F458440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 519 | 385 | 397 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0179969|Ga0466961_0179969_519_1148 |
| Length | 209 |
| Sequence | MLSAVRIISEAAELAARRHNGMARKGRGNEPYINHLAEVANRLAKATDGADAELVAAGWLHDVIEDTDTTRDELARTFSERVAALVVECTDDMTLPKAERRRLQVVDAPKKSASAKLIKIADKISNIGARINPDPASRSAMIWSIIQDGPSRLSPPVVAATLRWTGSSTIPSSLPGAPYDGRAADIDLYWRSCRCCIGCAWLQRTCSRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 7 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 10 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 11 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 12 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 13 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 14 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 15 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 16 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 17 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 18 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 19 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 20 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 21 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 22 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 23 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 24 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 25 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 26 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 27 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 28 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 29 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 30 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 31 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 32 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 33 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 34 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 35 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 36 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 37 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 38 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 39 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 40 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 41 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 42 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 43 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 44 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 45 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 46 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 47 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 48 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 49 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 50 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 51 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 52 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 53 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 54 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 55 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 56 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 57 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 58 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 59 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 60 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 61 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 62 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 63 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 64 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 65 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 66 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 67 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 68 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 69 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 70 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 71 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 72 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 73 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 74 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 75 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 76 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 77 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 78 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 79 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 80 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 81 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 82 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 83 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 84 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 85 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 86 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 87 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 88 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 89 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 90 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 91 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 92 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 93 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 94 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 95 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 96 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 97 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 98 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 99 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 100 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 101 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 102 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 103 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 104 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 105 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 123 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 124 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 125 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 131 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 135 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 137 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 138 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 139 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 141 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 142 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 143 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 144 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 145 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 146 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 147 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 148 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 150 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 151 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 152 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 154 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 155 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 157 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 158 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 235 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 236 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 346 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 349 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 350 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 351 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 355 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 361 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 366 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 368 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 369 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 370 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 371 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 372 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 373 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 374 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 375 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 376 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 377 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 378 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 379 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 380 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 381 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 382 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 383 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 384 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 385 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.6 |
