35269
35 Ga0070711_100027842 3300005439 Bacteria 3714
36 Ga0070711_100243258 3300005439 Bacteria 1408
37 Ga0070705_100001280 3300005440 Bacteria 13561
38 Ga0070705_100024312 3300005440 Bacteria 3268
39 Ga0070705_100300491 3300005440 Unclassified 1150
40 Ga0070700_100019543 3300005441 Bacteria 3911
41 Ga0070694_100176238 3300005444 Bacteria 1578
42 Ga0070708_100019039 3300005445 Bacteria 5758
43 Ga0070708_100031458 3300005445 Bacteria 4593
44 Ga0070708_100056909 3300005445 Bacteria 3479
45 Ga0070708_100081117 3300005445 Bacteria 2936
46 Ga0070681_10000187 3300005458 Bacteria 47873
47 Ga0070681_10004638 3300005458 Bacteria 13124
48 Ga0070681_10045088 3300005458 Bacteria 4413
49 Ga0070681_10097425 3300005458 Unclassified 2888
50 Ga0070681_10381278 3300005458 Bacteria 1321
51 Ga0068867_100318522 3300005459 Bacteria 1288
52 Ga0070706_100006431 3300005467 Bacteria 11098
53 Ga0070706_100029898 3300005467 Bacteria 5018
54 Ga0070706_100055586 3300005467 Bacteria 3654
55 Ga0070707_100011641 3300005468 Bacteria 8208
56 Ga0070707_100070952 3300005468 Bacteria 3356
57 Ga0070707_100150619 3300005468 Bacteria 2265
58 Ga0070707_100191864 3300005468 Bacteria 1992
59 Ga0070698_100026285 3300005471 Bacteria 6060
60 Ga0070698_100052091 3300005471 Bacteria 4166
61 Ga0070699_100003868 3300005518 Bacteria 13237
62 Ga0070699_100005294 3300005518 Bacteria 11315
63 Ga0070699_100106947 3300005518 Bacteria 2454
64 Ga0070679_100012890 3300005530 Bacteria 8004
65 Ga0070679_100081536 3300005530 Bacteria 3224
66 Ga0070679_100113060 3300005530 Unclassified 2701
67 Ga0070684_100013330 3300005535 Bacteria 6624
68 Ga0070684_100084783 3300005535 Bacteria 2809
69 Ga0070684_100088861 3300005535 Bacteria 2746
70 Ga0070697_100000226 3300005536 Bacteria 46212
71 Ga0070697_100001061 3300005536 Bacteria 20778
72 Ga0070697_100050444 3300005536 Bacteria 3377
73 Ga0070697_100353018 3300005536 Unclassified 1270
74 Ga0068853_100067937 3300005539 Bacteria 3098
75 Ga0068853_100399322 3300005539 Bacteria 1286
76 Ga0070672_100104754 3300005543 Unclassified 2299
77 Ga0070686_100003915 3300005544 Bacteria 8188
78 Ga0070686_100376364 3300005544 Bacteria 1074
79 Ga0070695_100000559 3300005545 Bacteria 19707
80 Ga0070696_100019275 3300005546 Bacteria 4619
81 Ga0070693_100000144 3300005547 Bacteria 32168
82 Ga0070665_100121614 3300005548 Unclassified 2612
83 Ga0070665_100133525 3300005548 Bacteria 2484
84 Ga0070704_100017363 3300005549 Bacteria 4575
85 Ga0068855_100004537 3300005563 Bacteria 16961
86 Ga0068855_100007606 3300005563 Bacteria 13106
87 Ga0068855_100019542 3300005563 Bacteria 8138
88 Ga0068855_100032373 3300005563 Bacteria 6244
89 Ga0068855_100082825 3300005563 Bacteria 3718
90 Ga0068855_100240634 3300005563 Unclassified 2023
91 Ga0070664_100145063 3300005564 Unclassified 2093
92 Ga0068857_100002952 3300005577 Bacteria 14005
93 Ga0068857_100146217 3300005577 Unclassified 2139
94 Ga0068854_100061783 3300005578 Bacteria 2714
95 Ga0068854_100177844 3300005578 Bacteria 1660
96 Ga0068854_100236606 3300005578 Unclassified 1452
97 Ga0068856_100000072 3300005614 Bacteria 95094
98 Ga0068856_100010543 3300005614 Bacteria 8973
99 Ga0068856_100034573 3300005614 Bacteria 4950
100 Ga0068856_100043806 3300005614 Bacteria 4402
101 Ga0068856_100048932 3300005614 Unclassified 4166
102 Ga0068856_100110893 3300005614 Bacteria 2741
103 Ga0068856_100624334 3300005614 Unclassified 1098
104 Ga0070702_100134025 3300005615 Bacteria 1569
105 Ga0068852_100000057 3300005616 Bacteria 75410
106 Ga0068852_100004393 3300005616 Bacteria 9966
107 Ga0068852_100080623 3300005616 Bacteria 2886
108 Ga0068859_100064557 3300005617 Unclassified 3694
109 Ga0068866_10106250 3300005718 Unclassified 1558
110 Ga0068851_10041039 3300005834 Bacteria 2326
111 Ga0068851_10041691 3300005834 Bacteria 2309
112 Ga0068863_100008130 3300005841 Bacteria 10241
113 Ga0068863_100081916 3300005841 Unclassified 3057
114 Ga0068863_100888095 3300005841 Bacteria 891
115 Ga0068858_100008187 3300005842 Bacteria 10052
116 Ga0068858_100049666 3300005842 Unclassified 3884
117 Ga0068858_100228179 3300005842 Bacteria 1765
118 Ga0068860_100105417 3300005843 Unclassified 2692
119 Ga0068862_100236484 3300005844 Unclassified 1659
120 Ga0081455_10171139 3300005937 Unclassified 1654
121 Ga0070717_10001588 3300006028 Bacteria 15710
122 Ga0070717_10004202 3300006028 Bacteria 10386
123 Ga0070717_10022730 3300006028 Unclassified 4959
124 Ga0070717_10034041 3300006028 Bacteria 4115
125 Ga0070717_10107713 3300006028 Unclassified 2374
126 Ga0075432_10075894 3300006058 Bacteria 1213
127 Ga0070716_100001474 3300006173 Bacteria 10496
128 Ga0070716_100027403 3300006173 Bacteria 3061
129 Ga0070716_100096204 3300006173 Bacteria 1804
130 Ga0070716_100182690 3300006173 Bacteria 1378
131 Ga0070716_100213732 3300006173 Bacteria 1291
132 Ga0070712_100000110 3300006175 Bacteria 42794
133 Ga0070712_100003435 3300006175 Bacteria 9747
134 Ga0070712_100062977 3300006175 Unclassified 2624
135 Ga0070712_100065152 3300006175 Bacteria 2585
136 Ga0070712_100092705 3300006175 Unclassified 2215
137 Ga0070712_100320609 3300006175 Unclassified 1260
138 Ga0097621_100006951 3300006237 Bacteria 8056
139 Ga0097621_100066888 3300006237 Unclassified 2960
140 Ga0097621_100118627 3300006237 Bacteria 2243
141 Ga0068871_100003081 3300006358 Bacteria 11436
142 Ga0068871_100006579 3300006358 Bacteria 8236
143 Ga0068871_100171017 3300006358 Unclassified 1862
144 Ga0075428_100031757 3300006844 Bacteria 5833
145 Ga0075431_100441745 3300006847 Bacteria 1298
146 Ga0075433_10127793 3300006852 Bacteria 2257
147 Ga0075434_100000496 3300006871 Bacteria 29734
148 Ga0075434_100001926 3300006871 Bacteria 17999
149 Ga0075434_100009753 3300006871 Bacteria 8976
150 Ga0075434_100047635 3300006871 Bacteria 4254
151 Ga0068865_100081531 3300006881 Unclassified 2323
152 Ga0068865_100226311 3300006881 Unclassified 1465
153 Ga0075436_100007406 3300006914 Bacteria 7507
154 Ga0075436_100010687 3300006914 Bacteria 6296
155 Ga0075436_100031127 3300006914 Bacteria 3673
156 Ga0075436_100032560 3300006914 Bacteria 3593
157 Ga0075436_100033265 3300006914 Bacteria 3554
158 Ga0097620_100064559 3300006931 Unclassified 3694
159 Ga0075435_100001764 3300007076 Bacteria 14092
160 Ga0075435_100038836 3300007076 Bacteria 3797
161 Ga0075435_100125926 3300007076 Unclassified 2141
162 Ga0075435_100413198 3300007076 Bacteria 1162
163 Ga0075435_100494614 3300007076 Bacteria 1057
164 Ga0099794_10010021 3300007265 Bacteria 4012
165 Ga0099794_10024693 3300007265 Unclassified 2761
166 Ga0099795_10002935 3300007788 Bacteria 4130
167 Ga0105240_10000454 3300009093 Bacteria 75423
168 Ga0105240_10006399 3300009093 Bacteria 17315
169 Ga0105240_10008372 3300009093 Bacteria 14800
170 Ga0105240_10014538 3300009093 Bacteria 10745
171 Ga0105240_10015467 3300009093 Bacteria 10374
172 Ga0105240_10186291 3300009093 Unclassified 2444
173 Ga0105240_10668123 3300009093 Bacteria 1137
174 Ga0111539_10026068 3300009094 Bacteria 7157
175 Ga0105245_10028833 3300009098 Bacteria 4899
176 Ga0105245_10204178 3300009098 Unclassified 1899
177 Ga0114129_10765049 3300009147 Bacteria 1235