| Metatranscriptomes | 0.19 |
| Isolates | 23.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.52 |
| Nodule | 20.04 |
| Rhizoplane | 7.51 |
| Rhizosphere | 50.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065165_1019150 | 3300005262 | Bacteria | 2454 |
| 2 | Ga0070676_10429548 | 3300005328 | Bacteria | 925 |
| 3 | Ga0070680_100005141 | 3300005336 | Bacteria | 9886 |
| 4 | Ga0070682_100396195 | 3300005337 | Bacteria | 1043 |
| 5 | Ga0070682_100571803 | 3300005337 | Bacteria | 888 |
| 6 | Ga0070660_100063206 | 3300005339 | Bacteria | 2877 |
| 7 | Ga0070660_100267952 | 3300005339 | Bacteria | 1395 |
| 8 | Ga0070689_100157744 | 3300005340 | Bacteria | 1833 |
| 9 | Ga0070691_10201868 | 3300005341 | Bacteria | 1045 |
| 10 | Ga0070661_100151918 | 3300005344 | Bacteria | 1751 |
| 11 | Ga0070668_100155128 | 3300005347 | Bacteria | 1854 |
| 12 | Ga0070668_100235046 | 3300005347 | Bacteria | 1516 |
| 13 | Ga0070668_100875501 | 3300005347 | Bacteria | 802 |
| 14 | Ga0070668_100901166 | 3300005347 | Bacteria | 790 |
| 15 | Ga0070669_100198704 | 3300005353 | Bacteria | 1577 |
| 16 | Ga0070675_100163507 | 3300005354 | Bacteria | 1916 |
| 17 | Ga0070671_100412987 | 3300005355 | Bacteria | 1155 |
| 18 | Ga0070671_101377491 | 3300005355 | Bacteria | 623 |
| 19 | Ga0070674_100024125 | 3300005356 | Bacteria | 3945 |
| 20 | Ga0070659_100413606 | 3300005366 | Bacteria | 1140 |
| 21 | Ga0070667_101112592 | 3300005367 | Bacteria | 738 |
| 22 | Ga0070709_10409023 | 3300005434 | Bacteria | 1015 |
| 23 | Ga0070663_100008516 | 3300005455 | Bacteria | 6314 |
| 24 | Ga0070663_100265140 | 3300005455 | Bacteria | 1364 |
| 25 | Ga0070663_100331118 | 3300005455 | Bacteria | 1227 |
| 26 | Ga0070678_100164951 | 3300005456 | Bacteria | 1799 |
| 27 | Ga0070678_100461277 | 3300005456 | Bacteria | 1115 |
| 28 | Ga0070681_10094620 | 3300005458 | Bacteria | 2936 |
| 29 | Ga0068867_100363833 | 3300005459 | Bacteria | 1210 |
| 30 | Ga0068867_100777802 | 3300005459 | Bacteria | 852 |
| 31 | Ga0070685_10466376 | 3300005466 | Bacteria | 888 |
| 32 | Ga0070706_100360397 | 3300005467 | Bacteria | 1355 |
| 33 | Ga0070698_100161423 | 3300005471 | Bacteria | 2185 |
| 34 | Ga0070679_100079934 | 3300005530 | Bacteria | 3259 |
| 35 | Ga0070684_100046744 | 3300005535 | Bacteria | 3750 |
| 36 | Ga0070697_100286524 | 3300005536 | Bacteria | 1414 |
| 37 | Ga0068853_100026423 | 3300005539 | Bacteria | 4874 |
| 38 | Ga0068853_100781492 | 3300005539 | Bacteria | 914 |
| 39 | Ga0068853_100882278 | 3300005539 | Bacteria | 859 |
| 40 | Ga0068853_101459987 | 3300005539 | Bacteria | 662 |
| 41 | Ga0070672_100447236 | 3300005543 | Bacteria | 1113 |
| 42 | Ga0070672_100918328 | 3300005543 | Bacteria | 774 |
| 43 | Ga0070686_100132633 | 3300005544 | Bacteria | 1725 |
| 44 | Ga0070665_100100858 | 3300005548 | Bacteria | 2891 |
| 45 | Ga0070665_100131661 | 3300005548 | Bacteria | 2503 |
| 46 | Ga0070665_100490922 | 3300005548 | Bacteria | 1239 |
| 47 | Ga0070665_100965293 | 3300005548 | Bacteria | 865 |
| 48 | Ga0070665_101387741 | 3300005548 | Bacteria | 712 |
| 49 | Ga0068855_100038094 | 3300005563 | Bacteria | 5714 |
| 50 | Ga0068855_100882741 | 3300005563 | Bacteria | 946 |
| 51 | Ga0068855_101280080 | 3300005563 | Bacteria | 760 |
| 52 | Ga0070664_100171957 | 3300005564 | Bacteria | 1922 |
| 53 | Ga0068857_100025776 | 3300005577 | Bacteria | 5177 |
| 54 | Ga0068854_100125831 | 3300005578 | Bacteria | 1952 |
| 55 | Ga0068856_100323070 | 3300005614 | Bacteria | 1561 |
| 56 | Ga0068856_100462538 | 3300005614 | Bacteria | 1289 |
| 57 | Ga0068856_100589509 | 3300005614 | Bacteria | 1133 |
| 58 | Ga0070702_100276630 | 3300005615 | Bacteria | 1151 |
| 59 | Ga0068852_100030155 | 3300005616 | Bacteria | 4462 |
| 60 | Ga0068852_100188677 | 3300005616 | Bacteria | 1943 |
| 61 | Ga0068852_100363639 | 3300005616 | Bacteria | 1416 |
| 62 | Ga0068861_101171061 | 3300005719 | Bacteria | 742 |
| 63 | Ga0068851_10006471 | 3300005834 | Bacteria | 5349 |
| 64 | Ga0068863_100241989 | 3300005841 | Bacteria | 1742 |
| 65 | Ga0068858_100468822 | 3300005842 | Bacteria | 1215 |
| 66 | Ga0068860_101995173 | 3300005843 | Bacteria | 602 |
| 67 | Ga0068862_100237880 | 3300005844 | Bacteria | 1654 |
| 68 | Ga0081540_1062753 | 3300005983 | Bacteria | 1763 |
| 69 | Ga0081540_1163381 | 3300005983 | Bacteria | 860 |
| 70 | Ga0070717_11206514 | 3300006028 | Bacteria | 688 |
| 71 | Ga0075365_10074124 | 3300006038 | Bacteria | 2295 |
| 72 | Ga0075365_10103142 | 3300006038 | Bacteria | 1955 |
| 73 | Ga0075363_100001410 | 3300006048 | Bacteria | 9093 |
| 74 | Ga0075364_10561494 | 3300006051 | Bacteria | 780 |
| 75 | Ga0075364_10564849 | 3300006051 | Bacteria | 778 |
| 76 | Ga0070712_100243151 | 3300006175 | Bacteria | 1434 |
| 77 | Ga0075367_10008466 | 3300006178 | Bacteria | 5330 |
| 78 | Ga0075369_10132716 | 3300006186 | Bacteria | 1132 |
| 79 | Ga0097621_100379278 | 3300006237 | Bacteria | 1263 |
| 80 | Ga0075370_10029115 | 3300006353 | Bacteria | 3073 |
| 81 | Ga0068871_100260839 | 3300006358 | Bacteria | 1511 |
| 82 | Ga0068871_100301846 | 3300006358 | Bacteria | 1406 |
| 83 | Ga0099823_1023273 | 3300006944 | Bacteria | 5681 |
| 84 | Ga0105240_10025071 | 3300009093 | Bacteria | 7850 |
| 85 | Ga0105240_10073053 | 3300009093 | Bacteria | 4237 |
| 86 | Ga0105240_10122488 | 3300009093 | Bacteria | 3129 |
| 87 | Ga0105245_10150293 | 3300009098 | Bacteria | 2201 |
| 88 | Ga0105245_10326876 | 3300009098 | Bacteria | 1512 |
| 89 | Ga0105247_10118877 | 3300009101 | Bacteria | 1710 |
| 90 | Ga0105247_10191361 | 3300009101 | Bacteria | 1370 |
| 91 | Ga0105241_10403215 | 3300009174 | Bacteria | 1200 |
| 92 | Ga0105241_11006847 | 3300009174 | Bacteria | 780 |
| 93 | Ga0105242_11088519 | 3300009176 | Bacteria | 812 |
| 94 | Ga0105248_10673186 | 3300009177 | Bacteria | 1167 |
| 95 | Ga0105248_11250062 | 3300009177 | Bacteria | 840 |
| 96 | Ga0105237_10014802 | 3300009545 | Bacteria | 8141 |
| 97 | Ga0105237_10017110 | 3300009545 | Bacteria | 7521 |
| 98 | Ga0105237_10105484 | 3300009545 | Bacteria | 2809 |
| 99 | Ga0105238_10001521 | 3300009551 | Bacteria | 23227 |
| 100 | Ga0105238_10437958 | 3300009551 | Bacteria | 1303 |
| 101 | Ga0105238_11612842 | 3300009551 | Bacteria | 679 |
| 102 | Ga0105239_10059018 | 3300010375 | Bacteria | 4211 |
| 103 | Ga0105239_10286303 | 3300010375 | Bacteria | 1855 |
| 104 | Ga0105239_10494692 | 3300010375 | Bacteria | 1390 |
| 105 | Ga0105239_10872232 | 3300010375 | Bacteria | 1032 |
| 106 | Ga0105246_10512617 | 3300011119 | Bacteria | 1021 |
| 107 | Ga0157370_10064495 | 3300013104 | Bacteria | 3468 |
| 108 | Ga0157370_10225226 | 3300013104 | Bacteria | 1736 |
| 109 | Ga0157369_10014713 | 3300013105 | Bacteria | 8827 |
| 110 | Ga0157374_10410884 | 3300013296 | Bacteria | 1351 |
| 111 | Ga0163162_10913450 | 3300013306 | Bacteria | 991 |
| 112 | Ga0157372_11975150 | 3300013307 | Bacteria | 670 |
| 113 | Ga0163163_10046845 | 3300014325 | Bacteria | 4247 |
| 114 | Ga0163163_11376836 | 3300014325 | Bacteria | 767 |
| 115 | Ga0157380_10513363 | 3300014326 | Bacteria | 1167 |
| 116 | Ga0157379_10697726 | 3300014968 | Bacteria | 952 |
| 117 | Ga0157376_10354198 | 3300014969 | Bacteria | 1406 |
| 118 | Ga0157376_10786792 | 3300014969 | Bacteria | 963 |
| 119 | Ga0209148_1000944 | 3300025254 | Bacteria | 19064 |
| 120 | Ga0209233_1001163 | 3300025261 | Bacteria | 10659 |
| 121 | Ga0209233_1027541 | 3300025261 | Bacteria | 1375 |
| 122 | Ga0209455_1007845 | 3300025272 | Bacteria | 2965 |
| 123 | Ga0209758_1001853 | 3300025297 | Bacteria | 23209 |
| 124 | Ga0209758_1016012 | 3300025297 | Bacteria | 3834 |
| 125 | Ga0209758_1062500 | 3300025297 | Bacteria | 1218 |
| 126 | Ga0209256_1005602 | 3300025299 | Bacteria | 7133 |
| 127 | Ga0209256_1051525 | 3300025299 | Bacteria | 992 |
| 128 | Ga0207426_1034412 | 3300025302 | Bacteria | 1625 |
| 129 | Ga0209257_1091455 | 3300025304 | Bacteria | 759 |
| 130 | Ga0207688_10111489 | 3300025901 | Bacteria | 1588 |
| 131 | Ga0207680_10553686 | 3300025903 | Bacteria | 821 |
| 132 | Ga0207647_10016170 | 3300025904 | Bacteria | 5094 |
| 133 | Ga0207647_10469259 | 3300025904 | Bacteria | 704 |
| 134 | Ga0207699_10058549 | 3300025906 | Bacteria | 2305 |
| 135 | Ga0207705_10876807 | 3300025909 | Bacteria | 696 |
| 136 | Ga0207684_10321875 | 3300025910 | Bacteria | 1333 |
| 137 | Ga0207654_10394779 | 3300025911 | Bacteria | 961 |
| 138 | Ga0207707_10000706 | 3300025912 | Bacteria | 33199 |
| 139 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 140 | Ga0207695_10032870 | 3300025913 | Bacteria | 5671 |
| 141 | Ga0207695_10145477 | 3300025913 | Bacteria | 2315 |
| 142 | Ga0207671_10003296 | 3300025914 | Bacteria | 16242 |
| 143 | Ga0207660_10002043 | 3300025917 | Bacteria | 13422 |
| 144 | Ga0207657_10004672 | 3300025919 | Bacteria | 14460 |
| 145 | Ga0207652_10003935 | 3300025921 | Bacteria | 12151 |
| 146 | Ga0207681_10387383 | 3300025923 | Bacteria | 1126 |
| 147 | Ga0207644_10900729 | 3300025931 | Bacteria | 741 |
| 148 | Ga0207690_10150765 | 3300025932 | Bacteria | 1723 |
| 149 | Ga0207706_10249322 | 3300025933 | Bacteria | 1551 |
| 150 | Ga0207686_10083041 | 3300025934 | Bacteria | 2096 |
| 151 | Ga0207686_10255276 | 3300025934 | Bacteria | 1283 |
| 152 | Ga0207709_10070549 | 3300025935 | Bacteria | 2216 |
| 153 | Ga0207709_10866387 | 3300025935 | Bacteria | 732 |
| 154 | Ga0207670_10202098 | 3300025936 | Bacteria | 1510 |
| 155 | Ga0207669_10031977 | 3300025937 | Bacteria | 2948 |
| 156 | Ga0207665_10506590 | 3300025939 | Bacteria | 933 |
| 157 | Ga0207691_10187184 | 3300025940 | Bacteria | 1807 |
| 158 | Ga0207711_10807392 | 3300025941 | Bacteria | 874 |
| 159 | Ga0207661_10191699 | 3300025944 | Bacteria | 1792 |
| 160 | Ga0207679_10085456 | 3300025945 | Bacteria | 2424 |
| 161 | Ga0207667_10007733 | 3300025949 | Bacteria | 12851 |
| 162 | Ga0207667_10582302 | 3300025949 | Bacteria | 1130 |
| 163 | Ga0207712_10074342 | 3300025961 | Bacteria | 2454 |
| 164 | Ga0207668_10006973 | 3300025972 | Bacteria | 6701 |
| 165 | Ga0207668_10361037 | 3300025972 | Bacteria | 1217 |
| 166 | Ga0207668_11118364 | 3300025972 | Bacteria | 706 |
| 167 | Ga0207640_10351682 | 3300025981 | Bacteria | 1184 |
| 168 | Ga0207640_10414409 | 3300025981 | Bacteria | 1101 |
| 169 | Ga0207639_10124224 | 3300026041 | Bacteria | 2126 |
| 170 | Ga0207639_10351959 | 3300026041 | Bacteria | 1316 |
| 171 | Ga0207639_11437760 | 3300026041 | Bacteria | 647 |
| 172 | Ga0207678_10007033 | 3300026067 | Bacteria | 9990 |
| 173 | Ga0207678_10106371 | 3300026067 | Bacteria | 2393 |
| 174 | Ga0207678_10746719 | 3300026067 | Bacteria | 863 |
| 175 | Ga0207678_10942413 | 3300026067 | Bacteria | 764 |
| 176 | Ga0207708_10101381 | 3300026075 | Bacteria | 2228 |
| 177 | Ga0207702_10432309 | 3300026078 | Bacteria | 1274 |
| 178 | Ga0207702_10523288 | 3300026078 | Bacteria | 1158 |
| 179 | Ga0207702_10786825 | 3300026078 | Bacteria | 940 |
| 180 | Ga0207648_10090589 | 3300026089 | Bacteria | 2672 |
| 181 | Ga0207648_10697656 | 3300026089 | Bacteria | 940 |
| 182 | Ga0207676_10261115 | 3300026095 | Bacteria | 1564 |
| 183 | Ga0207674_10046693 | 3300026116 | Bacteria | 4445 |
| 184 | Ga0207675_100810752 | 3300026118 | Bacteria | 950 |
| 185 | Ga0207683_10304244 | 3300026121 | Bacteria | 1459 |
| 186 | Ga0207698_10029276 | 3300026142 | Bacteria | 3942 |
| 187 | Ga0207698_10504860 | 3300026142 | Bacteria | 1177 |
| 188 | Ga0207698_11517549 | 3300026142 | Bacteria | 685 |
| 189 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 190 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 191 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 192 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 193 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 194 | Ga0209179_1026896 | 3300027512 | Bacteria | 1157 |
| 195 | Ga0209813_10024980 | 3300027866 | Bacteria | 1714 |
| 196 | Ga0268266_10001364 | 3300028379 | Bacteria | 29475 |
| 197 | Ga0268266_10033319 | 3300028379 | Bacteria | 4379 |
| 198 | Ga0268266_10824591 | 3300028379 | Bacteria | 896 |
| 199 | Ga0268265_10128250 | 3300028380 | Bacteria | 2103 |
| 200 | Ga0265337_1004679 | 3300028556 | Bacteria | 5626 |
| 201 | Ga0265326_10001084 | 3300028558 | Bacteria | 9692 |
| 202 | Ga0265319_1004856 | 3300028563 | Bacteria | 6578 |
| 203 | Ga0265334_10034125 | 3300028573 | Bacteria | 2020 |
| 204 | Ga0265323_10001297 | 3300028653 | Bacteria | 12481 |
| 205 | Ga0265322_10031991 | 3300028654 | Bacteria | 1501 |
| 206 | Ga0265336_10000620 | 3300028666 | Bacteria | 19526 |
| 207 | Ga0265338_10001434 | 3300028800 | Bacteria | 38730 |
| 208 | Ga0265324_10002184 | 3300029957 | Bacteria | 10245 |
| 209 | Ga0307509_10224940 | 3300031507 | Bacteria | 1685 |
| 210 | Ga0307508_10129029 | 3300031616 | Bacteria | 2132 |
| 211 | Ga0307510_10054119 | 3300033180 | Bacteria | 4210 |
| 212 | Ga0307510_10105648 | 3300033180 | Bacteria | 2583 |
| 213 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 214 | Ga0373927_0003781 | 3300035695 | Bacteria | 10741 |
| 215 | Ga0373947_0018352 | 3300035725 | Bacteria | 4026 |
| 216 | Ga0372808_015401 | 3300036459 | Bacteria | 1093 |
| 217 | Ga0373925_0060389 | 3300037068 | Bacteria | 2847 |
| 218 | Ga0395899_0049253 | 3300037312 | Bacteria | 3133 |
| 219 | Ga0395900_0003044 | 3300037418 | Bacteria | 18262 |
| 220 | Ga0395900_0194094 | 3300037418 | Bacteria | 2058 |
| 221 | Ga0395898_0003078 | 3300037466 | Bacteria | 18893 |
| 222 | Ga0395905_0104481 | 3300037471 | Bacteria | 2659 |
| 223 | Ga0395901_0022715 | 3300038443 | Bacteria | 6432 |
| 224 | Ga0395901_0230464 | 3300038443 | Bacteria | 1934 |
| 225 | Ga0436362_0220972 | 3300039453 | Bacteria | 5253 |
| 226 | Ga0436362_1191051 | 3300039453 | Bacteria | 1141 |
| 227 | Ga0451787_528066 | 3300041441 | Bacteria | 712 |
| 228 | Ga0451833_0561817 | 3300041491 | Bacteria | 1153 |
| 229 | Ga0451853_1322345 | 3300041512 | Bacteria | 915 |
| 230 | Ga0466961_0179969 | 3300044693 | Bacteria | 1313 |
| 231 | Ga0495617_165738 | 3300046452 | Bacteria | 699 |
| 232 | Ga0495592_0043578 | 3300046454 | Bacteria | 3357 |
| 233 | Ga0495603_0026413 | 3300046455 | Bacteria | 3508 |
| 234 | Ga0495603_0027767 | 3300046455 | Bacteria | 3414 |
| 235 | Ga0495629_0003885 | 3300046459 | Bacteria | 11256 |
| 236 | Ga0495629_0705419 | 3300046459 | Bacteria | 670 |
| 237 | Ga0495638_0019535 | 3300046460 | Bacteria | 4483 |
| 238 | Ga0495651_0026825 | 3300046462 | Bacteria | 4486 |
| 239 | Ga0495653_0612110 | 3300046463 | Bacteria | 668 |
| 240 | Ga0495606_0076424 | 3300046507 | Bacteria | 2093 |
| 241 | Ga0495606_0433611 | 3300046507 | Bacteria | 677 |
| 242 | Ga0495608_0308392 | 3300046511 | Bacteria | 979 |
| 243 | Ga0495610_0080963 | 3300046512 | Bacteria | 1492 |
| 244 | Ga0495618_0035880 | 3300046514 | Bacteria | 3112 |
| 245 | Ga0495620_0054254 | 3300046515 | Bacteria | 1694 |
| 246 | Ga0495628_0520104 | 3300046516 | Bacteria | 857 |
| 247 | Ga0495643_0053818 | 3300046522 | Bacteria | 2156 |
| 248 | Ga0495643_0143795 | 3300046522 | Bacteria | 1187 |
| 249 | Ga0495644_0066016 | 3300046523 | Bacteria | 1359 |
| 250 | Ga0495648_0001207 | 3300046524 | Bacteria | 25895 |
| 251 | Ga0495648_0055521 | 3300046524 | Bacteria | 2387 |
| 252 | Ga0495648_0154757 | 3300046524 | Bacteria | 1192 |
| 253 | Ga0495652_0557005 | 3300046529 | Bacteria | 788 |
| 254 | Ga0495640_0019349 | 3300046533 | Bacteria | 5027 |
| 255 | Ga0495587_0335757 | 3300046536 | Bacteria | 843 |
| 256 | Ga0495598_0104903 | 3300046537 | Bacteria | 940 |
| 257 | Ga0495597_0027670 | 3300046542 | Bacteria | 2599 |
| 258 | Ga0495645_0318804 | 3300046543 | Bacteria | 1010 |
| 259 | Ga0495622_0033954 | 3300046557 | Bacteria | 2380 |
| 260 | Ga0495622_0049422 | 3300046557 | Bacteria | 1952 |
| 261 | Ga0495667_0332104 | 3300046559 | Bacteria | 961 |
| 262 | Ga0495656_0008009 | 3300046615 | Bacteria | 3759 |
| 263 | Ga0495668_0183593 | 3300046616 | Bacteria | 1146 |
| 264 | Ga0495668_0353773 | 3300046616 | Bacteria | 806 |
| 265 | Ga0495625_0052558 | 3300046660 | Bacteria | 2917 |
| 266 | Ga0495625_0172256 | 3300046660 | Bacteria | 1445 |
| 267 | Ga0495625_0213420 | 3300046660 | Bacteria | 1268 |
| 268 | Ga0495635_0510112 | 3300046663 | Bacteria | 791 |
| 269 | Ga0495661_0038077 | 3300046665 | Bacteria | 2999 |
| 270 | Ga0495661_0199415 | 3300046665 | Bacteria | 1049 |
| 271 | Ga0495657_0290050 | 3300046675 | Bacteria | 977 |
| 272 | Ga0495599_0046793 | 3300046678 | Bacteria | 2712 |
| 273 | Ga0495646_0169857 | 3300046680 | Bacteria | 1202 |
| 274 | Ga0495658_0332785 | 3300046683 | Bacteria | 964 |
| 275 | Ga0495669_0005120 | 3300046684 | Bacteria | 5455 |
| 276 | Ga0495624_0261696 | 3300046690 | Bacteria | 1045 |
| 277 | Ga0495649_0028321 | 3300046694 | Bacteria | 3105 |
| 278 | Ga0495649_0348310 | 3300046694 | Bacteria | 749 |
| 279 | Ga0495589_0082769 | 3300046794 | Bacteria | 1560 |
| 280 | Ga0495600_0000832 | 3300046809 | Bacteria | 16425 |
| 281 | Ga0495600_0133892 | 3300046809 | Bacteria | 1610 |
| 282 | Ga0495660_0227519 | 3300046810 | Bacteria | 876 |
| 283 | Ga0495581_0119377 | 3300047315 | Bacteria | 1534 |
| 284 | Ga0495581_0440889 | 3300047315 | Bacteria | 759 |
| 285 | Ga0495581_0577771 | 3300047315 | Bacteria | 651 |
| 286 | Ga0495604_0010490 | 3300047317 | Bacteria | 7344 |
| 287 | Ga0495604_0367612 | 3300047317 | Bacteria | 952 |
| 288 | Ga0495676_0222941 | 3300047321 | Bacteria | 1298 |
| 289 | Ga0495680_0257390 | 3300047322 | Bacteria | 1235 |
| 290 | Ga0495687_005686 | 3300047443 | Bacteria | 7869 |
| 291 | Ga0495677_0115282 | 3300047445 | Bacteria | 1023 |