178 Ga0105241_10053532 3300009174 Bacteria 3087
179 Ga0105241_10092141 3300009174 Unclassified 2392
180 Ga0105242_10080113 3300009176 Bacteria 2729
181 Ga0105242_10256526 3300009176 Unclassified 1578
182 Ga0105248_10067384 3300009177 Bacteria 4019
183 Ga0105248_10096356 3300009177 Unclassified 3332
184 Ga0105237_10078300 3300009545 Unclassified 3295
185 Ga0105237_10435860 3300009545 Bacteria 1316
186 Ga0105238_10002254 3300009551 Bacteria 19428
187 Ga0105238_10320863 3300009551 Bacteria 1535
188 Ga0105249_10031496 3300009553 Bacteria 4797
189 Ga0105249_10284440 3300009553 Unclassified 1653
190 Ga0105239_10028962 3300010375 Bacteria 6087
191 Ga0105239_10132759 3300010375 Bacteria 2770
192 Ga0105239_10189317 3300010375 Unclassified 2303
193 Ga0157373_10074285 3300013100 Bacteria 2398
194 Ga0157371_10269788 3300013102 Bacteria 1228
195 Ga0157370_10000294 3300013104 Bacteria 63367
196 Ga0157370_10117143 3300013104 Bacteria 2488
197 Ga0157370_10432837 3300013104 Unclassified 1210
198 Ga0157369_10000244 3300013105 Bacteria 75434
199 Ga0157369_10009034 3300013105 Bacteria 11412
200 Ga0157369_10010525 3300013105 Bacteria 10530
201 Ga0157369_10155727 3300013105 Bacteria 2413
202 Ga0157369_10195100 3300013105 Bacteria 2127
203 Ga0157369_10209286 3300013105 Unclassified 2045
204 Ga0157369_10303845 3300013105 Unclassified 1659
205 Ga0157369_10310839 3300013105 Bacteria 1639
206 Ga0157369_10412747 3300013105 Bacteria 1400
207 Ga0157374_10010653 3300013296 Bacteria 7919
208 Ga0157374_10010654 3300013296 Bacteria 7918
209 Ga0157374_10025709 3300013296 Bacteria 5290
210 Ga0157374_10104111 3300013296 Bacteria 2724
211 Ga0157374_10147210 3300013296 Bacteria 2288
212 Ga0157378_10009064 3300013297 Bacteria 8660
213 Ga0157378_10057247 3300013297 Bacteria 3474
214 Ga0157378_10103327 3300013297 Bacteria 2603
215 Ga0157378_10136088 3300013297 Bacteria 2278
216 Ga0157378_10167972 3300013297 Bacteria 2056
217 Ga0163162_10145033 3300013306 Bacteria 2489
218 Ga0157372_10003967 3300013307 Bacteria 15902
219 Ga0157372_10004946 3300013307 Bacteria 14156
220 Ga0157372_10081767 3300013307 Bacteria 3656
221 Ga0157372_10225166 3300013307 Bacteria 2174
222 Ga0157372_10242196 3300013307 Unclassified 2093
223 Ga0157372_10254914 3300013307 Bacteria 2037
224 Ga0157372_10354697 3300013307 Bacteria 1709
225 Ga0157375_10171370 3300013308 Bacteria 2318
226 Ga0157375_10323475 3300013308 Bacteria 1707
227 Ga0157375_10325325 3300013308 Bacteria 1702
228 Ga0157375_10736201 3300013308 Unclassified 1138
229 Ga0163163_10071314 3300014325 Bacteria 3461
230 Ga0157379_10033441 3300014968 Unclassified 4586
231 Ga0157379_10113970 3300014968 Unclassified 2430
232 Ga0157379_10123487 3300014968 Bacteria 2330
233 Ga0157379_10141371 3300014968 Bacteria 2170
234 Ga0157379_10287950 3300014968 Unclassified 1496
235 Ga0157376_10000032 3300014969 Bacteria 167294
236 Ga0157376_10082715 3300014969 Bacteria 2759
237 Ga0157376_10101499 3300014969 Bacteria 2515
238 Ga0157376_10240844 3300014969 Bacteria 1685
239 Ga0224712_10169906 3300022467 Unclassified 977
240 Ga0224570_101057 3300022730 Unclassified 2161
241 Ga0224572_1000993 3300024225 Bacteria 3915
242 Ga0224572_1007234 3300024225 Bacteria 2030
243 Ga0228598_1003277 3300024227 Bacteria 3489
244 Ga0207656_10032669 3300025321 Bacteria 2162
245 Ga0207653_10000107 3300025885 Bacteria 59076
246 Ga0207692_10006658 3300025898 Unclassified 4697
247 Ga0207692_10007149 3300025898 Bacteria 4562
248 Ga0207642_10021786 3300025899 Unclassified 2530
249 Ga0207647_10003363 3300025904 Bacteria 11995
250 Ga0207647_10066087 3300025904 Unclassified 2194
251 Ga0207699_10003312 3300025906 Bacteria 7681
252 Ga0207699_10031521 3300025906 Unclassified 2977
253 Ga0207699_10039017 3300025906 Bacteria 2726
254 Ga0207699_10043102 3300025906 Bacteria 2620
255 Ga0207645_10074845 3300025907 Bacteria 2168
256 Ga0207705_10058508 3300025909 Unclassified 2780
257 Ga0207684_10000445 3300025910 Bacteria 54460
258 Ga0207684_10016084 3300025910 Bacteria 6426
259 Ga0207684_10082034 3300025910 Bacteria 2745
260 Ga0207684_10284963 3300025910 Bacteria 1425
261 Ga0207654_10289280 3300025911 Bacteria 1111
262 Ga0207707_10026388 3300025912 Bacteria 5078
263 Ga0207707_10268097 3300025912 Unclassified 1480
264 Ga0207695_10000570 3300025913 Bacteria 75451
265 Ga0207695_10007349 3300025913 Bacteria 14059
266 Ga0207695_10008906 3300025913 Bacteria 12493
267 Ga0207695_10009178 3300025913 Bacteria 12268
268 Ga0207695_10035594 3300025913 Bacteria 5397
269 Ga0207695_10124215 3300025913 Bacteria 2545
270 Ga0207695_10251881 3300025913 Unclassified 1665
271 Ga0207671_10038642 3300025914 Bacteria 3537
272 Ga0207671_10092598 3300025914 Bacteria 2279
273 Ga0207671_10146005 3300025914 Unclassified 1825
274 Ga0207671_10202461 3300025914 Unclassified 1551
275 Ga0207671_10206217 3300025914 Unclassified 1536
276 Ga0207693_10000353 3300025915 Bacteria 42212
277 Ga0207693_10002517 3300025915 Bacteria 15937
278 Ga0207693_10007255 3300025915 Bacteria 9123
279 Ga0207693_10007310 3300025915 Bacteria 9087
280 Ga0207693_10011640 3300025915 Bacteria 7117
281 Ga0207693_10040101 3300025915 Bacteria 3687
282 Ga0207693_10097834 3300025915 Bacteria 2301
283 Ga0207693_10231917 3300025915 Unclassified 1449
284 Ga0207663_10000671 3300025916 Bacteria 15122
285 Ga0207663_10024795 3300025916 Bacteria 3459
286 Ga0207663_10074829 3300025916 Bacteria 2196
287 Ga0207660_10115010 3300025917 Bacteria 2030
288 Ga0207649_10016866 3300025920 Bacteria 4131
289 Ga0207652_10013262 3300025921 Bacteria 6674
290 Ga0207652_10113548 3300025921 Bacteria 2405
291 Ga0207652_10260507 3300025921 Unclassified 1564
292 Ga0207646_10000842 3300025922 Bacteria 39742
293 Ga0207646_10002173 3300025922 Bacteria 23409
294 Ga0207646_10053146 3300025922 Bacteria 3624
295 Ga0207646_10248945 3300025922 Unclassified 1605
296 Ga0207694_10004856 3300025924 Bacteria 10440
297 Ga0207700_10000210 3300025928 Bacteria 34895
298 Ga0207700_10003334 3300025928 Bacteria 9315
299 Ga0207700_10060554 3300025928 Bacteria 2868
300 Ga0207700_10081565 3300025928 Bacteria 2526
301 Ga0207664_10000017 3300025929 Bacteria 230967
302 Ga0207664_10014897 3300025929 Bacteria 5629
303 Ga0207664_10068415 3300025929 Unclassified 2852
304 Ga0207664_10379972 3300025929 Unclassified 1254
305 Ga0207704_10022247 3300025938 Unclassified 3393
306 Ga0207704_10335540 3300025938 Bacteria 1172
307 Ga0207665_10000053 3300025939 Bacteria 73573
308 Ga0207665_10048464 3300025939 Bacteria 2852
309 Ga0207665_10054441 3300025939 Bacteria 2698
310 Ga0207665_10058248 3300025939 Bacteria 2611
311 Ga0207665_10117884 3300025939 Bacteria 1872
312 Ga0207665_10184145 3300025939 Bacteria 1514
313 Ga0207665_10425529 3300025939 Unclassified 1015
314 Ga0207691_10005128 3300025940 Bacteria 12642
315 Ga0207691_10128591 3300025940 Bacteria 2239
316 Ga0207711_10069407 3300025941 Unclassified 3055
317 Ga0207711_10129142 3300025941 Unclassified 2264
318 Ga0207711_10315325 3300025941 Bacteria 1444
319 Ga0207711_10572468 3300025941 Unclassified 1054
320 Ga0207689_10060272 3300025942 Unclassified 3121