| 292 | Ga0495673_0052082 | 3300047469 | Bacteria | 1790 |
| 293 | Ga0495673_0116210 | 3300047469 | Bacteria | 1064 |
| 294 | Ga0495684_0084916 | 3300047471 | Bacteria | 2401 |
| 295 | Ga0495686_0238978 | 3300047472 | Bacteria | 1025 |
| 296 | Ga0495602_0399894 | 3300048088 | Bacteria | 980 |
| 297 | Ga0495626_0235979 | 3300048091 | Bacteria | 738 |
| 298 | Ga0496100_0137553 | 3300048903 | Bacteria | 1728 |
| 299 | Ga0496100_0799227 | 3300048903 | Bacteria | 739 |
| 300 | Ga0496101_0357721 | 3300048904 | Bacteria | 1148 |
| 301 | Ga0496101_0416376 | 3300048904 | Bacteria | 1059 |
| 302 | Ga0496102_0347329 | 3300048905 | Bacteria | 1397 |
| 303 | Ga0496102_0435124 | 3300048905 | Bacteria | 1231 |
| 304 | Ga0496102_0660593 | 3300048905 | Bacteria | 968 |
| 305 | Ga0496102_0861939 | 3300048905 | Bacteria | 828 |
| 306 | Ga0496102_0948710 | 3300048905 | Bacteria | 781 |
| 307 | Ga0496104_0262848 | 3300048907 | Bacteria | 1638 |
| 308 | Ga0496105_0107446 | 3300048908 | Bacteria | 2303 |
| 309 | Ga0496105_0413109 | 3300048908 | Bacteria | 1069 |
| 310 | Ga0496105_0427224 | 3300048908 | Bacteria | 1048 |
| 311 | Ga0496105_0439215 | 3300048908 | Bacteria | 1031 |
| 312 | Ga0496106_0158994 | 3300048909 | Bacteria | 1786 |
| 313 | Ga0496106_0464242 | 3300048909 | Bacteria | 1017 |
| 314 | Ga0496106_0656890 | 3300048909 | Bacteria | 837 |
| 315 | Ga0496107_0143232 | 3300048910 | Bacteria | 1767 |
| 316 | Ga0496107_0188578 | 3300048910 | Bacteria | 1532 |
| 317 | Ga0496107_0269821 | 3300048910 | Bacteria | 1266 |
| 318 | Ga0496107_0591479 | 3300048910 | Bacteria | 820 |
| 319 | Ga0496108_0141180 | 3300048911 | Bacteria | 2075 |
| 320 | Ga0496108_0750288 | 3300048911 | Bacteria | 844 |
| 321 | Ga0496109_0140646 | 3300048912 | Bacteria | 2257 |
| 322 | Ga0496110_0058619 | 3300048913 | Bacteria | 3391 |
| 323 | Ga0496110_0382203 | 3300048913 | Bacteria | 1283 |
| 324 | Ga0496111_0296413 | 3300048914 | Bacteria | 1199 |
| 325 | Ga0496112_0338172 | 3300048915 | Bacteria | 1449 |
| 326 | Ga0496112_0377807 | 3300048915 | Bacteria | 1358 |
| 327 | Ga0496112_0649103 | 3300048915 | Bacteria | 985 |
| 328 | Ga0496112_0722491 | 3300048915 | Bacteria | 923 |
| 329 | Ga0496113_0522441 | 3300048916 | Bacteria | 953 |
| 330 | Ga0496114_0356349 | 3300048917 | Bacteria | 1294 |
| 331 | Ga0496114_0475345 | 3300048917 | Bacteria | 1106 |
| 332 | Ga0496115_0029999 | 3300048918 | Bacteria | 4275 |
| 333 | Ga0496115_0100912 | 3300048918 | Bacteria | 2366 |
| 334 | Ga0496115_0333224 | 3300048918 | Bacteria | 1239 |
| 335 | Ga0496115_0356483 | 3300048918 | Bacteria | 1192 |
| 336 | Ga0496116_0177935 | 3300048919 | Bacteria | 1143 |
| 337 | Ga0496118_0184317 | 3300048921 | Bacteria | 1257 |
| 338 | Ga0496119_0016625 | 3300048922 | Bacteria | 5584 |
| 339 | Ga0496119_0035070 | 3300048922 | Bacteria | 3293 |
| 340 | Ga0496120_0012617 | 3300048923 | Bacteria | 5736 |
| 341 | Ga0496120_0139495 | 3300048923 | Bacteria | 1232 |
| 342 | Ga0496121_0024927 | 3300048924 | Bacteria | 5700 |
| 343 | Ga0496121_0066148 | 3300048924 | Bacteria | 2936 |
| 344 | Ga0496122_0277299 | 3300048925 | Bacteria | 919 |
| 345 | Ga0496124_0080375 | 3300048927 | Bacteria | 2683 |
| 346 | Ga0496126_0071815 | 3300048929 | Bacteria | 3080 |
| 347 | Ga0496126_0089962 | 3300048929 | Bacteria | 2701 |
| 348 | Ga0496126_0125076 | 3300048929 | Bacteria | 2226 |
| 349 | Ga0496126_0227015 | 3300048929 | Bacteria | 1566 |
| 350 | Ga0496126_0341203 | 3300048929 | Bacteria | 1227 |
| 351 | Ga0495682_0050416 | 3300049460 | Bacteria | 1515 |
| 352 | Ga0495682_0140629 | 3300049460 | Bacteria | 862 |
| 353 | Ga0501039_0537093 | 3300049575 | Bacteria | 918 |
| 354 | nmdc:mga03n38_58970_c1 | 3300050490 | Bacteria | 1741 |
| 355 | nmdc:mga00v17_210556_c1 | 3300050491 | Bacteria | 1258 |
| 356 | nmdc:mga00v17_314580_c1 | 3300050491 | Bacteria | 1017 |
| 357 | nmdc:mga0yw44_28850_c1 | 3300050492 | Bacteria | 3197 |
| 358 | nmdc:mga0yw44_52270_c1 | 3300050492 | Bacteria | 2476 |
| 359 | nmdc:mga04h51_15963_c1 | 3300050495 | Bacteria | 2173 |
| 360 | Ga0500578_0098299 | 3300053086 | Bacteria | 1854 |
| 361 | Ga0500578_0141006 | 3300053086 | Bacteria | 1507 |
| 362 | Ga0500643_000168 | 3300053087 | Bacteria | 64858 |
| 363 | Ga0500646_0043653 | 3300053090 | Bacteria | 1270 |
| 364 | Ga0500651_0061214 | 3300053093 | Bacteria | 2352 |
| 365 | Ga0500566_0212098 | 3300053094 | Bacteria | 969 |
| 366 | Ga0500566_0218926 | 3300053094 | Bacteria | 948 |
| 367 | Ga0500566_0366552 | 3300053094 | Bacteria | 655 |
| 368 | Ga0500555_003109 | 3300053103 | Bacteria | 4736 |
| 369 | Ga0500569_001709 | 3300053109 | Bacteria | 4194 |
| 370 | Ga0500572_000255 | 3300053111 | Bacteria | 19104 |
| 371 | Ga0500572_018357 | 3300053111 | Bacteria | 1811 |
| 372 | Ga0500594_0088751 | 3300053118 | Bacteria | 936 |
| 373 | Ga0500595_078177 | 3300053119 | Bacteria | 972 |
| 374 | Ga0500595_115635 | 3300053119 | Bacteria | 760 |
| 375 | Ga0500614_027260 | 3300053123 | Bacteria | 1371 |
| 376 | Ga0500652_032290 | 3300053131 | Bacteria | 2062 |
| 377 | Ga0500655_018677 | 3300053133 | Bacteria | 1288 |
| 378 | Ga0500559_0000299 | 3300053136 | Bacteria | 38041 |
| 379 | Ga0500559_0127865 | 3300053136 | Bacteria | 1186 |
| 380 | Ga0500559_0261064 | 3300053136 | Bacteria | 815 |
| 381 | Ga0500568_0054363 | 3300053139 | Bacteria | 1566 |
| 382 | Ga0500588_0077106 | 3300053146 | Bacteria | 1107 |
| 383 | Ga0500590_180501 | 3300053148 | Bacteria | 917 |
| 384 | Ga0500616_0070164 | 3300053153 | Bacteria | 1790 |
| 385 | Ga0500622_0077056 | 3300053156 | Bacteria | 1675 |
| 386 | Ga0500627_0228425 | 3300053158 | Bacteria | 829 |
| 387 | Ga0500638_029142 | 3300053162 | Bacteria | 2654 |
| 388 | Ga0500639_033573 | 3300053163 | Bacteria | 2712 |
| 389 | Ga0500636_0000659 | 3300053177 | Bacteria | 18582 |
| 390 | Ga0500611_160406 | 3300053727 | Bacteria | 622 |
| 391 | Ga0500645_136650 | 3300053730 | Bacteria | 679 |
| 392 | Ga0500609_001181 | 3300053731 | Bacteria | 3881 |
| 393 | Ga0500596_022801 | 3300053735 | Bacteria | 947 |
| 394 | Ga0500596_042465 | 3300053735 | Bacteria | 728 |
| 395 | Ga0500599_000860 | 3300053736 | Bacteria | 3362 |
| 396 | Ga0500601_000475 | 3300053737 | Bacteria | 6405 |
| 397 | Ga0500661_055519 | 3300055283 | Bacteria | 711 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041441 | Ga0451787_528066 | Ga0451787_528066_162_668 | 156 |
| 2 | 3300044693 | Ga0466961_0179969 | Ga0466961_0179969_519_1148 | 165 |
| 3 | 3300009177 | Ga0105248_10673186 | Ga0105248_106731861 | 167 |
| 4 | 3300048088 | Ga0495602_0399894 | Ga0495602_0399894_191_730 | 171 |
| 5 | 3300025261 | Ga0209233_1001163 | Ga0209233_100116311 | 173 |
| 6 | 3300031616 | Ga0307508_10129029 | Ga0307508_101290292 | 173 |
| 7 | iso_pu_bacteria | 2888419890 | 2888421227 | 174 |
| 8 | iso_pu_bacteria | 2507262055 | 2507505973 | 175 |
| 9 | iso_pu_bacteria | 2508501009 | 2508540162 | 175 |
| 10 | iso_pu_bacteria | 2513237095 | 2513649123 | 175 |
| 11 | iso_pu_bacteria | 2513237102 | 2513700188 | 175 |
| 12 | iso_pu_bacteria | 2513237104 | 2513716143 | 175 |
| 13 | iso_pu_bacteria | 2513237137 | 2513861162 | 175 |
| 14 | iso_pu_bacteria | 2513237139 | 2513877197 | 175 |
| 15 | iso_pu_bacteria | 2517572143 | 2517889671 | 175 |
| 16 | iso_pu_bacteria | 2524023205 | 2524440788 | 175 |
| 17 | iso_pu_bacteria | 2524023228 | 2524533160 | 175 |
| 18 | iso_pu_bacteria | 2528768022 | 2528850739 | 175 |
| 19 | iso_pu_bacteria | 2617270735 | 2617347856 | 175 |
| 20 | iso_pu_bacteria | 2791355196 | 2793061493 | 175 |
| 21 | iso_pu_bacteria | 2791355197 | 2793070348 | 175 |
| 22 | iso_pu_bacteria | 2802429603 | 2805916203 | 175 |
| 23 | iso_pu_bacteria | 2816332527 | 2818240514 | 175 |
| 24 | iso_pu_bacteria | 2824600985 | 2824603676 | 175 |
| 25 | iso_pu_bacteria | 2824609381 | 2824610738 | 175 |
| 26 | iso_pu_bacteria | 2824617872 | 2824625157 | 175 |
| 27 | iso_pu_bacteria | 2824626560 | 2824630967 | 175 |
| 28 | iso_pu_bacteria | 2824635225 | 2824642280 | 175 |
| 29 | iso_pu_bacteria | 2824644064 | 2824648304 | 175 |
| 30 | iso_pu_bacteria | 2824661429 | 2824666880 | 175 |
| 31 | iso_pu_bacteria | 2824696289 | 2824699940 | 175 |
| 32 | iso_pu_bacteria | 2824714736 | 2824719484 | 175 |
| 33 | iso_pu_bacteria | 2824723954 | 2824729092 | 175 |
| 34 | iso_pu_bacteria | 2824773399 | 2824776370 | 175 |
| 35 | iso_pu_bacteria | 2842038055 | 2842044439 | 175 |
| 36 | iso_pu_bacteria | 2842045827 | 2842051572 | 175 |
| 37 | iso_pu_bacteria | 2847930680 | 2847939387 | 175 |
| 38 | iso_pu_bacteria | 2847939898 | 2847941144 | 175 |
| 39 | iso_pu_bacteria | 2874612657 | 2874616508 | 175 |
| 40 | iso_pu_bacteria | 2874620515 | 2874622526 | 175 |
| 41 | iso_pu_bacteria | 2876761206 | 2876763686 | 175 |
| 42 | iso_pu_bacteria | 2879083081 | 2879087060 | 175 |
| 43 | iso_pu_bacteria | 2879099564 | 2879104390 | 175 |
| 44 | iso_pu_bacteria | 2879127579 | 2879133738 | 175 |
| 45 | iso_pu_bacteria | 2879142872 | 2879148240 | 175 |
| 46 | iso_pu_bacteria | 2881364244 | 2881369549 | 175 |
| 47 | iso_pu_bacteria | 2881665667 | 2881669734 | 175 |
| 48 | iso_pu_bacteria | 2885366525 | 2885367805 | 175 |
| 49 | iso_pu_bacteria | 2885409591 | 2885412954 | 175 |
| 50 | iso_pu_bacteria | 2888378607 | 2888387191 | 175 |
| 51 | iso_pu_bacteria | 2903748898 | 2903750059 | 175 |
| 52 | iso_pu_bacteria | 2904666416 | 2904671467 | 175 |
| 53 | iso_pu_bacteria | 2904690495 | 2904692029 | 175 |
| 54 | iso_pu_bacteria | 2904699407 | 2904707572 | 175 |
| 55 | iso_pu_bacteria | 2908756301 | 2908757308 | 175 |
| 56 | iso_pu_bacteria | 2929615660 | 2929622160 | 175 |
| 57 | iso_pu_bacteria | 2929624759 | 2929630193 | 175 |
| 58 | iso_pu_bacteria | 2932784394 | 2932787879 | 175 |
| 59 | iso_pu_bacteria | 2932801729 | 2932807574 | 175 |
| 60 | iso_pu_bacteria | 2932809354 | 2932817604 | 175 |
| 61 | iso_pu_bacteria | 2932818245 | 2932826236 | 175 |
| 62 | iso_pu_bacteria | 2932828146 | 2932835093 | 175 |
| 63 | iso_pu_bacteria | 2933577622 | 2933584225 | 175 |
| 64 | iso_pu_bacteria | 2935608549 | 2935614398 | 175 |
| 65 | iso_pu_bacteria | 2935616580 | 2935620470 | 175 |
| 66 | iso_pu_bacteria | 2935630451 | 2935632852 | 175 |
| 67 | iso_pu_bacteria | 2935638405 | 2935640793 | 175 |
| 68 | iso_pu_bacteria | 2935665750 | 2935670296 | 175 |
| 69 | iso_pu_bacteria | 2935675223 | 2935679726 | 175 |
| 70 | iso_pu_bacteria | 2935684952 | 2935687295 | 175 |
| 71 | iso_pu_bacteria | 2935694250 | 2935696734 | 175 |
| 72 | iso_pu_bacteria | 2935703347 | 2935709174 | 175 |
| 73 | iso_pu_bacteria | 2935713505 | 2935718754 | 175 |
| 74 | iso_pu_bacteria | 2935722832 | 2935728406 | 175 |
| 75 | iso_pu_bacteria | 2935732158 | 2935736997 | 175 |
| 76 | iso_pu_bacteria | 2935741537 | 2935746000 | 175 |
| 77 | iso_pu_bacteria | 2935750917 | 2935753261 | 175 |
| 78 | iso_pu_bacteria | 2935760218 | 2935766347 | 175 |
| 79 | iso_pu_bacteria | 2935769743 | 2935770263 | 175 |
| 80 | iso_pu_bacteria | 2935785616 | 2935786684 | 175 |
| 81 | iso_pu_bacteria | 2935793552 | 2935794738 | 175 |
| 82 | iso_pu_bacteria | 2935801545 | 2935809028 | 175 |
| 83 | iso_pu_bacteria | 2935810662 | 2935813792 | 175 |
| 84 | iso_pu_bacteria | 2935819856 | 2935826616 | 175 |
| 85 | iso_pu_bacteria | 2935827899 | 2935832300 | 175 |
| 86 | iso_pu_bacteria | 2935837841 | 2935844005 | 175 |
| 87 | iso_pu_bacteria | 2935847175 | 2935851090 | 175 |
| 88 | iso_pu_bacteria | 2935855204 | 2935862796 | 175 |
| 89 | iso_pu_bacteria | 2935864058 | 2935864539 | 175 |
| 90 | iso_pu_bacteria | 2935873716 | 2935875109 | 175 |
| 91 | iso_pu_bacteria | 2935908558 | 2935913140 | 175 |
| 92 | iso_pu_bacteria | 2935916978 | 2935922562 | 175 |
| 93 | iso_pu_bacteria | 2935926038 | 2935930935 | 175 |
| 94 | iso_pu_bacteria | 2935934488 | 2935939731 | 175 |
| 95 | iso_pu_bacteria | 2935942939 | 2935946680 | 175 |
| 96 | iso_pu_bacteria | 2935951376 | 2935956119 | 175 |
| 97 | iso_pu_bacteria | 2935959822 | 2935965024 | 175 |
| 98 | iso_pu_bacteria | 2935967501 | 2935972912 | 175 |
| 99 | iso_pu_bacteria | 2935992306 | 2935999273 | 175 |
| 100 | iso_pu_bacteria | 2936002035 | 2936005828 | 175 |
| 101 | iso_pu_bacteria | 2936037263 | 2936039348 | 175 |
| 102 | iso_pu_bacteria | 2940556831 | 2940559174 | 175 |
| 103 | iso_pu_bacteria | 2941507105 | 2941508483 | 175 |
| 104 | iso_pu_bacteria | 2941515067 | 2941516314 | 175 |
| 105 | iso_pu_bacteria | 2941523033 | 2941524670 | 175 |
| 106 | iso_pu_bacteria | 2941538514 | 2941541868 | 175 |
| 107 | iso_pu_bacteria | 3005474847 | 3005475852 | 175 |
| 108 | iso_pu_bacteria | 3005710791 | 3005711861 | 175 |
| 109 | iso_pu_bacteria | 3005718088 | 3005719118 | 175 |
| 110 | iso_pu_bacteria | 8016511872 | 8016517210 | 175 |
| 111 | iso_pu_bacteria | 8016522445 | 8016527033 | 175 |
| 112 | iso_pu_bacteria | 8016530956 | 8016532112 | 175 |
| 113 | iso_pu_bacteria | 8016548790 | 8016556765 | 175 |
| 114 | iso_pu_bacteria | 8016557553 | 8016565120 | 175 |
| 115 | iso_pu_bacteria | 8016566248 | 8016570407 | 175 |
| 116 | iso_pu_bacteria | 8016575299 | 8016582944 | 175 |
| 117 | iso_pu_bacteria | 8016595262 | 8016602767 | 175 |
| 118 | iso_pu_bacteria | 8017057580 | 8017059380 | 175 |
| 119 | iso_pu_bacteria | 8019530166 | 8019531933 | 175 |
| 120 | iso_pu_bacteria | 8019576017 | 8019576239 | 175 |
| 121 | iso_pu_bacteria | 8019597564 | 8019607447 | 175 |
| 122 | iso_pu_bacteria | 8019608314 | 8019611063 | 175 |
| 123 | iso_pu_bacteria | 8019648815 | 8019651353 | 175 |
| 124 | iso_pu_bacteria | 8019687851 | 8019693246 | 175 |
| 125 | iso_pu_bacteria | 8055742211 | 8055743590 | 175 |
| 126 | iso_pu_bacteria | 8056967851 | 8056974101 | 175 |
| 127 | 3300048908 | Ga0496105_0427224 | Ga0496105_0427224_146_676 | 176 |
| 128 | 3300026142 | Ga0207698_10504860 | Ga0207698_105048602 | 178 |
| 129 | iso_pu_bacteria | 2513237094 | 2513638283 | 178 |
| 130 | iso_pu_bacteria | 2922368715 | 2922377366 | 178 |
| 131 | 3300005262 | Ga0065165_1019150 | Ga0065165_10191502 | 179 |
| 132 | 3300005328 | Ga0070676_10429548 | Ga0070676_104295482 | 179 |
| 133 | 3300005336 | Ga0070680_100005141 | Ga0070680_10000514111 | 179 |
| 134 | 3300005337 | Ga0070682_100396195 | Ga0070682_1003961952 | 179 |
| 135 | 3300005337 | Ga0070682_100571803 | Ga0070682_1005718032 | 179 |
| 136 | 3300005339 | Ga0070660_100063206 | Ga0070660_1000632065 | 179 |
| 137 | 3300005339 | Ga0070660_100267952 | Ga0070660_1002679522 | 179 |
| 138 | 3300005340 | Ga0070689_100157744 | Ga0070689_1001577442 | 179 |
| 139 | 3300005341 | Ga0070691_10201868 | Ga0070691_102018682 | 179 |
| 140 | 3300005344 | Ga0070661_100151918 | Ga0070661_1001519182 | 179 |
| 141 | 3300005347 | Ga0070668_100155128 | Ga0070668_1001551283 | 179 |
| 142 | 3300005347 | Ga0070668_100235046 | Ga0070668_1002350462 | 179 |
| 143 | 3300005347 | Ga0070668_100875501 | Ga0070668_1008755011 | 179 |
| 144 | 3300005347 | Ga0070668_100901166 | Ga0070668_1009011661 | 179 |
| 145 | 3300005353 | Ga0070669_100198704 | Ga0070669_1001987042 | 179 |
| 146 | 3300005354 | Ga0070675_100163507 | Ga0070675_1001635072 | 179 |
| 147 | 3300005355 | Ga0070671_100412987 | Ga0070671_1004129871 | 179 |
| 148 | 3300005355 | Ga0070671_101377491 | Ga0070671_1013774911 | 179 |
| 149 | 3300005356 | Ga0070674_100024125 | Ga0070674_1000241254 | 179 |
| 150 | 3300005366 | Ga0070659_100413606 | Ga0070659_1004136062 | 179 |
| 151 | 3300005367 | Ga0070667_101112592 | Ga0070667_1011125922 | 179 |
| 152 | 3300005434 | Ga0070709_10409023 | Ga0070709_104090232 | 179 |
| 153 | 3300005455 | Ga0070663_100008516 | Ga0070663_1000085166 | 179 |
| 154 | 3300005455 | Ga0070663_100265140 | Ga0070663_1002651402 | 179 |
| 155 | 3300005455 | Ga0070663_100331118 | Ga0070663_1003311182 | 179 |
| 156 | 3300005456 | Ga0070678_100164951 | Ga0070678_1001649514 | 179 |
| 157 | 3300005456 | Ga0070678_100461277 | Ga0070678_1004612772 | 179 |
| 158 | 3300005458 | Ga0070681_10094620 | Ga0070681_100946201 | 179 |
| 159 | 3300005459 | Ga0068867_100363833 | Ga0068867_1003638332 | 179 |
| 160 | 3300005459 | Ga0068867_100777802 | Ga0068867_1007778021 | 179 |
| 161 | 3300005466 | Ga0070685_10466376 | Ga0070685_104663762 | 179 |
| 162 | 3300005467 | Ga0070706_100360397 | Ga0070706_1003603972 | 179 |
| 163 | 3300005471 | Ga0070698_100161423 | Ga0070698_1001614233 | 179 |
| 164 | 3300005530 | Ga0070679_100079934 | Ga0070679_1000799344 | 179 |
| 165 | 3300005535 | Ga0070684_100046744 | Ga0070684_1000467442 | 179 |
| 166 | 3300005536 | Ga0070697_100286524 | Ga0070697_1002865242 | 179 |
| 167 | 3300005539 | Ga0068853_100026423 | Ga0068853_1000264233 | 179 |
| 168 | 3300005539 | Ga0068853_100781492 | Ga0068853_1007814922 | 179 |
| 169 | 3300005539 | Ga0068853_100882278 | Ga0068853_1008822782 | 179 |
| 170 | 3300005539 | Ga0068853_101459987 | Ga0068853_1014599871 | 179 |
| 171 | 3300005543 | Ga0070672_100447236 | Ga0070672_1004472362 | 179 |
| 172 | 3300005543 | Ga0070672_100918328 | Ga0070672_1009183281 | 179 |
| 173 | 3300005544 | Ga0070686_100132633 | Ga0070686_1001326332 | 179 |
| 174 | 3300005548 | Ga0070665_100100858 | Ga0070665_1001008584 | 179 |
| 175 | 3300005548 | Ga0070665_100131661 | Ga0070665_1001316611 | 179 |
| 176 | 3300005548 | Ga0070665_100490922 | Ga0070665_1004909222 | 179 |
| 177 | 3300005548 | Ga0070665_100965293 | Ga0070665_1009652932 | 179 |
| 178 | 3300005548 | Ga0070665_101387741 | Ga0070665_1013877412 | 179 |
| 179 | 3300005563 | Ga0068855_100038094 | Ga0068855_1000380946 | 179 |
| 180 | 3300005563 | Ga0068855_100882741 | Ga0068855_1008827412 | 179 |
| 181 | 3300005563 | Ga0068855_101280080 | Ga0068855_1012800801 | 179 |
| 182 | 3300005564 | Ga0070664_100171957 | Ga0070664_1001719572 | 179 |