321 Ga0207661_10121395 3300025944 Bacteria 2225
322 Ga0207661_10134151 3300025944 Unclassified 2125
323 Ga0207661_10193295 3300025944 Bacteria 1785
324 Ga0207667_10001828 3300025949 Bacteria 26767
325 Ga0207667_10018039 3300025949 Bacteria 7927
326 Ga0207667_10050704 3300025949 Bacteria 4378
327 Ga0207667_10077714 3300025949 Bacteria 3441
328 Ga0207667_10149383 3300025949 Bacteria 2405
329 Ga0207667_10154544 3300025949 Bacteria 2361
330 Ga0207640_10176472 3300025981 Bacteria 1597
331 Ga0207677_10045747 3300026023 Unclassified 2924
332 Ga0207677_10088141 3300026023 Bacteria 2249
333 Ga0207703_10004190 3300026035 Bacteria 11887
334 Ga0207703_10293580 3300026035 Unclassified 1480
335 Ga0207639_10034909 3300026041 Bacteria 3720
336 Ga0207639_10046754 3300026041 Bacteria 3267
337 Ga0207639_10583145 3300026041 Unclassified 1030
338 Ga0207708_10113863 3300026075 Bacteria 2102
339 Ga0207702_10000366 3300026078 Bacteria 51814
340 Ga0207702_10076938 3300026078 Unclassified 2884
341 Ga0207702_10123626 3300026078 Unclassified 2319
342 Ga0207702_10513182 3300026078 Bacteria 1169
343 Ga0207702_10525746 3300026078 Unclassified 1155
344 Ga0207641_10001205 3300026088 Bacteria 25890
345 Ga0207641_10034255 3300026088 Bacteria 4223
346 Ga0207641_10203140 3300026088 Bacteria 1828
347 Ga0207641_10222414 3300026088 Unclassified 1751
348 Ga0207641_10875350 3300026088 Bacteria 891
349 Ga0207676_10451604 3300026095 Bacteria 1212
350 Ga0207674_10000245 3300026116 Bacteria 67561
351 Ga0207674_10008755 3300026116 Bacteria 11651
352 Ga0207674_10061506 3300026116 Unclassified 3794
353 Ga0207675_100160150 3300026118 Unclassified 2146
354 Ga0207683_10118112 3300026121 Bacteria 2379
355 Ga0207683_10146407 3300026121 Bacteria 2130
356 Ga0207698_10000033 3300026142 Bacteria 110484
357 Ga0207698_10070569 3300026142 Bacteria 2768
358 Ga0207698_10106910 3300026142 Bacteria 2335
359 Ga0209588_1004615 3300027671 Unclassified 3898
360 Ga0207428_10317670 3300027907 Bacteria 1151
361 Ga0265354_1000071 3300028016 Bacteria 16863
362 Ga0265356_1000111 3300028017 Bacteria 13998
363 Ga0268266_10065986 3300028379 Bacteria 3129
364 Ga0268266_10086742 3300028379 Unclassified 2737
365 Ga0268266_10631886 3300028379 Bacteria 1030
366 Ga0268265_10218707 3300028380 Unclassified 1665
367 Ga0268264_10072168 3300028381 Unclassified 2927
368 Ga0265338_10006709 3300028800 Bacteria 14542
369 Ga0265338_10070827 3300028800 Bacteria 2987
370 Ga0265762_1001913 3300030760 Unclassified 3777
371 Ga0265762_1003447 3300030760 Bacteria 2834
372 Ga0265760_10026738 3300031090 Bacteria 1689
373 Ga0265760_10052431 3300031090 Unclassified 1230
374 Ga0265760_10058114 3300031090 Unclassified 1172
375 Ga0265325_10005171 3300031241 Bacteria 8113
376 Ga0265339_10016184 3300031249 Unclassified 4453
377 Ga0265316_10044825 3300031344 Unclassified 3515
378 Ga0265316_10257609 3300031344 Bacteria 1280
379 Ga0265316_10303139 3300031344 Bacteria 1163
380 Ga0265313_10009148 3300031595 Bacteria 6465
381 Ga0307510_10238537 3300033180 Bacteria 1315
382 Ga0373926_0002145 3300035083 Bacteria 6209
383 Ga0373923_0086422 3300035111 Unclassified 1367
384 Ga0373936_0001594 3300035113 Bacteria 8283
385 Ga0373936_0010109 3300035113 Unclassified 3565
386 Ga0373945_0026875 3300035116 Bacteria 2007
387 Ga0373954_0001349 3300035118 Bacteria 9888
388 Ga0373954_0054558 3300035118 Bacteria 1879
389 Ga0373954_0095267 3300035118 Unclassified 1433
390 Ga0373956_0010139 3300035119 Bacteria 3850
391 Ga0373956_0140255 3300035119 Bacteria 1134
392 Ga0373957_0022518 3300035120 Bacteria 2246
393 Ga0373943_0027175 3300035170 Bacteria 2686
394 Ga0373943_0223813 3300035170 Unclassified 1049
395 Ga0373946_0002501 3300035171 Bacteria 6491
396 Ga0373946_0002850 3300035171 Bacteria 6126
397 Ga0373924_0030839 3300035410 Bacteria 2151
398 Ga0373935_0001452 3300035692 Bacteria 13139
399 Ga0373935_0018862 3300035692 Unclassified 4205
400 Ga0373935_0188397 3300035692 Bacteria 1420
401 Ga0373927_0000230 3300035695 Bacteria 43996
402 Ga0373927_0001907 3300035695 Bacteria 15406
403 Ga0373927_0010455 3300035695 Bacteria 6186
404 Ga0373927_0042414 3300035695 Bacteria 2947
405 Ga0373933_0003934 3300035724 Bacteria 8199
406 Ga0373947_0001966 3300035725 Bacteria 12585
407 Ga0373947_0005727 3300035725 Bacteria 7247
408 Ga0373947_0007449 3300035725 Bacteria 6335
409 Ga0373937_0000082 3300036401 Bacteria 87971
410 Ga0373937_0042058 3300036401 Bacteria 4170
411 Ga0373937_0048376 3300036401 Bacteria 3893
412 Ga0373937_0158239 3300036401 Bacteria 2124
413 Ga0373937_0187397 3300036401 Bacteria 1943
414 Ga0373937_0192795 3300036401 Unclassified 1915
415 Ga0373937_0219268 3300036401 Bacteria 1791
416 Ga0373937_0268870 3300036401 Bacteria 1609
417 Ga0373925_0000105 3300037068 Bacteria 90042
418 Ga0373925_0000873 3300037068 Bacteria 27568
419 Ga0373925_0005959 3300037068 Bacteria 9032
420 Ga0373925_0019615 3300037068 Bacteria 4920
421 Ga0373925_0045003 3300037068 Bacteria 3278
422 Ga0395899_0305361 3300037312 Unclassified 1076
423 Ga0436364_1116354 3300037853 Bacteria 2290
424 Ga0436364_1164114 3300037853 Bacteria 1418
425 Ga0436365_1107063 3300039437 Bacteria 1966
426 Ga0436360_0507165 3300039438 Bacteria 1878
427 Ga0451577_0029083 3300042876 Bacteria 4996
428 Ga0466969_0182660 3300044656 Bacteria 960
429 Ga0466961_0125736 3300044693 Bacteria 1609
430 Ga0466963_0050085 3300044694 Bacteria 2764
431 Ga0453684_0173281 3300044712 Bacteria 2540
432 Ga0451576_0018870 3300045051 Bacteria 7539
433 Ga0451576_0132681 3300045051 Bacteria 2596
434 Ga0466967_0254282 3300045976 Bacteria 1679
435 Ga0495603_0134644 3300046455 Bacteria 1438
436 Ga0495629_0036894 3300046459 Bacteria 3448
437 Ga0495651_0011121 3300046462 Bacteria 6922
438 Ga0495580_0001996 3300046472 Bacteria 17956
439 Ga0495580_0002625 3300046472 Bacteria 15608
440 Ga0495580_0034905 3300046472 Unclassified 3618
441 Ga0495580_0136316 3300046472 Bacteria 1702
442 Ga0495580_0162047 3300046472 Bacteria 1548
443 Ga0495582_0000650 3300046473 Bacteria 19100
444 Ga0495582_0001904 3300046473 Bacteria 11730
445 Ga0495582_0057862 3300046473 Bacteria 2137
446 Ga0495664_0101991 3300046477 Bacteria 1729
447 Ga0495608_0082886 3300046511 Bacteria 2082
448 Ga0495628_0223603 3300046516 Unclassified 1413
449 Ga0495630_0032670 3300046517 Bacteria 3879
450 Ga0495630_0043386 3300046517 Bacteria 3360
451 Ga0495630_0114424 3300046517 Bacteria 2044
452 Ga0495652_0149170 3300046529 Bacteria 1829
453 Ga0495665_0002094 3300046531 Bacteria 10806
454 Ga0495665_0020830 3300046531 Unclassified 3522
455 Ga0495665_0262394 3300046531 Unclassified 888
456 Ga0495640_0022980 3300046533 Bacteria 4553
457 Ga0495587_0021048 3300046536 Bacteria 4022
458 Ga0495667_0031126 3300046559 Bacteria 3583
459 Ga0495634_0061132 3300046642 Bacteria 2505
460 Ga0495634_0153288 3300046642 Bacteria 1456
461 Ga0495635_0051485 3300046663 Bacteria 2837
462 Ga0495599_0112203 3300046678 Unclassified 1698
463 Ga0495623_0056092 3300046679 Bacteria 2481
464 Ga0495647_0007827 3300046681 Bacteria 3587
465 Ga0495658_0030470 3300046683 Bacteria 2929
466 Ga0495613_0229680 3300046689 Bacteria 1300