| 183 | 3300005577 | Ga0068857_100025776 | Ga0068857_1000257766 | 179 |
| 184 | 3300005578 | Ga0068854_100125831 | Ga0068854_1001258311 | 179 |
| 185 | 3300005614 | Ga0068856_100323070 | Ga0068856_1003230702 | 179 |
| 186 | 3300005614 | Ga0068856_100462538 | Ga0068856_1004625382 | 179 |
| 187 | 3300005614 | Ga0068856_100589509 | Ga0068856_1005895092 | 179 |
| 188 | 3300005615 | Ga0070702_100276630 | Ga0070702_1002766302 | 179 |
| 189 | 3300005616 | Ga0068852_100030155 | Ga0068852_1000301552 | 179 |
| 190 | 3300005616 | Ga0068852_100188677 | Ga0068852_1001886772 | 179 |
| 191 | 3300005616 | Ga0068852_100363639 | Ga0068852_1003636392 | 179 |
| 192 | 3300005719 | Ga0068861_101171061 | Ga0068861_1011710611 | 179 |
| 193 | 3300005834 | Ga0068851_10006471 | Ga0068851_100064716 | 179 |
| 194 | 3300005841 | Ga0068863_100241989 | Ga0068863_1002419892 | 179 |
| 195 | 3300005842 | Ga0068858_100468822 | Ga0068858_1004688222 | 179 |
| 196 | 3300005843 | Ga0068860_101995173 | Ga0068860_1019951731 | 179 |
| 197 | 3300005844 | Ga0068862_100237880 | Ga0068862_1002378802 | 179 |
| 198 | 3300005983 | Ga0081540_1062753 | Ga0081540_10627533 | 179 |
| 199 | 3300005983 | Ga0081540_1163381 | Ga0081540_11633811 | 179 |
| 200 | 3300006028 | Ga0070717_11206514 | Ga0070717_112065141 | 179 |
| 201 | 3300006038 | Ga0075365_10074124 | Ga0075365_100741244 | 179 |
| 202 | 3300006038 | Ga0075365_10103142 | Ga0075365_101031424 | 179 |
| 203 | 3300006048 | Ga0075363_100001410 | Ga0075363_1000014103 | 179 |
| 204 | 3300006051 | Ga0075364_10561494 | Ga0075364_105614941 | 179 |
| 205 | 3300006051 | Ga0075364_10564849 | Ga0075364_105648491 | 179 |
| 206 | 3300006175 | Ga0070712_100243151 | Ga0070712_1002431512 | 179 |
| 207 | 3300006178 | Ga0075367_10008466 | Ga0075367_100084665 | 179 |
| 208 | 3300006186 | Ga0075369_10132716 | Ga0075369_101327162 | 179 |
| 209 | 3300006237 | Ga0097621_100379278 | Ga0097621_1003792781 | 179 |
| 210 | 3300006353 | Ga0075370_10029115 | Ga0075370_100291155 | 179 |
| 211 | 3300006358 | Ga0068871_100260839 | Ga0068871_1002608394 | 179 |
| 212 | 3300006358 | Ga0068871_100301846 | Ga0068871_1003018463 | 179 |
| 213 | 3300006944 | Ga0099823_1023273 | Ga0099823_10232737 | 179 |
| 214 | 3300009093 | Ga0105240_10025071 | Ga0105240_100250715 | 179 |
| 215 | 3300009093 | Ga0105240_10073053 | Ga0105240_100730532 | 179 |
| 216 | 3300009093 | Ga0105240_10122488 | Ga0105240_101224882 | 179 |
| 217 | 3300009098 | Ga0105245_10150293 | Ga0105245_101502932 | 179 |
| 218 | 3300009098 | Ga0105245_10326876 | Ga0105245_103268764 | 179 |
| 219 | 3300009101 | Ga0105247_10118877 | Ga0105247_101188773 | 179 |
| 220 | 3300009101 | Ga0105247_10191361 | Ga0105247_101913613 | 179 |
| 221 | 3300009174 | Ga0105241_10403215 | Ga0105241_104032152 | 179 |
| 222 | 3300009174 | Ga0105241_11006847 | Ga0105241_110068472 | 179 |
| 223 | 3300009176 | Ga0105242_11088519 | Ga0105242_110885192 | 179 |
| 224 | 3300009177 | Ga0105248_11250062 | Ga0105248_112500622 | 179 |
| 225 | 3300009545 | Ga0105237_10014802 | Ga0105237_100148022 | 179 |
| 226 | 3300009545 | Ga0105237_10017110 | Ga0105237_100171106 | 179 |
| 227 | 3300009545 | Ga0105237_10105484 | Ga0105237_101054842 | 179 |
| 228 | 3300009551 | Ga0105238_10001521 | Ga0105238_100015214 | 179 |
| 229 | 3300009551 | Ga0105238_10437958 | Ga0105238_104379582 | 179 |
| 230 | 3300009551 | Ga0105238_11612842 | Ga0105238_116128421 | 179 |
| 231 | 3300010375 | Ga0105239_10059018 | Ga0105239_100590186 | 179 |
| 232 | 3300010375 | Ga0105239_10286303 | Ga0105239_102863032 | 179 |
| 233 | 3300010375 | Ga0105239_10494692 | Ga0105239_104946922 | 179 |
| 234 | 3300010375 | Ga0105239_10872232 | Ga0105239_108722322 | 179 |
| 235 | 3300011119 | Ga0105246_10512617 | Ga0105246_105126172 | 179 |
| 236 | 3300013104 | Ga0157370_10064495 | Ga0157370_100644955 | 179 |
| 237 | 3300013104 | Ga0157370_10225226 | Ga0157370_102252262 | 179 |
| 238 | 3300013105 | Ga0157369_10014713 | Ga0157369_100147137 | 179 |
| 239 | 3300013296 | Ga0157374_10410884 | Ga0157374_104108841 | 179 |
| 240 | 3300013306 | Ga0163162_10913450 | Ga0163162_109134501 | 179 |
| 241 | 3300013307 | Ga0157372_11975150 | Ga0157372_119751502 | 179 |
| 242 | 3300014325 | Ga0163163_10046845 | Ga0163163_100468452 | 179 |
| 243 | 3300014325 | Ga0163163_11376836 | Ga0163163_113768362 | 179 |
| 244 | 3300014326 | Ga0157380_10513363 | Ga0157380_105133633 | 179 |
| 245 | 3300014968 | Ga0157379_10697726 | Ga0157379_106977262 | 179 |
| 246 | 3300014969 | Ga0157376_10354198 | Ga0157376_103541982 | 179 |
| 247 | 3300014969 | Ga0157376_10786792 | Ga0157376_107867921 | 179 |
| 248 | 3300025254 | Ga0209148_1000944 | Ga0209148_100094418 | 179 |
| 249 | 3300025261 | Ga0209233_1027541 | Ga0209233_10275412 | 179 |
| 250 | 3300025272 | Ga0209455_1007845 | Ga0209455_10078454 | 179 |
| 251 | 3300025297 | Ga0209758_1001853 | Ga0209758_10018539 | 179 |
| 252 | 3300025297 | Ga0209758_1016012 | Ga0209758_10160126 | 179 |
| 253 | 3300025297 | Ga0209758_1062500 | Ga0209758_10625002 | 179 |
| 254 | 3300025299 | Ga0209256_1005602 | Ga0209256_10056024 | 179 |
| 255 | 3300025299 | Ga0209256_1051525 | Ga0209256_10515251 | 179 |
| 256 | 3300025302 | Ga0207426_1034412 | Ga0207426_10344123 | 179 |
| 257 | 3300025304 | Ga0209257_1091455 | Ga0209257_10914551 | 179 |
| 258 | 3300025901 | Ga0207688_10111489 | Ga0207688_101114892 | 179 |
| 259 | 3300025903 | Ga0207680_10553686 | Ga0207680_105536862 | 179 |
| 260 | 3300025904 | Ga0207647_10016170 | Ga0207647_100161702 | 179 |
| 261 | 3300025904 | Ga0207647_10469259 | Ga0207647_104692592 | 179 |
| 262 | 3300025906 | Ga0207699_10058549 | Ga0207699_100585493 | 179 |
| 263 | 3300025909 | Ga0207705_10876807 | Ga0207705_108768072 | 179 |
| 264 | 3300025910 | Ga0207684_10321875 | Ga0207684_103218752 | 179 |
| 265 | 3300025911 | Ga0207654_10394779 | Ga0207654_103947792 | 179 |
| 266 | 3300025912 | Ga0207707_10000706 | Ga0207707_1000070612 | 179 |
| 267 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006626 | 179 |
| 268 | 3300025913 | Ga0207695_10032870 | Ga0207695_100328705 | 179 |
| 269 | 3300025913 | Ga0207695_10145477 | Ga0207695_101454772 | 179 |
| 270 | 3300025914 | Ga0207671_10003296 | Ga0207671_100032969 | 179 |
| 271 | 3300025917 | Ga0207660_10002043 | Ga0207660_100020435 | 179 |
| 272 | 3300025919 | Ga0207657_10004672 | Ga0207657_1000467217 | 179 |
| 273 | 3300025921 | Ga0207652_10003935 | Ga0207652_1000393514 | 179 |
| 274 | 3300025923 | Ga0207681_10387383 | Ga0207681_103873832 | 179 |
| 275 | 3300025931 | Ga0207644_10900729 | Ga0207644_109007291 | 179 |
| 276 | 3300025932 | Ga0207690_10150765 | Ga0207690_101507652 | 179 |
| 277 | 3300025933 | Ga0207706_10249322 | Ga0207706_102493222 | 179 |
| 278 | 3300025934 | Ga0207686_10083041 | Ga0207686_100830412 | 179 |
| 279 | 3300025934 | Ga0207686_10255276 | Ga0207686_102552762 | 179 |
| 280 | 3300025935 | Ga0207709_10070549 | Ga0207709_100705492 | 179 |
| 281 | 3300025935 | Ga0207709_10866387 | Ga0207709_108663871 | 179 |
| 282 | 3300025936 | Ga0207670_10202098 | Ga0207670_102020982 | 179 |
| 283 | 3300025937 | Ga0207669_10031977 | Ga0207669_100319773 | 179 |
| 284 | 3300025939 | Ga0207665_10506590 | Ga0207665_105065902 | 179 |
| 285 | 3300025940 | Ga0207691_10187184 | Ga0207691_101871842 | 179 |
| 286 | 3300025941 | Ga0207711_10807392 | Ga0207711_108073922 | 179 |
| 287 | 3300025944 | Ga0207661_10191699 | Ga0207661_101916994 | 179 |
| 288 | 3300025945 | Ga0207679_10085456 | Ga0207679_100854562 | 179 |
| 289 | 3300025949 | Ga0207667_10007733 | Ga0207667_100077336 | 179 |
| 290 | 3300025949 | Ga0207667_10582302 | Ga0207667_105823022 | 179 |
| 291 | 3300025961 | Ga0207712_10074342 | Ga0207712_100743425 | 179 |
| 292 | 3300025972 | Ga0207668_10006973 | Ga0207668_100069734 | 179 |
| 293 | 3300025972 | Ga0207668_10361037 | Ga0207668_103610371 | 179 |
| 294 | 3300025972 | Ga0207668_11118364 | Ga0207668_111183641 | 179 |
| 295 | 3300025981 | Ga0207640_10351682 | Ga0207640_103516822 | 179 |
| 296 | 3300025981 | Ga0207640_10414409 | Ga0207640_104144091 | 179 |
| 297 | 3300026041 | Ga0207639_10124224 | Ga0207639_101242241 | 179 |
| 298 | 3300026041 | Ga0207639_10351959 | Ga0207639_103519592 | 179 |
| 299 | 3300026041 | Ga0207639_11437760 | Ga0207639_114377601 | 179 |
| 300 | 3300026067 | Ga0207678_10007033 | Ga0207678_1000703310 | 179 |
| 301 | 3300026067 | Ga0207678_10106371 | Ga0207678_101063715 | 179 |
| 302 | 3300026067 | Ga0207678_10746719 | Ga0207678_107467192 | 179 |
| 303 | 3300026067 | Ga0207678_10942413 | Ga0207678_109424131 | 179 |
| 304 | 3300026075 | Ga0207708_10101381 | Ga0207708_101013813 | 179 |
| 305 | 3300026078 | Ga0207702_10432309 | Ga0207702_104323092 | 179 |
| 306 | 3300026078 | Ga0207702_10523288 | Ga0207702_105232882 | 179 |
| 307 | 3300026078 | Ga0207702_10786825 | Ga0207702_107868252 | 179 |
| 308 | 3300026089 | Ga0207648_10090589 | Ga0207648_100905892 | 179 |
| 309 | 3300026089 | Ga0207648_10697656 | Ga0207648_106976562 | 179 |
| 310 | 3300026095 | Ga0207676_10261115 | Ga0207676_102611151 | 179 |
| 311 | 3300026116 | Ga0207674_10046693 | Ga0207674_100466937 | 179 |
| 312 | 3300026118 | Ga0207675_100810752 | Ga0207675_1008107522 | 179 |
| 313 | 3300026121 | Ga0207683_10304244 | Ga0207683_103042443 | 179 |
| 314 | 3300026142 | Ga0207698_10029276 | Ga0207698_100292765 | 179 |
| 315 | 3300026142 | Ga0207698_11517549 | Ga0207698_115175492 | 179 |
| 316 | 3300027296 | Ga0209389_1000039 | Ga0209389_100003975 | 179 |
| 317 | 3300027357 | Ga0209589_1000038 | Ga0209589_100003847 | 179 |
| 318 | 3300027361 | Ga0209489_100023 | Ga0209489_100023146 | 179 |
| 319 | 3300027361 | Ga0209489_100087 | Ga0209489_10008775 | 179 |
| 320 | 3300027363 | Ga0209700_100090 | Ga0209700_10009041 | 179 |
| 321 | 3300027512 | Ga0209179_1026896 | Ga0209179_10268962 | 179 |
| 322 | 3300027866 | Ga0209813_10024980 | Ga0209813_100249802 | 179 |
| 323 | 3300028379 | Ga0268266_10001364 | Ga0268266_100013646 | 179 |
| 324 | 3300028379 | Ga0268266_10033319 | Ga0268266_100333192 | 179 |
| 325 | 3300028379 | Ga0268266_10824591 | Ga0268266_108245911 | 179 |
| 326 | 3300028380 | Ga0268265_10128250 | Ga0268265_101282503 | 179 |
| 327 | 3300028556 | Ga0265337_1004679 | Ga0265337_10046798 | 179 |
| 328 | 3300028558 | Ga0265326_10001084 | Ga0265326_100010848 | 179 |
| 329 | 3300028563 | Ga0265319_1004856 | Ga0265319_10048568 | 179 |
| 330 | 3300028573 | Ga0265334_10034125 | Ga0265334_100341252 | 179 |
| 331 | 3300028653 | Ga0265323_10001297 | Ga0265323_1000129714 | 179 |
| 332 | 3300028654 | Ga0265322_10031991 | Ga0265322_100319912 | 179 |
| 333 | 3300028666 | Ga0265336_10000620 | Ga0265336_1000062010 | 179 |
| 334 | 3300028800 | Ga0265338_10001434 | Ga0265338_1000143414 | 179 |
| 335 | 3300029957 | Ga0265324_10002184 | Ga0265324_100021845 | 179 |
| 336 | 3300031507 | Ga0307509_10224940 | Ga0307509_102249403 | 179 |
| 337 | 3300033180 | Ga0307510_10054119 | Ga0307510_100541197 | 179 |
| 338 | 3300033180 | Ga0307510_10105648 | Ga0307510_101056482 | 179 |
| 339 | 3300033442 | Ga0315911_1000005 | Ga0315911_100000557 | 179 |
| 340 | 3300035695 | Ga0373927_0003781 | Ga0373927_0003781_6313_6852 | 179 |
| 341 | 3300035725 | Ga0373947_0018352 | Ga0373947_0018352_1219_1758 | 179 |
| 342 | 3300036459 | Ga0372808_015401 | Ga0372808_015401_74_613 | 179 |
| 343 | 3300037068 | Ga0373925_0060389 | Ga0373925_0060389_910_1449 | 179 |
| 344 | 3300037312 | Ga0395899_0049253 | Ga0395899_0049253_1736_2275 | 179 |
| 345 | 3300037418 | Ga0395900_0003044 | Ga0395900_0003044_291_830 | 179 |
| 346 | 3300037418 | Ga0395900_0194094 | Ga0395900_0194094_1111_1650 | 179 |
| 347 | 3300037466 | Ga0395898_0003078 | Ga0395898_0003078_6821_7360 | 179 |
| 348 | 3300037471 | Ga0395905_0104481 | Ga0395905_0104481_680_1219 | 179 |
| 349 | 3300038443 | Ga0395901_0022715 | Ga0395901_0022715_2089_2628 | 179 |
| 350 | 3300038443 | Ga0395901_0230464 | Ga0395901_0230464_1153_1692 | 179 |
| 351 | 3300039453 | Ga0436362_0220972 | Ga0436362_0220972_4676_5215 | 179 |
| 352 | 3300039453 | Ga0436362_1191051 | Ga0436362_1191051_413_955 | 179 |
| 353 | 3300041491 | Ga0451833_0561817 | Ga0451833_0561817_554_1093 | 179 |
| 354 | 3300041512 | Ga0451853_1322345 | Ga0451853_1322345_364_903 | 179 |
| 355 | 3300046452 | Ga0495617_165738 | Ga0495617_165738_85_642 | 179 |
| 356 | 3300046454 | Ga0495592_0043578 | Ga0495592_0043578_1418_1957 | 179 |
| 357 | 3300046455 | Ga0495603_0026413 | Ga0495603_0026413_200_739 | 179 |
| 358 | 3300046455 | Ga0495603_0027767 | Ga0495603_0027767_2716_3255 | 179 |
| 359 | 3300046459 | Ga0495629_0003885 | Ga0495629_0003885_6906_7445 | 179 |
| 360 | 3300046459 | Ga0495629_0705419 | Ga0495629_0705419_121_660 | 179 |
| 361 | 3300046460 | Ga0495638_0019535 | Ga0495638_0019535_1083_1622 | 179 |
| 362 | 3300046462 | Ga0495651_0026825 | Ga0495651_0026825_113_652 | 179 |
| 363 | 3300046463 | Ga0495653_0612110 | Ga0495653_0612110_113_652 | 179 |
| 364 | 3300046507 | Ga0495606_0076424 | Ga0495606_0076424_643_1182 | 179 |
| 365 | 3300046507 | Ga0495606_0433611 | Ga0495606_0433611_13_552 | 179 |
| 366 | 3300046511 | Ga0495608_0308392 | Ga0495608_0308392_145_684 | 179 |
| 367 | 3300046512 | Ga0495610_0080963 | Ga0495610_0080963_794_1333 | 179 |
| 368 | 3300046514 | Ga0495618_0035880 | Ga0495618_0035880_1660_2199 | 179 |
| 369 | 3300046515 | Ga0495620_0054254 | Ga0495620_0054254_74_613 | 179 |
| 370 | 3300046516 | Ga0495628_0520104 | Ga0495628_0520104_64_603 | 179 |
| 371 | 3300046522 | Ga0495643_0053818 | Ga0495643_0053818_87_626 | 179 |
| 372 | 3300046522 | Ga0495643_0143795 | Ga0495643_0143795_14_553 | 179 |
| 373 | 3300046523 | Ga0495644_0066016 | Ga0495644_0066016_386_943 | 179 |
| 374 | 3300046524 | Ga0495648_0001207 | Ga0495648_0001207_8423_8962 | 179 |
| 375 | 3300046524 | Ga0495648_0055521 | Ga0495648_0055521_167_706 | 179 |
| 376 | 3300046524 | Ga0495648_0154757 | Ga0495648_0154757_127_666 | 179 |
| 377 | 3300046529 | Ga0495652_0557005 | Ga0495652_0557005_216_755 | 179 |
| 378 | 3300046533 | Ga0495640_0019349 | Ga0495640_0019349_4349_4888 | 179 |
| 379 | 3300046536 | Ga0495587_0335757 | Ga0495587_0335757_64_603 | 179 |
| 380 | 3300046537 | Ga0495598_0104903 | Ga0495598_0104903_368_907 | 179 |
| 381 | 3300046542 | Ga0495597_0027670 | Ga0495597_0027670_1582_2121 | 179 |
| 382 | 3300046543 | Ga0495645_0318804 | Ga0495645_0318804_246_785 | 179 |
| 383 | 3300046557 | Ga0495622_0033954 | Ga0495622_0033954_1320_1859 | 179 |
| 384 | 3300046557 | Ga0495622_0049422 | Ga0495622_0049422_386_925 | 179 |
| 385 | 3300046559 | Ga0495667_0332104 | Ga0495667_0332104_272_811 | 179 |
| 386 | 3300046615 | Ga0495656_0008009 | Ga0495656_0008009_1405_1962 | 179 |
| 387 | 3300046616 | Ga0495668_0183593 | Ga0495668_0183593_143_682 | 179 |
| 388 | 3300046616 | Ga0495668_0353773 | Ga0495668_0353773_94_651 | 179 |
| 389 | 3300046660 | Ga0495625_0052558 | Ga0495625_0052558_29_568 | 179 |
| 390 | 3300046660 | Ga0495625_0172256 | Ga0495625_0172256_521_1078 | 179 |
| 391 | 3300046660 | Ga0495625_0213420 | Ga0495625_0213420_495_1034 | 179 |
| 392 | 3300046663 | Ga0495635_0510112 | Ga0495635_0510112_90_629 | 179 |
| 393 | 3300046665 | Ga0495661_0038077 | Ga0495661_0038077_1123_1662 | 179 |
| 394 | 3300046665 | Ga0495661_0199415 | Ga0495661_0199415_144_683 | 179 |
| 395 | 3300046675 | Ga0495657_0290050 | Ga0495657_0290050_404_943 | 179 |
| 396 | 3300046678 | Ga0495599_0046793 | Ga0495599_0046793_719_1258 | 179 |
| 397 | 3300046680 | Ga0495646_0169857 | Ga0495646_0169857_191_730 | 179 |
| 398 | 3300046683 | Ga0495658_0332785 | Ga0495658_0332785_394_933 | 179 |
| 399 | 3300046684 | Ga0495669_0005120 | Ga0495669_0005120_26_583 | 179 |
| 400 | 3300046690 | Ga0495624_0261696 | Ga0495624_0261696_64_603 | 179 |
| 401 | 3300046694 | Ga0495649_0028321 | Ga0495649_0028321_2292_2831 | 179 |
| 402 | 3300046694 | Ga0495649_0348310 | Ga0495649_0348310_121_660 | 179 |
| 403 | 3300046794 | Ga0495589_0082769 | Ga0495589_0082769_398_955 | 179 |
| 404 | 3300046809 | Ga0495600_0000832 | Ga0495600_0000832_5796_6335 | 179 |
| 405 | 3300046809 | Ga0495600_0133892 | Ga0495600_0133892_968_1507 | 179 |
| 406 | 3300046810 | Ga0495660_0227519 | Ga0495660_0227519_200_739 | 179 |
| 407 | 3300047315 | Ga0495581_0119377 | Ga0495581_0119377_281_820 | 179 |
| 408 | 3300047315 | Ga0495581_0440889 | Ga0495581_0440889_91_630 | 179 |
| 409 | 3300047315 | Ga0495581_0577771 | Ga0495581_0577771_21_560 | 179 |
| 410 | 3300047317 | Ga0495604_0010490 | Ga0495604_0010490_737_1276 | 179 |
| 411 | 3300047317 | Ga0495604_0367612 | Ga0495604_0367612_369_908 | 179 |
| 412 | 3300047321 | Ga0495676_0222941 | Ga0495676_0222941_684_1223 | 179 |
| 413 | 3300047322 | Ga0495680_0257390 | Ga0495680_0257390_374_913 | 179 |
| 414 | 3300047443 | Ga0495687_005686 | Ga0495687_005686_4782_5321 | 179 |
| 415 | 3300047445 | Ga0495677_0115282 | Ga0495677_0115282_368_925 | 179 |
| 416 | 3300047469 | Ga0495673_0052082 | Ga0495673_0052082_1237_1776 | 179 |
| 417 | 3300047469 | Ga0495673_0116210 | Ga0495673_0116210_90_629 | 179 |
| 418 | 3300047471 | Ga0495684_0084916 | Ga0495684_0084916_224_763 | 179 |
| 419 | 3300047472 | Ga0495686_0238978 | Ga0495686_0238978_299_838 | 179 |
| 420 | 3300048091 | Ga0495626_0235979 | Ga0495626_0235979_161_700 | 179 |
| 421 | 3300048903 | Ga0496100_0137553 | Ga0496100_0137553_30_572 | 179 |
| 422 | 3300048903 | Ga0496100_0799227 | Ga0496100_0799227_117_656 | 179 |
| 423 | 3300048904 | Ga0496101_0357721 | Ga0496101_0357721_247_789 | 179 |
| 424 | 3300048904 | Ga0496101_0416376 | Ga0496101_0416376_111_650 | 179 |
| 425 | 3300048905 | Ga0496102_0347329 | Ga0496102_0347329_275_829 | 179 |
| 426 | 3300048905 | Ga0496102_0435124 | Ga0496102_0435124_157_696 | 179 |