467 Ga0495624_0094439 3300046690 Bacteria 1844
468 Ga0495581_0010415 3300047315 Bacteria 5377
469 Ga0495604_0000235 3300047317 Bacteria 49754
470 Ga0495674_0149638 3300047319 Bacteria 1958
471 Ga0495674_0189714 3300047319 Unclassified 1709
472 Ga0495674_0386982 3300047319 Bacteria 1131
473 Ga0495676_0034427 3300047321 Bacteria 4251
474 Ga0495675_0338692 3300047444 Unclassified 887
475 Ga0495684_0003813 3300047471 Bacteria 11747
476 Ga0495684_0008107 3300047471 Bacteria 8121
477 Ga0495684_0076553 3300047471 Bacteria 2541
478 Ga0495684_0381000 3300047471 Unclassified 995
479 Ga0495602_0004006 3300048088 Bacteria 15346
480 Ga0495602_0024975 3300048088 Bacteria 5790
481 Ga0495602_0072585 3300048088 Bacteria 2934
482 Ga0495602_0097302 3300048088 Unclassified 2425
483 Ga0495602_0118107 3300048088 Unclassified 2140
484 Ga0496101_0100745 3300048904 Unclassified 2162
485 Ga0496103_0294817 3300048906 Bacteria 1043
486 Ga0496104_0003899 3300048907 Bacteria 12916
487 Ga0496105_0079654 3300048908 Bacteria 2705
488 Ga0496112_0029534 3300048915 Bacteria 5302
489 Ga0496113_0389800 3300048916 Bacteria 1118
490 Ga0496114_0005831 3300048917 Bacteria 9672
491 Ga0496114_0171636 3300048917 Bacteria 1890
492 Ga0496114_0269072 3300048917 Bacteria 1501
493 Ga0496114_0319922 3300048917 Bacteria 1371
494 Ga0496115_0002947 3300048918 Bacteria 12268
495 Ga0496115_0028603 3300048918 Bacteria 4370
496 Ga0496115_0226901 3300048918 Bacteria 1540
497 nmdc:mga09592_234334_c1 3300050508 Unclassified 1590
498 nmdc:mga06r32_403565_c1 3300050510 Bacteria 1349
499 nmdc:mga08y16_17150_c1 3300050511 Bacteria 7624
500 nmdc:mga08y16_453383_c1 3300050511 Bacteria 1308
501 nmdc:mga0n895_229690_c1 3300050512 Bacteria 1884
502 nmdc:mga0n895_23662_c1 3300050512 Bacteria 5777
503 nmdc:mga0n895_465_c1 3300050512 Bacteria 27165
504 nmdc:mga0n895_53515_c1 3300050512 Bacteria 3966
505 nmdc:mga0rr50_149856_c1 3300050513 Bacteria 1884
506 nmdc:mga0rr50_149902_c1 3300050513 Bacteria 1884
507 nmdc:mga0rr50_30057_c1 3300050513 Unclassified 3841
508 nmdc:mga0rr50_30784_c1 3300050513 Bacteria 3804
509 nmdc:mga0rr50_393_c1 3300050513 Bacteria 23808
510 nmdc:mga08x19_115980_c1 3300050514 Bacteria 1791
511 nmdc:mga08x19_208490_c1 3300050514 Bacteria 1341
512 nmdc:mga08x19_24089_c1 3300050514 Bacteria 3779
513 nmdc:mga08x19_28440_c1 3300050514 Bacteria 3502
514 nmdc:mga08x19_413676_c1 3300050514 Unclassified 947
515 nmdc:mga08x19_5157_c1 3300050514 Bacteria 7726
516 nmdc:mga08x19_6388_c1 3300050514 Bacteria 6976
517 nmdc:mga08x19_64160_c1 3300050514 Bacteria 2384
518 nmdc:mga0a205_20354_c1 3300050515 Bacteria 6258
519 nmdc:mga0a205_9363_c1 3300050515 Bacteria 8952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0229680 Ga0495613_0229680_376_1110 244
2 3300025939 Ga0207665_10425529 Ga0207665_104255291 245
3 3300005436 Ga0070713_100236003 Ga0070713_1002360031 251
4 3300035116 Ga0373945_0026875 Ga0373945_0026875_1236_1991 251
5 3300035119 Ga0373956_0140255 Ga0373956_0140255_12_767 251
6 3300046531 Ga0495665_0262394 Ga0495665_0262394_113_868 251
7 3300005295 Ga0065707_10279664 Ga0065707_102796641 257
8 3300005544 Ga0070686_100376364 Ga0070686_1003763641 257
9 3300007076 Ga0075435_100413198 Ga0075435_1004131981 257
10 3300009553 Ga0105249_10284440 Ga0105249_102844402 257
11 3300013308 Ga0157375_10323475 Ga0157375_103234752 257
12 3300025939 Ga0207665_10054441 Ga0207665_100544413 257
13 3300028379 Ga0268266_10631886 Ga0268266_106318861 257
14 3300005328 Ga0070676_10165993 Ga0070676_101659932 259
15 3300005335 Ga0070666_10018221 Ga0070666_100182216 259
16 3300005563 Ga0068855_100004537 Ga0068855_10000453714 259
17 3300005616 Ga0068852_100000057 Ga0068852_10000005726 259
18 3300006175 Ga0070712_100320609 Ga0070712_1003206091 259
19 3300009098 Ga0105245_10028833 Ga0105245_100288331 259
20 3300025913 Ga0207695_10000570 Ga0207695_1000057038 259
21 3300025915 Ga0207693_10097834 Ga0207693_100978341 259
22 3300025949 Ga0207667_10018039 Ga0207667_100180392 259
23 3300026121 Ga0207683_10118112 Ga0207683_101181122 259
24 3300031344 Ga0265316_10257609 Ga0265316_102576091 259
25 3300036401 Ga0373937_0192795 Ga0373937_0192795_294_1073 259
26 3300044694 Ga0466963_0050085 Ga0466963_0050085_1948_2727 259
27 3300047319 Ga0495674_0386982 Ga0495674_0386982_320_1099 259
28 3300047471 Ga0495684_0381000 Ga0495684_0381000_206_985 259
29 3300048918 Ga0496115_0226901 Ga0496115_0226901_15_794 259
30 3300047319 Ga0495674_0189714 Ga0495674_0189714_22_804 260
31 3300009094 Ga0111539_10026068 Ga0111539_100260684 263
32 3300009553 Ga0105249_10031496 Ga0105249_100314964 263
33 3300050511 nmdc:mga08y16_17150_c1 nmdc:mga08y16_17150_c1_856_1653 263
34 3300046529 Ga0495652_0149170 Ga0495652_0149170_47_844 265
35 3300050508 nmdc:mga09592_234334_c1 nmdc:mga09592_234334_c1_21_818 265
36 3300050514 nmdc:mga08x19_413676_c1 nmdc:mga08x19_413676_c1_123_920 265
37 3300026088 Ga0207641_10034255 Ga0207641_100342554 266
38 3300035692 Ga0373935_0188397 Ga0373935_0188397_605_1405 266
39 3300046517 Ga0495630_0114424 Ga0495630_0114424_17_817 266
40 3300026121 Ga0207683_10146407 Ga0207683_101464072 267
41 3300005563 Ga0068855_100019542 Ga0068855_1000195425 269
42 3300025949 Ga0207667_10077714 Ga0207667_100777141 269
43 3300026041 Ga0207639_10583145 Ga0207639_105831451 269
44 3300005344 Ga0070661_100027500 Ga0070661_1000275004 270
45 3300005563 Ga0068855_100082825 Ga0068855_1000828253 270
46 3300005614 Ga0068856_100043806 Ga0068856_1000438062 270
47 3300006237 Ga0097621_100118627 Ga0097621_1001186271 270
48 3300009545 Ga0105237_10435860 Ga0105237_104358602 270
49 3300013100 Ga0157373_10074285 Ga0157373_100742852 270
50 3300013296 Ga0157374_10010653 Ga0157374_100106534 270
51 3300014969 Ga0157376_10082715 Ga0157376_100827153 270
52 3300025920 Ga0207649_10016866 Ga0207649_100168662 270
53 3300025949 Ga0207667_10050704 Ga0207667_100507043 270
54 3300026041 Ga0207639_10034909 Ga0207639_100349093 270
55 3300048918 Ga0496115_0028603 Ga0496115_0028603_1667_2479 270
56 3300009093 Ga0105240_10006399 Ga0105240_1000639912 271
57 3300003323 rootH1_10307865 rootH1_103078654 273
58 3300005329 Ga0070683_100257449 Ga0070683_1002574491 273
59 3300005539 Ga0068853_100399322 Ga0068853_1003993221 273
60 3300009093 Ga0105240_10014538 Ga0105240_100145384 273
61 3300009174 Ga0105241_10053532 Ga0105241_100535324 273
62 3300009174 Ga0105241_10092141 Ga0105241_100921413 273
63 3300009551 Ga0105238_10002254 Ga0105238_1000225410 273
64 3300010375 Ga0105239_10028962 Ga0105239_100289623 273
65 3300010375 Ga0105239_10132759 Ga0105239_101327593 273
66 3300013104 Ga0157370_10432837 Ga0157370_104328371 273
67 3300013105 Ga0157369_10010525 Ga0157369_100105253 273
68 3300013105 Ga0157369_10209286 Ga0157369_102092862 273
69 3300013296 Ga0157374_10104111 Ga0157374_101041111 273
70 3300013297 Ga0157378_10057247 Ga0157378_100572471 273
71 3300013307 Ga0157372_10003967 Ga0157372_1000396710 273
72 3300013308 Ga0157375_10736201 Ga0157375_107362011 273
73 3300014968 Ga0157379_10123487 Ga0157379_101234873 273
74 3300025913 Ga0207695_10007349 Ga0207695_100073493 273
75 3300046472 Ga0495580_0162047 Ga0495580_0162047_125_946 273
76 3300028800 Ga0265338_10070827 Ga0265338_100708273 277
77 3300031344 Ga0265316_10303139 Ga0265316_103031391 277
78 3300031595 Ga0265313_10009148 Ga0265313_100091485 277
79 3300004799 Ga0058863_10037519 Ga0058863_100375192 278
80 3300005458 Ga0070681_10381278 Ga0070681_103812782 278
81 3300005530 Ga0070679_100113060 Ga0070679_1001130603 278
82 3300013105 Ga0157369_10195100 Ga0157369_101951003 278
83 3300025921 Ga0207652_10260507 Ga0207652_102605072 278
84 3300035170 Ga0373943_0223813 Ga0373943_0223813_141_977 278
85 3300035695 Ga0373927_0042414 Ga0373927_0042414_2064_2900 278
86 3300044656 Ga0466969_0182660 Ga0466969_0182660_31_885 279
87 3300044693 Ga0466961_0125736 Ga0466961_0125736_713_1567 279
88 3300005535 Ga0070684_100013330 Ga0070684_1000133302 280
89 3300006914 Ga0075436_100032560 Ga0075436_1000325604 280
90 3300013297 Ga0157378_10167972 Ga0157378_101679722 280
91 3300039438 Ga0436360_0507165 Ga0436360_0507165_98_958 281
92 3300005444 Ga0070694_100176238 Ga0070694_1001762381 282
93 3300006914 Ga0075436_100010687 Ga0075436_1000106877 282
94 3300025921 Ga0207652_10113548 Ga0207652_101135482 282
95 3300050514 nmdc:mga08x19_6388_c1 nmdc:mga08x19_6388_c1_2589_3437 282
96 3300005329 Ga0070683_100104832 Ga0070683_1001048322 283
97 3300005336 Ga0070680_100059597 Ga0070680_1000595972 283
98 3300005338 Ga0068868_100009551 Ga0068868_1000095516 283
99 3300005436 Ga0070713_100024188 Ga0070713_1000241882 283
100 3300005458 Ga0070681_10000187 Ga0070681_100001874 283
101 3300005563 Ga0068855_100007606 Ga0068855_10000760613 283
102 3300005577 Ga0068857_100002952 Ga0068857_10000295213 283
103 3300005578 Ga0068854_100061783 Ga0068854_1000617832 283
104 3300005614 Ga0068856_100034573 Ga0068856_1000345731 283
105 3300005616 Ga0068852_100004393 Ga0068852_1000043936 283
106 3300005834 Ga0068851_10041691 Ga0068851_100416912 283
107 3300005841 Ga0068863_100888095 Ga0068863_1008880951 283
108 3300005842 Ga0068858_100008187 Ga0068858_1000081879 283
109 3300006237 Ga0097621_100006951 Ga0097621_1000069517 283
110 3300006358 Ga0068871_100003081 Ga0068871_10000308110 283
111 3300025911 Ga0207654_10289280 Ga0207654_102892802 283
112 3300025912 Ga0207707_10026388 Ga0207707_100263881 283
113 3300025913 Ga0207695_10009178 Ga0207695_100091785 283
114 3300025917 Ga0207660_10115010 Ga0207660_101150102 283
115 3300025924 Ga0207694_10004856 Ga0207694_100048565 283
116 3300025928 Ga0207700_10081565 Ga0207700_100815652 283
117 3300025949 Ga0207667_10001828 Ga0207667_1000182816 283
118 3300026035 Ga0207703_10004190 Ga0207703_100041905 283
119 3300026088 Ga0207641_10875350 Ga0207641_108753501 283
120 3300026116 Ga0207674_10008755 Ga0207674_1000875510 283
121 3300026142 Ga0207698_10106910 Ga0207698_101069102 283
122 3300031344 Ga0265316_10044825 Ga0265316_100448252 283
123 3300046678 Ga0495599_0112203 Ga0495599_0112203_490_1353 283
124 3300047471 Ga0495684_0003813 Ga0495684_0003813_5435_6298 283
125 3300048088 Ga0495602_0024975 Ga0495602_0024975_16_879 283
126 3300005548 Ga0070665_100121614 Ga0070665_1001216143 284
127 3300005937 Ga0081455_10171139 Ga0081455_101711392 284
128 3300006871 Ga0075434_100000496 Ga0075434_10000049620 284
129 3300007076 Ga0075435_100001764 Ga0075435_10000176410 284
130 3300028379 Ga0268266_10086742 Ga0268266_100867423 284
131 3300035083 Ga0373926_0002145 Ga0373926_0002145_1859_2722 284
132 3300035170 Ga0373943_0027175 Ga0373943_0027175_834_1697 284
133 3300035171 Ga0373946_0002501 Ga0373946_0002501_360_1223 284
134 3300035695 Ga0373927_0000230 Ga0373927_0000230_32038_32901 284
135 3300035725 Ga0373947_0007449 Ga0373947_0007449_4477_5340 284
136 3300037068 Ga0373925_0000105 Ga0373925_0000105_32046_32909 284
137 3300037853 Ga0436364_1164114 Ga0436364_1164114_442_1299 284
138 3300050513 nmdc:mga0rr50_393_c1 nmdc:mga0rr50_393_c1_21623_22498 284
139 3300050515 nmdc:mga0a205_9363_c1 nmdc:mga0a205_9363_c1_2608_3483 284
140 3300005337 Ga0070682_100127790 Ga0070682_1001277902 285
141 3300005339 Ga0070660_100366532 Ga0070660_1003665321 285
142 3300005366 Ga0070659_100091817 Ga0070659_1000918173 285
143 3300005439 Ga0070711_100243258 Ga0070711_1002432581 285
144 3300005563 Ga0068855_100032373 Ga0068855_1000323732 285
145 3300005563 Ga0068855_100240634 Ga0068855_1002406343 285
146 3300005578 Ga0068854_100177844 Ga0068854_1001778442 285
147 3300005614 Ga0068856_100010543 Ga0068856_1000105433 285
148 3300005614 Ga0068856_100110893 Ga0068856_1001108932 285
149 3300007265 Ga0099794_10024693 Ga0099794_100246932 285
150 3300009093 Ga0105240_10008372 Ga0105240_100083728 285
151 3300013104 Ga0157370_10117143 Ga0157370_101171432 285
152 3300013105 Ga0157369_10009034 Ga0157369_100090344 285
153 3300013105 Ga0157369_10412747 Ga0157369_104127471 285
154 3300013296 Ga0157374_10010654 Ga0157374_100106544 285
155 3300013307 Ga0157372_10225166 Ga0157372_102251662 285
156 3300014968 Ga0157379_10287950 Ga0157379_102879502 285
157 3300025913 Ga0207695_10008906 Ga0207695_100089062 285
158 3300025913 Ga0207695_10035594 Ga0207695_100355942 285
159 3300025913 Ga0207695_10251881 Ga0207695_102518812 285
160 3300025914 Ga0207671_10038642 Ga0207671_100386422 285
161 3300025914 Ga0207671_10202461 Ga0207671_102024613 285
162 3300025916 Ga0207663_10074829 Ga0207663_100748291 285
163 3300025949 Ga0207667_10154544 Ga0207667_101545442 285
164 3300025981 Ga0207640_10176472 Ga0207640_101764721 285
165 3300026078 Ga0207702_10076938 Ga0207702_100769383 285
166 3300026078 Ga0207702_10123626 Ga0207702_101236262 285
167 3300026088 Ga0207641_10203140 Ga0207641_102031401 285
168 3300027671 Ga0209588_1004615 Ga0209588_10046152 285
169 3300036401 Ga0373937_0158239 Ga0373937_0158239_777_1634 285
170 3300048918 Ga0496115_0002947 Ga0496115_0002947_1331_2188 285
171 3300006058 Ga0075432_10075894 Ga0075432_100758942 286
172 3300007076 Ga0075435_100038836 Ga0075435_1000388364 286
173 3300014969 Ga0157376_10101499 Ga0157376_101014992 286
174 3300035111 Ga0373923_0086422 Ga0373923_0086422_227_1087 286
175 3300036401 Ga0373937_0042058 Ga0373937_0042058_2758_3618 286
176 3300036401 Ga0373937_0268870 Ga0373937_0268870_36_896 286
177 3300037068 Ga0373925_0019615 Ga0373925_0019615_2222_3103 286
178 3300045976 Ga0466967_0254282 Ga0466967_0254282_362_1222 286
179 3300047444 Ga0495675_0338692 Ga0495675_0338692_17_877 286
180 3300048917 Ga0496114_0269072 Ga0496114_0269072_409_1269 286
181 3300050512 nmdc:mga0n895_23662_c1 nmdc:mga0n895_23662_c1_3691_4551 286
182 3300050513 nmdc:mga0rr50_30784_c1 nmdc:mga0rr50_30784_c1_1585_2445 286
183 3300050514 nmdc:mga08x19_208490_c1 nmdc:mga08x19_208490_c1_22_882 286
184 3300050514 nmdc:mga08x19_64160_c1 nmdc:mga08x19_64160_c1_308_1168 286
185 3300003320 rootH2_10328943 rootH2_103289431 287
186 3300005329 Ga0070683_100325347 Ga0070683_1003253471 287
187 3300005337 Ga0070682_100091395 Ga0070682_1000913952 287
188 3300005338 Ga0068868_100057583 Ga0068868_1000575833 287
189 3300005341 Ga0070691_10006654 Ga0070691_100066541 287
190 3300005355 Ga0070671_100233121 Ga0070671_1002331211 287
191 3300005406 Ga0070703_10001782 Ga0070703_100017825 287
192 3300005406 Ga0070703_10055878 Ga0070703_100558782 287
193 3300005434 Ga0070709_10045677 Ga0070709_100456772 287
194 3300005434 Ga0070709_10055134 Ga0070709_100551342 287
195 3300005435 Ga0070714_100000060 Ga0070714_10000006013 287
196 3300005435 Ga0070714_100004520 Ga0070714_1000045205 287
197 3300005435 Ga0070714_100250036 Ga0070714_1002500361 287
198 3300005436 Ga0070713_100000118 Ga0070713_10000011819 287
199 3300005436 Ga0070713_100033366 Ga0070713_1000333663 287
200 3300005436 Ga0070713_100402533 Ga0070713_1004025331 287
201 3300005437 Ga0070710_10009712 Ga0070710_100097123 287
202 3300005438 Ga0070701_10000500 Ga0070701_100005002 287
203 3300005439 Ga0070711_100000168 Ga0070711_1000001688 287
204 3300005439 Ga0070711_100027842 Ga0070711_1000278424 287
205 3300005440 Ga0070705_100001280 Ga0070705_1000012804 287
206 3300005440 Ga0070705_100024312 Ga0070705_1000243124 287
207 3300005440 Ga0070705_100300491 Ga0070705_1003004911 287
208 3300005441 Ga0070700_100019543 Ga0070700_1000195433 287
209 3300005445 Ga0070708_100019039 Ga0070708_1000190392 287
210 3300005445 Ga0070708_100031458 Ga0070708_1000314583 287
211 3300005445 Ga0070708_100056909 Ga0070708_1000569093 287
212 3300005445 Ga0070708_100081117 Ga0070708_1000811172 287
213 3300005458 Ga0070681_10004638 Ga0070681_100046385 287
214 3300005458 Ga0070681_10045088 Ga0070681_100450883 287
215 3300005458 Ga0070681_10097425 Ga0070681_100974252 287
216 3300005459 Ga0068867_100318522 Ga0068867_1003185222 287
217 3300005467 Ga0070706_100006431 Ga0070706_1000064315 287
218 3300005467 Ga0070706_100029898 Ga0070706_1000298982 287
219 3300005467 Ga0070706_100055586 Ga0070706_1000555862 287
220 3300005468 Ga0070707_100011641 Ga0070707_1000116413 287
221 3300005468 Ga0070707_100070952 Ga0070707_1000709523 287
222 3300005468 Ga0070707_100150619 Ga0070707_1001506191 287
223 3300005468 Ga0070707_100191864 Ga0070707_1001918642 287
224 3300005471 Ga0070698_100026285 Ga0070698_1000262853 287
225 3300005471 Ga0070698_100052091 Ga0070698_1000520915 287
226 3300005518 Ga0070699_100003868 Ga0070699_1000038682 287
227 3300005518 Ga0070699_100005294 Ga0070699_10000529411 287
228 3300005518 Ga0070699_100106947 Ga0070699_1001069472 287
229 3300005530 Ga0070679_100012890 Ga0070679_1000128905 287
230 3300005530 Ga0070679_100081536 Ga0070679_1000815365 287
231 3300005535 Ga0070684_100084783 Ga0070684_1000847832 287
232 3300005535 Ga0070684_100088861 Ga0070684_1000888611 287
233 3300005536 Ga0070697_100000226 Ga0070697_10000022633 287
234 3300005536 Ga0070697_100001061 Ga0070697_10000106122 287
235 3300005536 Ga0070697_100050444 Ga0070697_1000504442 287
236 3300005536 Ga0070697_100353018 Ga0070697_1003530182 287
237 3300005539 Ga0068853_100067937 Ga0068853_1000679371 287
238 3300005543 Ga0070672_100104754 Ga0070672_1001047542 287
239 3300005544 Ga0070686_100003915 Ga0070686_1000039154 287
240 3300005545 Ga0070695_100000559 Ga0070695_10000055913 287
241 3300005546 Ga0070696_100019275 Ga0070696_1000192752 287
242 3300005547 Ga0070693_100000144 Ga0070693_10000014412 287
243 3300005548 Ga0070665_100133525 Ga0070665_1001335252 287
244 3300005549 Ga0070704_100017363 Ga0070704_1000173633 287
245 3300005564 Ga0070664_100145063 Ga0070664_1001450632 287
246 3300005577 Ga0068857_100146217 Ga0068857_1001462172 287
247 3300005578 Ga0068854_100236606 Ga0068854_1002366062 287
248 3300005614 Ga0068856_100000072 Ga0068856_10000007262 287
249 3300005614 Ga0068856_100048932 Ga0068856_1000489322 287
250 3300005614 Ga0068856_100624334 Ga0068856_1006243341 287
251 3300005615 Ga0070702_100134025 Ga0070702_1001340251 287
252 3300005616 Ga0068852_100080623 Ga0068852_1000806233 287
253 3300005617 Ga0068859_100064557 Ga0068859_1000645573 287
254 3300005718 Ga0068866_10106250 Ga0068866_101062501 287
255 3300005834 Ga0068851_10041039 Ga0068851_100410392 287
256 3300005841 Ga0068863_100008130 Ga0068863_1000081303 287
257 3300005841 Ga0068863_100081916 Ga0068863_1000819162 287
258 3300005842 Ga0068858_100049666 Ga0068858_1000496663 287
259 3300005842 Ga0068858_100228179 Ga0068858_1002281792 287
260 3300005843 Ga0068860_100105417 Ga0068860_1001054172 287
261 3300005844 Ga0068862_100236484 Ga0068862_1002364842 287
262 3300006028 Ga0070717_10001588 Ga0070717_100015888 287
263 3300006028 Ga0070717_10004202 Ga0070717_1000420210 287
264 3300006028 Ga0070717_10022730 Ga0070717_100227305 287
265 3300006028 Ga0070717_10034041 Ga0070717_100340412 287
266 3300006028 Ga0070717_10107713 Ga0070717_101077133 287
267 3300006173 Ga0070716_100001474 Ga0070716_1000014743 287
268 3300006173 Ga0070716_100027403 Ga0070716_1000274034 287
269 3300006173 Ga0070716_100096204 Ga0070716_1000962042 287
270 3300006173 Ga0070716_100182690 Ga0070716_1001826902 287
271 3300006173 Ga0070716_100213732 Ga0070716_1002137322 287
272 3300006175 Ga0070712_100000110 Ga0070712_10000011027 287
273 3300006175 Ga0070712_100003435 Ga0070712_1000034356 287
274 3300006175 Ga0070712_100062977 Ga0070712_1000629772 287
275 3300006175 Ga0070712_100065152 Ga0070712_1000651521 287
276 3300006175 Ga0070712_100092705 Ga0070712_1000927052 287
277 3300006237 Ga0097621_100066888 Ga0097621_1000668881 287
278 3300006358 Ga0068871_100006579 Ga0068871_1000065795 287
279 3300006358 Ga0068871_100171017 Ga0068871_1001710172 287
280 3300006844 Ga0075428_100031757 Ga0075428_1000317577 287
281 3300006847 Ga0075431_100441745 Ga0075431_1004417452 287
282 3300006852 Ga0075433_10127793 Ga0075433_101277932 287
283 3300006871 Ga0075434_100001926 Ga0075434_1000019269 287
284 3300006871 Ga0075434_100009753 Ga0075434_1000097536 287
285 3300006871 Ga0075434_100047635 Ga0075434_1000476355 287
286 3300006881 Ga0068865_100081531 Ga0068865_1000815312 287
287 3300006881 Ga0068865_100226311 Ga0068865_1002263111 287
288 3300006914 Ga0075436_100007406 Ga0075436_1000074062 287
289 3300006914 Ga0075436_100031127 Ga0075436_1000311271 287
290 3300006914 Ga0075436_100033265 Ga0075436_1000332653 287
291 3300006931 Ga0097620_100064559 Ga0097620_1000645593 287
292 3300007076 Ga0075435_100125926 Ga0075435_1001259262 287
293 3300007076 Ga0075435_100494614 Ga0075435_1004946142 287
294 3300007265 Ga0099794_10010021 Ga0099794_100100213 287
295 3300007788 Ga0099795_10002935 Ga0099795_100029352 287
296 3300009093 Ga0105240_10000454 Ga0105240_1000045439 287
297 3300009093 Ga0105240_10015467 Ga0105240_100154673 287
298 3300009093 Ga0105240_10186291 Ga0105240_101862912 287
299 3300009093 Ga0105240_10668123 Ga0105240_106681231 287
300 3300009098 Ga0105245_10204178 Ga0105245_102041781 287
301 3300009147 Ga0114129_10765049 Ga0114129_107650492 287
302 3300009176 Ga0105242_10080113 Ga0105242_100801134 287
303 3300009176 Ga0105242_10256526 Ga0105242_102565261 287
304 3300009177 Ga0105248_10067384 Ga0105248_100673844 287
305 3300009177 Ga0105248_10096356 Ga0105248_100963562 287
306 3300009545 Ga0105237_10078300 Ga0105237_100783002 287
307 3300009551 Ga0105238_10320863 Ga0105238_103208632 287
308 3300010375 Ga0105239_10189317 Ga0105239_101893171 287
309 3300013102 Ga0157371_10269788 Ga0157371_102697881 287
310 3300013104 Ga0157370_10000294 Ga0157370_1000029424 287
311 3300013105 Ga0157369_10000244 Ga0157369_1000024425 287
312 3300013105 Ga0157369_10155727 Ga0157369_101557272 287
313 3300013105 Ga0157369_10303845 Ga0157369_103038452 287
314 3300013105 Ga0157369_10310839 Ga0157369_103108392 287
315 3300013296 Ga0157374_10025709 Ga0157374_100257095 287
316 3300013296 Ga0157374_10147210 Ga0157374_101472102 287
317 3300013297 Ga0157378_10009064 Ga0157378_100090645 287
318 3300013297 Ga0157378_10103327 Ga0157378_101033272 287
319 3300013297 Ga0157378_10136088 Ga0157378_101360881 287
320 3300013306 Ga0163162_10145033 Ga0163162_101450333 287
321 3300013307 Ga0157372_10004946 Ga0157372_100049467 287
322 3300013307 Ga0157372_10081767 Ga0157372_100817672 287
323 3300013307 Ga0157372_10242196 Ga0157372_102421962 287
324 3300013307 Ga0157372_10254914 Ga0157372_102549144 287
325 3300013307 Ga0157372_10354697 Ga0157372_103546972 287
326 3300013308 Ga0157375_10171370 Ga0157375_101713702 287
327 3300013308 Ga0157375_10325325 Ga0157375_103253252 287
328 3300014325 Ga0163163_10071314 Ga0163163_100713142 287
329 3300014968 Ga0157379_10033441 Ga0157379_100334413 287
330 3300014968 Ga0157379_10113970 Ga0157379_101139701 287
331 3300014968 Ga0157379_10141371 Ga0157379_101413711 287
332 3300014969 Ga0157376_10000032 Ga0157376_10000032103 287
333 3300014969 Ga0157376_10240844 Ga0157376_102408442 287
334 3300022467 Ga0224712_10169906 Ga0224712_101699061 287
335 3300022730 Ga0224570_101057 Ga0224570_1010572 287
336 3300024225 Ga0224572_1000993 Ga0224572_10009934 287
337 3300024225 Ga0224572_1007234 Ga0224572_10072342 287
338 3300024227 Ga0228598_1003277 Ga0228598_10032774 287
339 3300025321 Ga0207656_10032669 Ga0207656_100326692 287
340 3300025885 Ga0207653_10000107 Ga0207653_1000010736 287
341 3300025898 Ga0207692_10006658 Ga0207692_100066582 287
342 3300025898 Ga0207692_10007149 Ga0207692_100071493 287
343 3300025899 Ga0207642_10021786 Ga0207642_100217862 287
344 3300025904 Ga0207647_10003363 Ga0207647_100033633 287
345 3300025904 Ga0207647_10066087 Ga0207647_100660872 287
346 3300025906 Ga0207699_10003312 Ga0207699_100033123 287
347 3300025906 Ga0207699_10031521 Ga0207699_100315212 287
348 3300025906 Ga0207699_10039017 Ga0207699_100390173 287
349 3300025906 Ga0207699_10043102 Ga0207699_100431022 287
350 3300025907 Ga0207645_10074845 Ga0207645_100748452 287
351 3300025909 Ga0207705_10058508 Ga0207705_100585082 287
352 3300025910 Ga0207684_10000445 Ga0207684_1000044540 287
353 3300025910 Ga0207684_10016084 Ga0207684_100160841 287
354 3300025910 Ga0207684_10082034 Ga0207684_100820342 287
355 3300025910 Ga0207684_10284963 Ga0207684_102849631 287
356 3300025912 Ga0207707_10268097 Ga0207707_102680972 287
357 3300025913 Ga0207695_10124215 Ga0207695_101242152 287
358 3300025914 Ga0207671_10092598 Ga0207671_100925981 287
359 3300025914 Ga0207671_10146005 Ga0207671_101460052 287
360 3300025914 Ga0207671_10206217 Ga0207671_102062171 287
361 3300025915 Ga0207693_10000353 Ga0207693_1000035321 287
362 3300025915 Ga0207693_10002517 Ga0207693_100025177 287
363 3300025915 Ga0207693_10007255 Ga0207693_100072557 287
364 3300025915 Ga0207693_10007310 Ga0207693_1000731010 287
365 3300025915 Ga0207693_10011640 Ga0207693_100116403 287
366 3300025915 Ga0207693_10040101 Ga0207693_100401014 287
367 3300025915 Ga0207693_10231917 Ga0207693_102319172 287
368 3300025916 Ga0207663_10000671 Ga0207663_100006715 287
369 3300025916 Ga0207663_10024795 Ga0207663_100247952 287
370 3300025921 Ga0207652_10013262 Ga0207652_100132622 287
371 3300025922 Ga0207646_10000842 Ga0207646_100008423 287
372 3300025922 Ga0207646_10002173 Ga0207646_100021736 287
373 3300025922 Ga0207646_10053146 Ga0207646_100531462 287
374 3300025922 Ga0207646_10248945 Ga0207646_102489452 287
375 3300025928 Ga0207700_10000210 Ga0207700_100002108 287
376 3300025928 Ga0207700_10003334 Ga0207700_100033344 287
377 3300025928 Ga0207700_10060554 Ga0207700_100605543 287
378 3300025929 Ga0207664_10000017 Ga0207664_10000017128 287
379 3300025929 Ga0207664_10014897 Ga0207664_100148973 287
380 3300025929 Ga0207664_10068415 Ga0207664_100684151 287
381 3300025929 Ga0207664_10379972 Ga0207664_103799722 287
382 3300025938 Ga0207704_10022247 Ga0207704_100222472 287
383 3300025938 Ga0207704_10335540 Ga0207704_103355401 287
384 3300025939 Ga0207665_10000053 Ga0207665_1000005311 287
385 3300025939 Ga0207665_10048464 Ga0207665_100484643 287
386 3300025939 Ga0207665_10058248 Ga0207665_100582482 287
387 3300025939 Ga0207665_10117884 Ga0207665_101178841 287
388 3300025939 Ga0207665_10184145 Ga0207665_101841451 287
389 3300025940 Ga0207691_10005128 Ga0207691_100051289 287
390 3300025940 Ga0207691_10128591 Ga0207691_101285913 287
391 3300025941 Ga0207711_10069407 Ga0207711_100694071 287
392 3300025941 Ga0207711_10129142 Ga0207711_101291422 287
393 3300025941 Ga0207711_10315325 Ga0207711_103153252 287
394 3300025941 Ga0207711_10572468 Ga0207711_105724681 287
395 3300025942 Ga0207689_10060272 Ga0207689_100602721 287
396 3300025944 Ga0207661_10121395 Ga0207661_101213952 287
397 3300025944 Ga0207661_10134151 Ga0207661_101341512 287
398 3300025944 Ga0207661_10193295 Ga0207661_101932952 287
399 3300025949 Ga0207667_10149383 Ga0207667_101493832 287
400 3300026023 Ga0207677_10045747 Ga0207677_100457472 287
401 3300026023 Ga0207677_10088141 Ga0207677_100881413 287
402 3300026035 Ga0207703_10293580 Ga0207703_102935802 287
403 3300026041 Ga0207639_10046754 Ga0207639_100467542 287
404 3300026075 Ga0207708_10113863 Ga0207708_101138632 287
405 3300026078 Ga0207702_10000366 Ga0207702_1000036645 287
406 3300026078 Ga0207702_10513182 Ga0207702_105131821 287
407 3300026078 Ga0207702_10525746 Ga0207702_105257461 287
408 3300026088 Ga0207641_10001205 Ga0207641_100012059 287
409 3300026088 Ga0207641_10222414 Ga0207641_102224142 287
410 3300026095 Ga0207676_10451604 Ga0207676_104516041 287
411 3300026116 Ga0207674_10000245 Ga0207674_1000024534 287
412 3300026116 Ga0207674_10061506 Ga0207674_100615063 287
413 3300026118 Ga0207675_100160150 Ga0207675_1001601502 287
414 3300026142 Ga0207698_10000033 Ga0207698_1000003377 287
415 3300026142 Ga0207698_10070569 Ga0207698_100705691 287
416 3300027907 Ga0207428_10317670 Ga0207428_103176702 287
417 3300028016 Ga0265354_1000071 Ga0265354_10000713 287
418 3300028017 Ga0265356_1000111 Ga0265356_10001116 287
419 3300028379 Ga0268266_10065986 Ga0268266_100659863 287
420 3300028380 Ga0268265_10218707 Ga0268265_102187072 287
421 3300028381 Ga0268264_10072168 Ga0268264_100721682 287
422 3300028800 Ga0265338_10006709 Ga0265338_100067096 287
423 3300030760 Ga0265762_1001913 Ga0265762_10019131 287
424 3300030760 Ga0265762_1003447 Ga0265762_10034472 287
425 3300031090 Ga0265760_10026738 Ga0265760_100267382 287
426 3300031090 Ga0265760_10052431 Ga0265760_100524311 287
427 3300031090 Ga0265760_10058114 Ga0265760_100581142 287
428 3300031241 Ga0265325_10005171 Ga0265325_100051712 287
429 3300031249 Ga0265339_10016184 Ga0265339_100161844 287
430 3300033180 Ga0307510_10238537 Ga0307510_102385372 287
431 3300035113 Ga0373936_0001594 Ga0373936_0001594_3570_4433 287
432 3300035113 Ga0373936_0010109 Ga0373936_0010109_1329_2192 287
433 3300035118 Ga0373954_0001349 Ga0373954_0001349_1837_2700 287
434 3300035118 Ga0373954_0054558 Ga0373954_0054558_1003_1866 287
435 3300035118 Ga0373954_0095267 Ga0373954_0095267_467_1333 287
436 3300035119 Ga0373956_0010139 Ga0373956_0010139_218_1081 287
437 3300035120 Ga0373957_0022518 Ga0373957_0022518_765_1628 287
438 3300035171 Ga0373946_0002850 Ga0373946_0002850_296_1159 287
439 3300035410 Ga0373924_0030839 Ga0373924_0030839_35_898 287
440 3300035692 Ga0373935_0001452 Ga0373935_0001452_8647_9510 287
441 3300035692 Ga0373935_0018862 Ga0373935_0018862_886_1749 287
442 3300035695 Ga0373927_0001907 Ga0373927_0001907_12587_13450 287
443 3300035695 Ga0373927_0010455 Ga0373927_0010455_170_1033 287
444 3300035724 Ga0373933_0003934 Ga0373933_0003934_4758_5621 287
445 3300035725 Ga0373947_0001966 Ga0373947_0001966_10201_11064 287
446 3300035725 Ga0373947_0005727 Ga0373947_0005727_4426_5289 287
447 3300036401 Ga0373937_0000082 Ga0373937_0000082_31587_32450 287
448 3300036401 Ga0373937_0048376 Ga0373937_0048376_1564_2433 287
449 3300036401 Ga0373937_0187397 Ga0373937_0187397_154_1017 287
450 3300036401 Ga0373937_0219268 Ga0373937_0219268_908_1771 287
451 3300037068 Ga0373925_0000873 Ga0373925_0000873_1238_2101 287
452 3300037068 Ga0373925_0005959 Ga0373925_0005959_2161_3024 287
453 3300037068 Ga0373925_0045003 Ga0373925_0045003_478_1341 287
454 3300037312 Ga0395899_0305361 Ga0395899_0305361_19_882 287
455 3300037853 Ga0436364_1116354 Ga0436364_1116354_131_994 287
456 3300039437 Ga0436365_1107063 Ga0436365_1107063_1045_1911 287
457 3300042876 Ga0451577_0029083 Ga0451577_0029083_1494_2357 287
458 3300044712 Ga0453684_0173281 Ga0453684_0173281_622_1485 287
459 3300045051 Ga0451576_0018870 Ga0451576_0018870_5686_6549 287
460 3300045051 Ga0451576_0132681 Ga0451576_0132681_806_1669 287
461 3300046455 Ga0495603_0134644 Ga0495603_0134644_296_1159 287
462 3300046459 Ga0495629_0036894 Ga0495629_0036894_577_1440 287
463 3300046462 Ga0495651_0011121 Ga0495651_0011121_233_1096 287
464 3300046472 Ga0495580_0001996 Ga0495580_0001996_9306_10169 287
465 3300046472 Ga0495580_0002625 Ga0495580_0002625_300_1166 287
466 3300046472 Ga0495580_0034905 Ga0495580_0034905_1785_2657 287
467 3300046472 Ga0495580_0136316 Ga0495580_0136316_330_1193 287
468 3300046473 Ga0495582_0000650 Ga0495582_0000650_698_1570 287
469 3300046473 Ga0495582_0001904 Ga0495582_0001904_2078_2941 287
470 3300046473 Ga0495582_0057862 Ga0495582_0057862_57_920 287
471 3300046477 Ga0495664_0101991 Ga0495664_0101991_753_1616 287
472 3300046511 Ga0495608_0082886 Ga0495608_0082886_1147_2010 287
473 3300046516 Ga0495628_0223603 Ga0495628_0223603_209_1072 287
474 3300046517 Ga0495630_0032670 Ga0495630_0032670_1697_2560 287
475 3300046517 Ga0495630_0043386 Ga0495630_0043386_1432_2295 287
476 3300046531 Ga0495665_0002094 Ga0495665_0002094_1543_2406 287
477 3300046531 Ga0495665_0020830 Ga0495665_0020830_2067_2933 287
478 3300046533 Ga0495640_0022980 Ga0495640_0022980_964_1827 287
479 3300046536 Ga0495587_0021048 Ga0495587_0021048_3077_3940 287
480 3300046559 Ga0495667_0031126 Ga0495667_0031126_1813_2676 287
481 3300046642 Ga0495634_0061132 Ga0495634_0061132_1035_1898 287
482 3300046642 Ga0495634_0153288 Ga0495634_0153288_172_1035 287
483 3300046663 Ga0495635_0051485 Ga0495635_0051485_446_1309 287
484 3300046679 Ga0495623_0056092 Ga0495623_0056092_583_1446 287
485 3300046681 Ga0495647_0007827 Ga0495647_0007827_966_1829 287
486 3300046683 Ga0495658_0030470 Ga0495658_0030470_588_1451 287
487 3300046690 Ga0495624_0094439 Ga0495624_0094439_815_1678 287
488 3300047315 Ga0495581_0010415 Ga0495581_0010415_2663_3526 287
489 3300047317 Ga0495604_0000235 Ga0495604_0000235_17615_18478 287
490 3300047319 Ga0495674_0149638 Ga0495674_0149638_379_1242 287
491 3300047321 Ga0495676_0034427 Ga0495676_0034427_1607_2470 287
492 3300047471 Ga0495684_0008107 Ga0495684_0008107_551_1414 287
493 3300047471 Ga0495684_0076553 Ga0495684_0076553_22_885 287
494 3300048088 Ga0495602_0004006 Ga0495602_0004006_5787_6650 287
495 3300048088 Ga0495602_0072585 Ga0495602_0072585_66_929 287
496 3300048088 Ga0495602_0097302 Ga0495602_0097302_890_1753 287
497 3300048088 Ga0495602_0118107 Ga0495602_0118107_185_1048 287
498 3300048904 Ga0496101_0100745 Ga0496101_0100745_474_1337 287
499 3300048906 Ga0496103_0294817 Ga0496103_0294817_11_874 287
500 3300048907 Ga0496104_0003899 Ga0496104_0003899_8625_9491 287
501 3300048908 Ga0496105_0079654 Ga0496105_0079654_1022_1939 287
502 3300048915 Ga0496112_0029534 Ga0496112_0029534_2406_3269 287
503 3300048916 Ga0496113_0389800 Ga0496113_0389800_22_885 287
504 3300048917 Ga0496114_0005831 Ga0496114_0005831_4657_5541 287
505 3300048917 Ga0496114_0171636 Ga0496114_0171636_657_1571 287
506 3300048917 Ga0496114_0319922 Ga0496114_0319922_427_1290 287
507 3300050510 nmdc:mga06r32_403565_c1 nmdc:mga06r32_403565_c1_212_1075 287
508 3300050511 nmdc:mga08y16_453383_c1 nmdc:mga08y16_453383_c1_267_1130 287
509 3300050512 nmdc:mga0n895_229690_c1 nmdc:mga0n895_229690_c1_998_1861 287
510 3300050512 nmdc:mga0n895_465_c1 nmdc:mga0n895_465_c1_8287_9156 287
511 3300050512 nmdc:mga0n895_53515_c1 nmdc:mga0n895_53515_c1_2984_3868 287
512 3300050513 nmdc:mga0rr50_149856_c1 nmdc:mga0rr50_149856_c1_947_1813 287
513 3300050513 nmdc:mga0rr50_149902_c1 nmdc:mga0rr50_149902_c1_24_887 287
514 3300050513 nmdc:mga0rr50_30057_c1 nmdc:mga0rr50_30057_c1_2343_3206 287
515 3300050514 nmdc:mga08x19_115980_c1 nmdc:mga08x19_115980_c1_764_1627 287
516 3300050514 nmdc:mga08x19_24089_c1 nmdc:mga08x19_24089_c1_2844_3707 287
517 3300050514 nmdc:mga08x19_28440_c1 nmdc:mga08x19_28440_c1_1948_2847 287
518 3300050514 nmdc:mga08x19_5157_c1 nmdc:mga08x19_5157_c1_1355_2218 287
519 3300050515 nmdc:mga0a205_20354_c1 nmdc:mga0a205_20354_c1_2703_3572 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

54

277

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8637 37 271
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8488 37 271
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.841 37 272
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8383 27 285
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8285 24 284
ID Description Score Start End Superfamily
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7941 24 284 3.20.20.150
3vylH00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.762 37 269 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.76 37 287 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7509 24 284 3.20.20.150
3dx5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7502 39 278 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9ZDK5-F1-model_v4 Xylose isomerase 0.9936 49 287 GO:0016853
AF-A0A2V7WTW8-F1-model_v4 Xylose isomerase 0.9899 49 255 GO:0016853
AF-A0A2V9ZDK5-F1-model_v4 Xylose isomerase 0.9895 49 287 GO:0016853
AF-A0A1Q8B116-F1-model_v4 Xylose isomerase 0.9861 87 287 GO:0016853
AF-A0A2V9IAU4-F1-model_v4 Xylose isomerase 0.9818 114 287 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.94 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map