| 427 | 3300048905 | Ga0496102_0660593 | Ga0496102_0660593_251_790 | 179 |
| 428 | 3300048905 | Ga0496102_0861939 | Ga0496102_0861939_46_588 | 179 |
| 429 | 3300048905 | Ga0496102_0948710 | Ga0496102_0948710_30_587 | 179 |
| 430 | 3300048907 | Ga0496104_0262848 | Ga0496104_0262848_121_660 | 179 |
| 431 | 3300048908 | Ga0496105_0107446 | Ga0496105_0107446_876_1415 | 179 |
| 432 | 3300048908 | Ga0496105_0413109 | Ga0496105_0413109_264_806 | 179 |
| 433 | 3300048908 | Ga0496105_0439215 | Ga0496105_0439215_192_749 | 179 |
| 434 | 3300048909 | Ga0496106_0158994 | Ga0496106_0158994_729_1286 | 179 |
| 435 | 3300048909 | Ga0496106_0464242 | Ga0496106_0464242_105_662 | 179 |
| 436 | 3300048909 | Ga0496106_0656890 | Ga0496106_0656890_118_657 | 179 |
| 437 | 3300048910 | Ga0496107_0143232 | Ga0496107_0143232_577_1134 | 179 |
| 438 | 3300048910 | Ga0496107_0188578 | Ga0496107_0188578_574_1113 | 179 |
| 439 | 3300048910 | Ga0496107_0269821 | Ga0496107_0269821_373_930 | 179 |
| 440 | 3300048910 | Ga0496107_0591479 | Ga0496107_0591479_118_657 | 179 |
| 441 | 3300048911 | Ga0496108_0141180 | Ga0496108_0141180_1019_1558 | 179 |
| 442 | 3300048911 | Ga0496108_0750288 | Ga0496108_0750288_174_713 | 179 |
| 443 | 3300048912 | Ga0496109_0140646 | Ga0496109_0140646_1070_1609 | 179 |
| 444 | 3300048913 | Ga0496110_0058619 | Ga0496110_0058619_538_1077 | 179 |
| 445 | 3300048913 | Ga0496110_0382203 | Ga0496110_0382203_494_1036 | 179 |
| 446 | 3300048914 | Ga0496111_0296413 | Ga0496111_0296413_431_970 | 179 |
| 447 | 3300048915 | Ga0496112_0338172 | Ga0496112_0338172_324_881 | 179 |
| 448 | 3300048915 | Ga0496112_0377807 | Ga0496112_0377807_151_690 | 179 |
| 449 | 3300048915 | Ga0496112_0649103 | Ga0496112_0649103_293_832 | 179 |
| 450 | 3300048915 | Ga0496112_0722491 | Ga0496112_0722491_243_782 | 179 |
| 451 | 3300048916 | Ga0496113_0522441 | Ga0496113_0522441_287_826 | 179 |
| 452 | 3300048917 | Ga0496114_0356349 | Ga0496114_0356349_97_636 | 179 |
| 453 | 3300048917 | Ga0496114_0475345 | Ga0496114_0475345_401_940 | 179 |
| 454 | 3300048918 | Ga0496115_0029999 | Ga0496115_0029999_1147_1686 | 179 |
| 455 | 3300048918 | Ga0496115_0100912 | Ga0496115_0100912_638_1195 | 179 |
| 456 | 3300048918 | Ga0496115_0333224 | Ga0496115_0333224_516_1055 | 179 |
| 457 | 3300048918 | Ga0496115_0356483 | Ga0496115_0356483_426_983 | 179 |
| 458 | 3300048919 | Ga0496116_0177935 | Ga0496116_0177935_474_1013 | 179 |
| 459 | 3300048921 | Ga0496118_0184317 | Ga0496118_0184317_622_1161 | 179 |
| 460 | 3300048922 | Ga0496119_0016625 | Ga0496119_0016625_4236_4775 | 179 |
| 461 | 3300048922 | Ga0496119_0035070 | Ga0496119_0035070_133_672 | 179 |
| 462 | 3300048923 | Ga0496120_0012617 | Ga0496120_0012617_541_1080 | 179 |
| 463 | 3300048923 | Ga0496120_0139495 | Ga0496120_0139495_433_972 | 179 |
| 464 | 3300048924 | Ga0496121_0024927 | Ga0496121_0024927_4322_4861 | 179 |
| 465 | 3300048924 | Ga0496121_0066148 | Ga0496121_0066148_1770_2309 | 179 |
| 466 | 3300048925 | Ga0496122_0277299 | Ga0496122_0277299_293_832 | 179 |
| 467 | 3300048927 | Ga0496124_0080375 | Ga0496124_0080375_1360_1899 | 179 |
| 468 | 3300048929 | Ga0496126_0071815 | Ga0496126_0071815_2405_2944 | 179 |
| 469 | 3300048929 | Ga0496126_0089962 | Ga0496126_0089962_1098_1637 | 179 |
| 470 | 3300048929 | Ga0496126_0125076 | Ga0496126_0125076_523_1062 | 179 |
| 471 | 3300048929 | Ga0496126_0227015 | Ga0496126_0227015_219_758 | 179 |
| 472 | 3300048929 | Ga0496126_0341203 | Ga0496126_0341203_314_868 | 179 |
| 473 | 3300049460 | Ga0495682_0050416 | Ga0495682_0050416_129_668 | 179 |
| 474 | 3300049460 | Ga0495682_0140629 | Ga0495682_0140629_221_760 | 179 |
| 475 | 3300049575 | Ga0501039_0537093 | Ga0501039_0537093_345_884 | 179 |
| 476 | 3300050490 | nmdc:mga03n38_58970_c1 | nmdc:mga03n38_58970_c1_1086_1643 | 179 |
| 477 | 3300050491 | nmdc:mga00v17_210556_c1 | nmdc:mga00v17_210556_c1_39_596 | 179 |
| 478 | 3300050491 | nmdc:mga00v17_314580_c1 | nmdc:mga00v17_314580_c1_136_675 | 179 |
| 479 | 3300050492 | nmdc:mga0yw44_28850_c1 | nmdc:mga0yw44_28850_c1_1652_2191 | 179 |
| 480 | 3300050492 | nmdc:mga0yw44_52270_c1 | nmdc:mga0yw44_52270_c1_654_1211 | 179 |
| 481 | 3300050495 | nmdc:mga04h51_15963_c1 | nmdc:mga04h51_15963_c1_1531_2070 | 179 |
| 482 | 3300053086 | Ga0500578_0098299 | Ga0500578_0098299_804_1343 | 179 |
| 483 | 3300053086 | Ga0500578_0141006 | Ga0500578_0141006_741_1280 | 179 |
| 484 | 3300053087 | Ga0500643_000168 | Ga0500643_000168_23876_24415 | 179 |
| 485 | 3300053090 | Ga0500646_0043653 | Ga0500646_0043653_160_699 | 179 |
| 486 | 3300053093 | Ga0500651_0061214 | Ga0500651_0061214_1607_2146 | 179 |
| 487 | 3300053094 | Ga0500566_0212098 | Ga0500566_0212098_329_868 | 179 |
| 488 | 3300053094 | Ga0500566_0218926 | Ga0500566_0218926_61_600 | 179 |
| 489 | 3300053094 | Ga0500566_0366552 | Ga0500566_0366552_15_554 | 179 |
| 490 | 3300053103 | Ga0500555_003109 | Ga0500555_003109_376_915 | 179 |
| 491 | 3300053109 | Ga0500569_001709 | Ga0500569_001709_2134_2673 | 179 |
| 492 | 3300053111 | Ga0500572_000255 | Ga0500572_000255_3197_3736 | 179 |
| 493 | 3300053111 | Ga0500572_018357 | Ga0500572_018357_560_1099 | 179 |
| 494 | 3300053118 | Ga0500594_0088751 | Ga0500594_0088751_167_706 | 179 |
| 495 | 3300053119 | Ga0500595_078177 | Ga0500595_078177_203_742 | 179 |
| 496 | 3300053119 | Ga0500595_115635 | Ga0500595_115635_82_621 | 179 |
| 497 | 3300053123 | Ga0500614_027260 | Ga0500614_027260_723_1262 | 179 |
| 498 | 3300053131 | Ga0500652_032290 | Ga0500652_032290_1229_1768 | 179 |
| 499 | 3300053133 | Ga0500655_018677 | Ga0500655_018677_287_826 | 179 |
| 500 | 3300053136 | Ga0500559_0000299 | Ga0500559_0000299_15841_16380 | 179 |
| 501 | 3300053136 | Ga0500559_0127865 | Ga0500559_0127865_109_648 | 179 |
| 502 | 3300053136 | Ga0500559_0261064 | Ga0500559_0261064_108_647 | 179 |
| 503 | 3300053139 | Ga0500568_0054363 | Ga0500568_0054363_287_826 | 179 |
| 504 | 3300053146 | Ga0500588_0077106 | Ga0500588_0077106_219_758 | 179 |
| 505 | 3300053148 | Ga0500590_180501 | Ga0500590_180501_93_635 | 179 |
| 506 | 3300053153 | Ga0500616_0070164 | Ga0500616_0070164_856_1395 | 179 |
| 507 | 3300053156 | Ga0500622_0077056 | Ga0500622_0077056_640_1179 | 179 |
| 508 | 3300053158 | Ga0500627_0228425 | Ga0500627_0228425_167_706 | 179 |
| 509 | 3300053162 | Ga0500638_029142 | Ga0500638_029142_692_1231 | 179 |
| 510 | 3300053163 | Ga0500639_033573 | Ga0500639_033573_18_557 | 179 |
| 511 | 3300053177 | Ga0500636_0000659 | Ga0500636_0000659_7937_8476 | 179 |
| 512 | 3300053727 | Ga0500611_160406 | Ga0500611_160406_43_582 | 179 |
| 513 | 3300053730 | Ga0500645_136650 | Ga0500645_136650_70_609 | 179 |
| 514 | 3300053731 | Ga0500609_001181 | Ga0500609_001181_2449_2988 | 179 |
| 515 | 3300053735 | Ga0500596_022801 | Ga0500596_022801_354_893 | 179 |
| 516 | 3300053735 | Ga0500596_042465 | Ga0500596_042465_57_596 | 179 |
| 517 | 3300053736 | Ga0500599_000860 | Ga0500599_000860_460_999 | 179 |
| 518 | 3300053737 | Ga0500601_000475 | Ga0500601_000475_4917_5456 | 179 |
| 519 | 3300055283 | Ga0500661_055519 | Ga0500661_055519_131_670 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vxa-assembly1.cif.gz_A | structure of the human mesh1-nadph complex | 0.9256 | 2 | 175 |
| 3nr1-assembly1.cif.gz_B | a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses | 0.9218 | 2 | 176 |
| 3nr1-assembly1.cif.gz_B | a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses | 0.9021 | 2 | 176 |
| 5vxa-assembly1.cif.gz_A | structure of the human mesh1-nadph complex | 0.9009 | 2 | 175 |
| 3nqw-assembly1.cif.gz_B | a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses | 0.8794 | 1 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O18307_57_228_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9224 | 5 | 175 | 1.10.3210.10 |
| af_Q54KN3_7_177_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9164 | 7 | 172 | 1.10.3210.10 |
| af_O18307_57_228_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9072 | 5 | 175 | 1.10.3210.10 |
| af_Q54KN3_7_177_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8803 | 7 | 172 | 1.10.3210.10 |
| af_P0AG24_2_190_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7309 | 4 | 175 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G7X7K8-F1-model_v4 | Very-short-patch-repair endonuclease | 0.9967 | 1 | 179 |
GO:0004519
GO:0008893 |
| AF-A0A1G7X7K8-F1-model_v4 | Very-short-patch-repair endonuclease | 0.9912 | 1 | 179 |
GO:0004519
GO:0008893 |
| AF-A0A7C5ZWP4-F1-model_v4 | Bifunctional (P)ppGpp synthetase/guanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolase | 0.9611 | 2 | 177 |
GO:0008893
|
| AF-A0A0N4T6P7-F1-model_v4 | HD domain-containing protein | 0.9553 | 4 | 128 |
GO:0008893
|
| AF-A0A2N5NWT6-F1-model_v4 | deleted | 0.9551 | 8 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar