F458440

General Info

Members Datasets Scaffolds Average Seq Length
519 385 397 179

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0179969|Ga0466961_0179969_519_1148
Length 209
Sequence MLSAVRIISEAAELAARRHNGMARKGRGNEPYINHLAEVANRLAKATDGADAELVAAGWLHDVIEDTDTTRDELARTFSERVAALVVECTDDMTLPKAERRRLQVVDAPKKSASAKLIKIADKISNIGARINPDPASRSAMIWSIIQDGPSRLSPPVVAATLRWTGSSTIPSSLPGAPYDGRAADIDLYWRSCRCCIGCAWLQRTCSRR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
21 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
22 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
23 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
24 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
25 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
26 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
27 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
28 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
29 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
30 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
31 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
32 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
33 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
34 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
35 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
36 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
37 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
38 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
39 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
40 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
41 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
42 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
43 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
44 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
45 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
46 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
47 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
48 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
49 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
50 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
51 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
52 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
53 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
54 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
55 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
56 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
57 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
58 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
59 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
60 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
61 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
62 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
63 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
64 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
65 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
66 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
67 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
68 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
69 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
70 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
71 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
72 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
73 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
74 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
75 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
76 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
77 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
78 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
79 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
80 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
81 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
82 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
83 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
84 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
85 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
86 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
87 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
88 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
89 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
90 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
91 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
92 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
93 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
94 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
95 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
96 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
97 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
98 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
99 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
100 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
101 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
102 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
103 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
104 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
105 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
106 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
107 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
108 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
109 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
110 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
111 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
120 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
121 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
122 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
123 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
124 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
125 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
126 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
129 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
130 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
131 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
132 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
135 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
136 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
137 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
138 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
139 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
142 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
143 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
147 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
151 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
152 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
153 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
154 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
155 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
157 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
158 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
175 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
178 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
226 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
228 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
234 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
235 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
238 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
239 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
257 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
346 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
349 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
350 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
355 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
365 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
366 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
367 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
368 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
369 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
370 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
371 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
372 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
373 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
374 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
375 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
376 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
377 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
378 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
379 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
380 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
381 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
382 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
383 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
384 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
385 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.6
Metatranscriptomes 0.19
Isolates 23.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.52
Nodule 20.04
Rhizoplane 7.51
Rhizosphere 50.87
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1019150 3300005262 Bacteria 2454
2 Ga0070676_10429548 3300005328 Bacteria 925
3 Ga0070680_100005141 3300005336 Bacteria 9886
4 Ga0070682_100396195 3300005337 Bacteria 1043
5 Ga0070682_100571803 3300005337 Bacteria 888
6 Ga0070660_100063206 3300005339 Bacteria 2877
7 Ga0070660_100267952 3300005339 Bacteria 1395
8 Ga0070689_100157744 3300005340 Bacteria 1833
9 Ga0070691_10201868 3300005341 Bacteria 1045
10 Ga0070661_100151918 3300005344 Bacteria 1751
11 Ga0070668_100155128 3300005347 Bacteria 1854
12 Ga0070668_100235046 3300005347 Bacteria 1516
13 Ga0070668_100875501 3300005347 Bacteria 802
14 Ga0070668_100901166 3300005347 Bacteria 790
15 Ga0070669_100198704 3300005353 Bacteria 1577
16 Ga0070675_100163507 3300005354 Bacteria 1916
17 Ga0070671_100412987 3300005355 Bacteria 1155
18 Ga0070671_101377491 3300005355 Bacteria 623
19 Ga0070674_100024125 3300005356 Bacteria 3945
20 Ga0070659_100413606 3300005366 Bacteria 1140
21 Ga0070667_101112592 3300005367 Bacteria 738
22 Ga0070709_10409023 3300005434 Bacteria 1015
23 Ga0070663_100008516 3300005455 Bacteria 6314
24 Ga0070663_100265140 3300005455 Bacteria 1364
25 Ga0070663_100331118 3300005455 Bacteria 1227
26 Ga0070678_100164951 3300005456 Bacteria 1799
27 Ga0070678_100461277 3300005456 Bacteria 1115
28 Ga0070681_10094620 3300005458 Bacteria 2936
29 Ga0068867_100363833 3300005459 Bacteria 1210
30 Ga0068867_100777802 3300005459 Bacteria 852
31 Ga0070685_10466376 3300005466 Bacteria 888
32 Ga0070706_100360397 3300005467 Bacteria 1355
33 Ga0070698_100161423 3300005471 Bacteria 2185
34 Ga0070679_100079934 3300005530 Bacteria 3259
35 Ga0070684_100046744 3300005535 Bacteria 3750
36 Ga0070697_100286524 3300005536 Bacteria 1414
37 Ga0068853_100026423 3300005539 Bacteria 4874
38 Ga0068853_100781492 3300005539 Bacteria 914
39 Ga0068853_100882278 3300005539 Bacteria 859
40 Ga0068853_101459987 3300005539 Bacteria 662
41 Ga0070672_100447236 3300005543 Bacteria 1113
42 Ga0070672_100918328 3300005543 Bacteria 774
43 Ga0070686_100132633 3300005544 Bacteria 1725
44 Ga0070665_100100858 3300005548 Bacteria 2891
45 Ga0070665_100131661 3300005548 Bacteria 2503
46 Ga0070665_100490922 3300005548 Bacteria 1239
47 Ga0070665_100965293 3300005548 Bacteria 865
48 Ga0070665_101387741 3300005548 Bacteria 712
49 Ga0068855_100038094 3300005563 Bacteria 5714
50 Ga0068855_100882741 3300005563 Bacteria 946
51 Ga0068855_101280080 3300005563 Bacteria 760
52 Ga0070664_100171957 3300005564 Bacteria 1922
53 Ga0068857_100025776 3300005577 Bacteria 5177
54 Ga0068854_100125831 3300005578 Bacteria 1952
55 Ga0068856_100323070 3300005614 Bacteria 1561
56 Ga0068856_100462538 3300005614 Bacteria 1289
57 Ga0068856_100589509 3300005614 Bacteria 1133
58 Ga0070702_100276630 3300005615 Bacteria 1151
59 Ga0068852_100030155 3300005616 Bacteria 4462
60 Ga0068852_100188677 3300005616 Bacteria 1943
61 Ga0068852_100363639 3300005616 Bacteria 1416
62 Ga0068861_101171061 3300005719 Bacteria 742
63 Ga0068851_10006471 3300005834 Bacteria 5349
64 Ga0068863_100241989 3300005841 Bacteria 1742
65 Ga0068858_100468822 3300005842 Bacteria 1215
66 Ga0068860_101995173 3300005843 Bacteria 602
67 Ga0068862_100237880 3300005844 Bacteria 1654
68 Ga0081540_1062753 3300005983 Bacteria 1763
69 Ga0081540_1163381 3300005983 Bacteria 860
70 Ga0070717_11206514 3300006028 Bacteria 688
71 Ga0075365_10074124 3300006038 Bacteria 2295
72 Ga0075365_10103142 3300006038 Bacteria 1955
73 Ga0075363_100001410 3300006048 Bacteria 9093
74 Ga0075364_10561494 3300006051 Bacteria 780
75 Ga0075364_10564849 3300006051 Bacteria 778
76 Ga0070712_100243151 3300006175 Bacteria 1434
77 Ga0075367_10008466 3300006178 Bacteria 5330
78 Ga0075369_10132716 3300006186 Bacteria 1132
79 Ga0097621_100379278 3300006237 Bacteria 1263
80 Ga0075370_10029115 3300006353 Bacteria 3073
81 Ga0068871_100260839 3300006358 Bacteria 1511
82 Ga0068871_100301846 3300006358 Bacteria 1406
83 Ga0099823_1023273 3300006944 Bacteria 5681
84 Ga0105240_10025071 3300009093 Bacteria 7850
85 Ga0105240_10073053 3300009093 Bacteria 4237
86 Ga0105240_10122488 3300009093 Bacteria 3129
87 Ga0105245_10150293 3300009098 Bacteria 2201
88 Ga0105245_10326876 3300009098 Bacteria 1512
89 Ga0105247_10118877 3300009101 Bacteria 1710
90 Ga0105247_10191361 3300009101 Bacteria 1370
91 Ga0105241_10403215 3300009174 Bacteria 1200
92 Ga0105241_11006847 3300009174 Bacteria 780
93 Ga0105242_11088519 3300009176 Bacteria 812
94 Ga0105248_10673186 3300009177 Bacteria 1167
95 Ga0105248_11250062 3300009177 Bacteria 840
96 Ga0105237_10014802 3300009545 Bacteria 8141
97 Ga0105237_10017110 3300009545 Bacteria 7521
98 Ga0105237_10105484 3300009545 Bacteria 2809
99 Ga0105238_10001521 3300009551 Bacteria 23227
100 Ga0105238_10437958 3300009551 Bacteria 1303
101 Ga0105238_11612842 3300009551 Bacteria 679
102 Ga0105239_10059018 3300010375 Bacteria 4211
103 Ga0105239_10286303 3300010375 Bacteria 1855
104 Ga0105239_10494692 3300010375 Bacteria 1390
105 Ga0105239_10872232 3300010375 Bacteria 1032
106 Ga0105246_10512617 3300011119 Bacteria 1021
107 Ga0157370_10064495 3300013104 Bacteria 3468
108 Ga0157370_10225226 3300013104 Bacteria 1736
109 Ga0157369_10014713 3300013105 Bacteria 8827
110 Ga0157374_10410884 3300013296 Bacteria 1351
111 Ga0163162_10913450 3300013306 Bacteria 991
112 Ga0157372_11975150 3300013307 Bacteria 670
113 Ga0163163_10046845 3300014325 Bacteria 4247
114 Ga0163163_11376836 3300014325 Bacteria 767
115 Ga0157380_10513363 3300014326 Bacteria 1167
116 Ga0157379_10697726 3300014968 Bacteria 952
117 Ga0157376_10354198 3300014969 Bacteria 1406
118 Ga0157376_10786792 3300014969 Bacteria 963
119 Ga0209148_1000944 3300025254 Bacteria 19064
120 Ga0209233_1001163 3300025261 Bacteria 10659
121 Ga0209233_1027541 3300025261 Bacteria 1375
122 Ga0209455_1007845 3300025272 Bacteria 2965
123 Ga0209758_1001853 3300025297 Bacteria 23209
124 Ga0209758_1016012 3300025297 Bacteria 3834
125 Ga0209758_1062500 3300025297 Bacteria 1218
126 Ga0209256_1005602 3300025299 Bacteria 7133
127 Ga0209256_1051525 3300025299 Bacteria 992
128 Ga0207426_1034412 3300025302 Bacteria 1625
129 Ga0209257_1091455 3300025304 Bacteria 759
130 Ga0207688_10111489 3300025901 Bacteria 1588
131 Ga0207680_10553686 3300025903 Bacteria 821
132 Ga0207647_10016170 3300025904 Bacteria 5094
133 Ga0207647_10469259 3300025904 Bacteria 704
134 Ga0207699_10058549 3300025906 Bacteria 2305
135 Ga0207705_10876807 3300025909 Bacteria 696
136 Ga0207684_10321875 3300025910 Bacteria 1333
137 Ga0207654_10394779 3300025911 Bacteria 961
138 Ga0207707_10000706 3300025912 Bacteria 33199
139 Ga0207695_10000006 3300025913 Bacteria 1135309
140 Ga0207695_10032870 3300025913 Bacteria 5671
141 Ga0207695_10145477 3300025913 Bacteria 2315
142 Ga0207671_10003296 3300025914 Bacteria 16242
143 Ga0207660_10002043 3300025917 Bacteria 13422
144 Ga0207657_10004672 3300025919 Bacteria 14460
145 Ga0207652_10003935 3300025921 Bacteria 12151
146 Ga0207681_10387383 3300025923 Bacteria 1126
147 Ga0207644_10900729 3300025931 Bacteria 741
148 Ga0207690_10150765 3300025932 Bacteria 1723
149 Ga0207706_10249322 3300025933 Bacteria 1551
150 Ga0207686_10083041 3300025934 Bacteria 2096
151 Ga0207686_10255276 3300025934 Bacteria 1283
152 Ga0207709_10070549 3300025935 Bacteria 2216
153 Ga0207709_10866387 3300025935 Bacteria 732
154 Ga0207670_10202098 3300025936 Bacteria 1510
155 Ga0207669_10031977 3300025937 Bacteria 2948
156 Ga0207665_10506590 3300025939 Bacteria 933
157 Ga0207691_10187184 3300025940 Bacteria 1807
158 Ga0207711_10807392 3300025941 Bacteria 874
159 Ga0207661_10191699 3300025944 Bacteria 1792
160 Ga0207679_10085456 3300025945 Bacteria 2424
161 Ga0207667_10007733 3300025949 Bacteria 12851
162 Ga0207667_10582302 3300025949 Bacteria 1130
163 Ga0207712_10074342 3300025961 Bacteria 2454
164 Ga0207668_10006973 3300025972 Bacteria 6701
165 Ga0207668_10361037 3300025972 Bacteria 1217
166 Ga0207668_11118364 3300025972 Bacteria 706
167 Ga0207640_10351682 3300025981 Bacteria 1184
168 Ga0207640_10414409 3300025981 Bacteria 1101
169 Ga0207639_10124224 3300026041 Bacteria 2126
170 Ga0207639_10351959 3300026041 Bacteria 1316
171 Ga0207639_11437760 3300026041 Bacteria 647
172 Ga0207678_10007033 3300026067 Bacteria 9990
173 Ga0207678_10106371 3300026067 Bacteria 2393
174 Ga0207678_10746719 3300026067 Bacteria 863
175 Ga0207678_10942413 3300026067 Bacteria 764
176 Ga0207708_10101381 3300026075 Bacteria 2228
177 Ga0207702_10432309 3300026078 Bacteria 1274
178 Ga0207702_10523288 3300026078 Bacteria 1158
179 Ga0207702_10786825 3300026078 Bacteria 940
180 Ga0207648_10090589 3300026089 Bacteria 2672
181 Ga0207648_10697656 3300026089 Bacteria 940
182 Ga0207676_10261115 3300026095 Bacteria 1564
183 Ga0207674_10046693 3300026116 Bacteria 4445
184 Ga0207675_100810752 3300026118 Bacteria 950
185 Ga0207683_10304244 3300026121 Bacteria 1459
186 Ga0207698_10029276 3300026142 Bacteria 3942
187 Ga0207698_10504860 3300026142 Bacteria 1177
188 Ga0207698_11517549 3300026142 Bacteria 685
189 Ga0209389_1000039 3300027296 Bacteria 124545
190 Ga0209589_1000038 3300027357 Bacteria 127285
191 Ga0209489_100023 3300027361 Bacteria 198829
192 Ga0209489_100087 3300027361 Bacteria 124545
193 Ga0209700_100090 3300027363 Bacteria 124545
194 Ga0209179_1026896 3300027512 Bacteria 1157
195 Ga0209813_10024980 3300027866 Bacteria 1714
196 Ga0268266_10001364 3300028379 Bacteria 29475
197 Ga0268266_10033319 3300028379 Bacteria 4379
198 Ga0268266_10824591 3300028379 Bacteria 896
199 Ga0268265_10128250 3300028380 Bacteria 2103
200 Ga0265337_1004679 3300028556 Bacteria 5626
201 Ga0265326_10001084 3300028558 Bacteria 9692
202 Ga0265319_1004856 3300028563 Bacteria 6578
203 Ga0265334_10034125 3300028573 Bacteria 2020
204 Ga0265323_10001297 3300028653 Bacteria 12481
205 Ga0265322_10031991 3300028654 Bacteria 1501
206 Ga0265336_10000620 3300028666 Bacteria 19526
207 Ga0265338_10001434 3300028800 Bacteria 38730
208 Ga0265324_10002184 3300029957 Bacteria 10245
209 Ga0307509_10224940 3300031507 Bacteria 1685
210 Ga0307508_10129029 3300031616 Bacteria 2132
211 Ga0307510_10054119 3300033180 Bacteria 4210
212 Ga0307510_10105648 3300033180 Bacteria 2583
213 Ga0315911_1000005 3300033442 Bacteria 426255
214 Ga0373927_0003781 3300035695 Bacteria 10741
215 Ga0373947_0018352 3300035725 Bacteria 4026
216 Ga0372808_015401 3300036459 Bacteria 1093
217 Ga0373925_0060389 3300037068 Bacteria 2847
218 Ga0395899_0049253 3300037312 Bacteria 3133
219 Ga0395900_0003044 3300037418 Bacteria 18262
220 Ga0395900_0194094 3300037418 Bacteria 2058
221 Ga0395898_0003078 3300037466 Bacteria 18893
222 Ga0395905_0104481 3300037471 Bacteria 2659
223 Ga0395901_0022715 3300038443 Bacteria 6432
224 Ga0395901_0230464 3300038443 Bacteria 1934
225 Ga0436362_0220972 3300039453 Bacteria 5253
226 Ga0436362_1191051 3300039453 Bacteria 1141
227 Ga0451787_528066 3300041441 Bacteria 712
228 Ga0451833_0561817 3300041491 Bacteria 1153
229 Ga0451853_1322345 3300041512 Bacteria 915
230 Ga0466961_0179969 3300044693 Bacteria 1313
231 Ga0495617_165738 3300046452 Bacteria 699
232 Ga0495592_0043578 3300046454 Bacteria 3357
233 Ga0495603_0026413 3300046455 Bacteria 3508
234 Ga0495603_0027767 3300046455 Bacteria 3414
235 Ga0495629_0003885 3300046459 Bacteria 11256
236 Ga0495629_0705419 3300046459 Bacteria 670
237 Ga0495638_0019535 3300046460 Bacteria 4483
238 Ga0495651_0026825 3300046462 Bacteria 4486
239 Ga0495653_0612110 3300046463 Bacteria 668
240 Ga0495606_0076424 3300046507 Bacteria 2093
241 Ga0495606_0433611 3300046507 Bacteria 677
242 Ga0495608_0308392 3300046511 Bacteria 979
243 Ga0495610_0080963 3300046512 Bacteria 1492
244 Ga0495618_0035880 3300046514 Bacteria 3112
245 Ga0495620_0054254 3300046515 Bacteria 1694
246 Ga0495628_0520104 3300046516 Bacteria 857
247 Ga0495643_0053818 3300046522 Bacteria 2156
248 Ga0495643_0143795 3300046522 Bacteria 1187
249 Ga0495644_0066016 3300046523 Bacteria 1359
250 Ga0495648_0001207 3300046524 Bacteria 25895
251 Ga0495648_0055521 3300046524 Bacteria 2387
252 Ga0495648_0154757 3300046524 Bacteria 1192
253 Ga0495652_0557005 3300046529 Bacteria 788
254 Ga0495640_0019349 3300046533 Bacteria 5027
255 Ga0495587_0335757 3300046536 Bacteria 843
256 Ga0495598_0104903 3300046537 Bacteria 940
257 Ga0495597_0027670 3300046542 Bacteria 2599
258 Ga0495645_0318804 3300046543 Bacteria 1010
259 Ga0495622_0033954 3300046557 Bacteria 2380
260 Ga0495622_0049422 3300046557 Bacteria 1952
261 Ga0495667_0332104 3300046559 Bacteria 961
262 Ga0495656_0008009 3300046615 Bacteria 3759
263 Ga0495668_0183593 3300046616 Bacteria 1146
264 Ga0495668_0353773 3300046616 Bacteria 806
265 Ga0495625_0052558 3300046660 Bacteria 2917
266 Ga0495625_0172256 3300046660 Bacteria 1445
267 Ga0495625_0213420 3300046660 Bacteria 1268
268 Ga0495635_0510112 3300046663 Bacteria 791
269 Ga0495661_0038077 3300046665 Bacteria 2999
270 Ga0495661_0199415 3300046665 Bacteria 1049
271 Ga0495657_0290050 3300046675 Bacteria 977
272 Ga0495599_0046793 3300046678 Bacteria 2712
273 Ga0495646_0169857 3300046680 Bacteria 1202
274 Ga0495658_0332785 3300046683 Bacteria 964
275 Ga0495669_0005120 3300046684 Bacteria 5455
276 Ga0495624_0261696 3300046690 Bacteria 1045
277 Ga0495649_0028321 3300046694 Bacteria 3105
278 Ga0495649_0348310 3300046694 Bacteria 749
279 Ga0495589_0082769 3300046794 Bacteria 1560
280 Ga0495600_0000832 3300046809 Bacteria 16425
281 Ga0495600_0133892 3300046809 Bacteria 1610
282 Ga0495660_0227519 3300046810 Bacteria 876
283 Ga0495581_0119377 3300047315 Bacteria 1534
284 Ga0495581_0440889 3300047315 Bacteria 759
285 Ga0495581_0577771 3300047315 Bacteria 651
286 Ga0495604_0010490 3300047317 Bacteria 7344
287 Ga0495604_0367612 3300047317 Bacteria 952
288 Ga0495676_0222941 3300047321 Bacteria 1298
289 Ga0495680_0257390 3300047322 Bacteria 1235
290 Ga0495687_005686 3300047443 Bacteria 7869
291 Ga0495677_0115282 3300047445 Bacteria 1023
292 Ga0495673_0052082 3300047469 Bacteria 1790
293 Ga0495673_0116210 3300047469 Bacteria 1064
294 Ga0495684_0084916 3300047471 Bacteria 2401
295 Ga0495686_0238978 3300047472 Bacteria 1025
296 Ga0495602_0399894 3300048088 Bacteria 980
297 Ga0495626_0235979 3300048091 Bacteria 738
298 Ga0496100_0137553 3300048903 Bacteria 1728
299 Ga0496100_0799227 3300048903 Bacteria 739
300 Ga0496101_0357721 3300048904 Bacteria 1148
301 Ga0496101_0416376 3300048904 Bacteria 1059
302 Ga0496102_0347329 3300048905 Bacteria 1397
303 Ga0496102_0435124 3300048905 Bacteria 1231
304 Ga0496102_0660593 3300048905 Bacteria 968
305 Ga0496102_0861939 3300048905 Bacteria 828
306 Ga0496102_0948710 3300048905 Bacteria 781
307 Ga0496104_0262848 3300048907 Bacteria 1638
308 Ga0496105_0107446 3300048908 Bacteria 2303
309 Ga0496105_0413109 3300048908 Bacteria 1069
310 Ga0496105_0427224 3300048908 Bacteria 1048
311 Ga0496105_0439215 3300048908 Bacteria 1031
312 Ga0496106_0158994 3300048909 Bacteria 1786
313 Ga0496106_0464242 3300048909 Bacteria 1017
314 Ga0496106_0656890 3300048909 Bacteria 837
315 Ga0496107_0143232 3300048910 Bacteria 1767
316 Ga0496107_0188578 3300048910 Bacteria 1532
317 Ga0496107_0269821 3300048910 Bacteria 1266
318 Ga0496107_0591479 3300048910 Bacteria 820
319 Ga0496108_0141180 3300048911 Bacteria 2075
320 Ga0496108_0750288 3300048911 Bacteria 844
321 Ga0496109_0140646 3300048912 Bacteria 2257
322 Ga0496110_0058619 3300048913 Bacteria 3391
323 Ga0496110_0382203 3300048913 Bacteria 1283
324 Ga0496111_0296413 3300048914 Bacteria 1199
325 Ga0496112_0338172 3300048915 Bacteria 1449
326 Ga0496112_0377807 3300048915 Bacteria 1358
327 Ga0496112_0649103 3300048915 Bacteria 985
328 Ga0496112_0722491 3300048915 Bacteria 923
329 Ga0496113_0522441 3300048916 Bacteria 953
330 Ga0496114_0356349 3300048917 Bacteria 1294
331 Ga0496114_0475345 3300048917 Bacteria 1106
332 Ga0496115_0029999 3300048918 Bacteria 4275
333 Ga0496115_0100912 3300048918 Bacteria 2366
334 Ga0496115_0333224 3300048918 Bacteria 1239
335 Ga0496115_0356483 3300048918 Bacteria 1192
336 Ga0496116_0177935 3300048919 Bacteria 1143
337 Ga0496118_0184317 3300048921 Bacteria 1257
338 Ga0496119_0016625 3300048922 Bacteria 5584
339 Ga0496119_0035070 3300048922 Bacteria 3293
340 Ga0496120_0012617 3300048923 Bacteria 5736
341 Ga0496120_0139495 3300048923 Bacteria 1232
342 Ga0496121_0024927 3300048924 Bacteria 5700
343 Ga0496121_0066148 3300048924 Bacteria 2936
344 Ga0496122_0277299 3300048925 Bacteria 919
345 Ga0496124_0080375 3300048927 Bacteria 2683
346 Ga0496126_0071815 3300048929 Bacteria 3080
347 Ga0496126_0089962 3300048929 Bacteria 2701
348 Ga0496126_0125076 3300048929 Bacteria 2226
349 Ga0496126_0227015 3300048929 Bacteria 1566
350 Ga0496126_0341203 3300048929 Bacteria 1227
351 Ga0495682_0050416 3300049460 Bacteria 1515
352 Ga0495682_0140629 3300049460 Bacteria 862
353 Ga0501039_0537093 3300049575 Bacteria 918
354 nmdc:mga03n38_58970_c1 3300050490 Bacteria 1741
355 nmdc:mga00v17_210556_c1 3300050491 Bacteria 1258
356 nmdc:mga00v17_314580_c1 3300050491 Bacteria 1017
357 nmdc:mga0yw44_28850_c1 3300050492 Bacteria 3197
358 nmdc:mga0yw44_52270_c1 3300050492 Bacteria 2476
359 nmdc:mga04h51_15963_c1 3300050495 Bacteria 2173
360 Ga0500578_0098299 3300053086 Bacteria 1854
361 Ga0500578_0141006 3300053086 Bacteria 1507
362 Ga0500643_000168 3300053087 Bacteria 64858
363 Ga0500646_0043653 3300053090 Bacteria 1270
364 Ga0500651_0061214 3300053093 Bacteria 2352
365 Ga0500566_0212098 3300053094 Bacteria 969
366 Ga0500566_0218926 3300053094 Bacteria 948
367 Ga0500566_0366552 3300053094 Bacteria 655
368 Ga0500555_003109 3300053103 Bacteria 4736
369 Ga0500569_001709 3300053109 Bacteria 4194
370 Ga0500572_000255 3300053111 Bacteria 19104
371 Ga0500572_018357 3300053111 Bacteria 1811
372 Ga0500594_0088751 3300053118 Bacteria 936
373 Ga0500595_078177 3300053119 Bacteria 972
374 Ga0500595_115635 3300053119 Bacteria 760
375 Ga0500614_027260 3300053123 Bacteria 1371
376 Ga0500652_032290 3300053131 Bacteria 2062
377 Ga0500655_018677 3300053133 Bacteria 1288
378 Ga0500559_0000299 3300053136 Bacteria 38041
379 Ga0500559_0127865 3300053136 Bacteria 1186
380 Ga0500559_0261064 3300053136 Bacteria 815
381 Ga0500568_0054363 3300053139 Bacteria 1566
382 Ga0500588_0077106 3300053146 Bacteria 1107
383 Ga0500590_180501 3300053148 Bacteria 917
384 Ga0500616_0070164 3300053153 Bacteria 1790
385 Ga0500622_0077056 3300053156 Bacteria 1675
386 Ga0500627_0228425 3300053158 Bacteria 829
387 Ga0500638_029142 3300053162 Bacteria 2654
388 Ga0500639_033573 3300053163 Bacteria 2712
389 Ga0500636_0000659 3300053177 Bacteria 18582
390 Ga0500611_160406 3300053727 Bacteria 622
391 Ga0500645_136650 3300053730 Bacteria 679
392 Ga0500609_001181 3300053731 Bacteria 3881
393 Ga0500596_022801 3300053735 Bacteria 947
394 Ga0500596_042465 3300053735 Bacteria 728
395 Ga0500599_000860 3300053736 Bacteria 3362
396 Ga0500601_000475 3300053737 Bacteria 6405
397 Ga0500661_055519 3300055283 Bacteria 711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041441 Ga0451787_528066 Ga0451787_528066_162_668 156
2 3300044693 Ga0466961_0179969 Ga0466961_0179969_519_1148 165
3 3300009177 Ga0105248_10673186 Ga0105248_106731861 167
4 3300048088 Ga0495602_0399894 Ga0495602_0399894_191_730 171
5 3300025261 Ga0209233_1001163 Ga0209233_100116311 173
6 3300031616 Ga0307508_10129029 Ga0307508_101290292 173
7 iso_pu_bacteria 2888419890 2888421227 174
8 iso_pu_bacteria 2507262055 2507505973 175
9 iso_pu_bacteria 2508501009 2508540162 175
10 iso_pu_bacteria 2513237095 2513649123 175
11 iso_pu_bacteria 2513237102 2513700188 175
12 iso_pu_bacteria 2513237104 2513716143 175
13 iso_pu_bacteria 2513237137 2513861162 175
14 iso_pu_bacteria 2513237139 2513877197 175
15 iso_pu_bacteria 2517572143 2517889671 175
16 iso_pu_bacteria 2524023205 2524440788 175
17 iso_pu_bacteria 2524023228 2524533160 175
18 iso_pu_bacteria 2528768022 2528850739 175
19 iso_pu_bacteria 2617270735 2617347856 175
20 iso_pu_bacteria 2791355196 2793061493 175
21 iso_pu_bacteria 2791355197 2793070348 175
22 iso_pu_bacteria 2802429603 2805916203 175
23 iso_pu_bacteria 2816332527 2818240514 175
24 iso_pu_bacteria 2824600985 2824603676 175
25 iso_pu_bacteria 2824609381 2824610738 175
26 iso_pu_bacteria 2824617872 2824625157 175
27 iso_pu_bacteria 2824626560 2824630967 175
28 iso_pu_bacteria 2824635225 2824642280 175
29 iso_pu_bacteria 2824644064 2824648304 175
30 iso_pu_bacteria 2824661429 2824666880 175
31 iso_pu_bacteria 2824696289 2824699940 175
32 iso_pu_bacteria 2824714736 2824719484 175
33 iso_pu_bacteria 2824723954 2824729092 175
34 iso_pu_bacteria 2824773399 2824776370 175
35 iso_pu_bacteria 2842038055 2842044439 175
36 iso_pu_bacteria 2842045827 2842051572 175
37 iso_pu_bacteria 2847930680 2847939387 175
38 iso_pu_bacteria 2847939898 2847941144 175
39 iso_pu_bacteria 2874612657 2874616508 175
40 iso_pu_bacteria 2874620515 2874622526 175
41 iso_pu_bacteria 2876761206 2876763686 175
42 iso_pu_bacteria 2879083081 2879087060 175
43 iso_pu_bacteria 2879099564 2879104390 175
44 iso_pu_bacteria 2879127579 2879133738 175
45 iso_pu_bacteria 2879142872 2879148240 175
46 iso_pu_bacteria 2881364244 2881369549 175
47 iso_pu_bacteria 2881665667 2881669734 175
48 iso_pu_bacteria 2885366525 2885367805 175
49 iso_pu_bacteria 2885409591 2885412954 175
50 iso_pu_bacteria 2888378607 2888387191 175
51 iso_pu_bacteria 2903748898 2903750059 175
52 iso_pu_bacteria 2904666416 2904671467 175
53 iso_pu_bacteria 2904690495 2904692029 175
54 iso_pu_bacteria 2904699407 2904707572 175
55 iso_pu_bacteria 2908756301 2908757308 175
56 iso_pu_bacteria 2929615660 2929622160 175
57 iso_pu_bacteria 2929624759 2929630193 175
58 iso_pu_bacteria 2932784394 2932787879 175
59 iso_pu_bacteria 2932801729 2932807574 175
60 iso_pu_bacteria 2932809354 2932817604 175
61 iso_pu_bacteria 2932818245 2932826236 175
62 iso_pu_bacteria 2932828146 2932835093 175
63 iso_pu_bacteria 2933577622 2933584225 175
64 iso_pu_bacteria 2935608549 2935614398 175
65 iso_pu_bacteria 2935616580 2935620470 175
66 iso_pu_bacteria 2935630451 2935632852 175
67 iso_pu_bacteria 2935638405 2935640793 175
68 iso_pu_bacteria 2935665750 2935670296 175
69 iso_pu_bacteria 2935675223 2935679726 175
70 iso_pu_bacteria 2935684952 2935687295 175
71 iso_pu_bacteria 2935694250 2935696734 175
72 iso_pu_bacteria 2935703347 2935709174 175
73 iso_pu_bacteria 2935713505 2935718754 175
74 iso_pu_bacteria 2935722832 2935728406 175
75 iso_pu_bacteria 2935732158 2935736997 175
76 iso_pu_bacteria 2935741537 2935746000 175
77 iso_pu_bacteria 2935750917 2935753261 175
78 iso_pu_bacteria 2935760218 2935766347 175
79 iso_pu_bacteria 2935769743 2935770263 175
80 iso_pu_bacteria 2935785616 2935786684 175
81 iso_pu_bacteria 2935793552 2935794738 175
82 iso_pu_bacteria 2935801545 2935809028 175
83 iso_pu_bacteria 2935810662 2935813792 175
84 iso_pu_bacteria 2935819856 2935826616 175
85 iso_pu_bacteria 2935827899 2935832300 175
86 iso_pu_bacteria 2935837841 2935844005 175
87 iso_pu_bacteria 2935847175 2935851090 175
88 iso_pu_bacteria 2935855204 2935862796 175
89 iso_pu_bacteria 2935864058 2935864539 175
90 iso_pu_bacteria 2935873716 2935875109 175
91 iso_pu_bacteria 2935908558 2935913140 175
92 iso_pu_bacteria 2935916978 2935922562 175
93 iso_pu_bacteria 2935926038 2935930935 175
94 iso_pu_bacteria 2935934488 2935939731 175
95 iso_pu_bacteria 2935942939 2935946680 175
96 iso_pu_bacteria 2935951376 2935956119 175
97 iso_pu_bacteria 2935959822 2935965024 175
98 iso_pu_bacteria 2935967501 2935972912 175
99 iso_pu_bacteria 2935992306 2935999273 175
100 iso_pu_bacteria 2936002035 2936005828 175
101 iso_pu_bacteria 2936037263 2936039348 175
102 iso_pu_bacteria 2940556831 2940559174 175
103 iso_pu_bacteria 2941507105 2941508483 175
104 iso_pu_bacteria 2941515067 2941516314 175
105 iso_pu_bacteria 2941523033 2941524670 175
106 iso_pu_bacteria 2941538514 2941541868 175
107 iso_pu_bacteria 3005474847 3005475852 175
108 iso_pu_bacteria 3005710791 3005711861 175
109 iso_pu_bacteria 3005718088 3005719118 175
110 iso_pu_bacteria 8016511872 8016517210 175
111 iso_pu_bacteria 8016522445 8016527033 175
112 iso_pu_bacteria 8016530956 8016532112 175
113 iso_pu_bacteria 8016548790 8016556765 175
114 iso_pu_bacteria 8016557553 8016565120 175
115 iso_pu_bacteria 8016566248 8016570407 175
116 iso_pu_bacteria 8016575299 8016582944 175
117 iso_pu_bacteria 8016595262 8016602767 175
118 iso_pu_bacteria 8017057580 8017059380 175
119 iso_pu_bacteria 8019530166 8019531933 175
120 iso_pu_bacteria 8019576017 8019576239 175
121 iso_pu_bacteria 8019597564 8019607447 175
122 iso_pu_bacteria 8019608314 8019611063 175
123 iso_pu_bacteria 8019648815 8019651353 175
124 iso_pu_bacteria 8019687851 8019693246 175
125 iso_pu_bacteria 8055742211 8055743590 175
126 iso_pu_bacteria 8056967851 8056974101 175
127 3300048908 Ga0496105_0427224 Ga0496105_0427224_146_676 176
128 3300026142 Ga0207698_10504860 Ga0207698_105048602 178
129 iso_pu_bacteria 2513237094 2513638283 178
130 iso_pu_bacteria 2922368715 2922377366 178
131 3300005262 Ga0065165_1019150 Ga0065165_10191502 179
132 3300005328 Ga0070676_10429548 Ga0070676_104295482 179
133 3300005336 Ga0070680_100005141 Ga0070680_10000514111 179
134 3300005337 Ga0070682_100396195 Ga0070682_1003961952 179
135 3300005337 Ga0070682_100571803 Ga0070682_1005718032 179
136 3300005339 Ga0070660_100063206 Ga0070660_1000632065 179
137 3300005339 Ga0070660_100267952 Ga0070660_1002679522 179
138 3300005340 Ga0070689_100157744 Ga0070689_1001577442 179
139 3300005341 Ga0070691_10201868 Ga0070691_102018682 179
140 3300005344 Ga0070661_100151918 Ga0070661_1001519182 179
141 3300005347 Ga0070668_100155128 Ga0070668_1001551283 179
142 3300005347 Ga0070668_100235046 Ga0070668_1002350462 179
143 3300005347 Ga0070668_100875501 Ga0070668_1008755011 179
144 3300005347 Ga0070668_100901166 Ga0070668_1009011661 179
145 3300005353 Ga0070669_100198704 Ga0070669_1001987042 179
146 3300005354 Ga0070675_100163507 Ga0070675_1001635072 179
147 3300005355 Ga0070671_100412987 Ga0070671_1004129871 179
148 3300005355 Ga0070671_101377491 Ga0070671_1013774911 179
149 3300005356 Ga0070674_100024125 Ga0070674_1000241254 179
150 3300005366 Ga0070659_100413606 Ga0070659_1004136062 179
151 3300005367 Ga0070667_101112592 Ga0070667_1011125922 179
152 3300005434 Ga0070709_10409023 Ga0070709_104090232 179
153 3300005455 Ga0070663_100008516 Ga0070663_1000085166 179
154 3300005455 Ga0070663_100265140 Ga0070663_1002651402 179
155 3300005455 Ga0070663_100331118 Ga0070663_1003311182 179
156 3300005456 Ga0070678_100164951 Ga0070678_1001649514 179
157 3300005456 Ga0070678_100461277 Ga0070678_1004612772 179
158 3300005458 Ga0070681_10094620 Ga0070681_100946201 179
159 3300005459 Ga0068867_100363833 Ga0068867_1003638332 179
160 3300005459 Ga0068867_100777802 Ga0068867_1007778021 179
161 3300005466 Ga0070685_10466376 Ga0070685_104663762 179
162 3300005467 Ga0070706_100360397 Ga0070706_1003603972 179
163 3300005471 Ga0070698_100161423 Ga0070698_1001614233 179
164 3300005530 Ga0070679_100079934 Ga0070679_1000799344 179
165 3300005535 Ga0070684_100046744 Ga0070684_1000467442 179
166 3300005536 Ga0070697_100286524 Ga0070697_1002865242 179
167 3300005539 Ga0068853_100026423 Ga0068853_1000264233 179
168 3300005539 Ga0068853_100781492 Ga0068853_1007814922 179
169 3300005539 Ga0068853_100882278 Ga0068853_1008822782 179
170 3300005539 Ga0068853_101459987 Ga0068853_1014599871 179
171 3300005543 Ga0070672_100447236 Ga0070672_1004472362 179
172 3300005543 Ga0070672_100918328 Ga0070672_1009183281 179
173 3300005544 Ga0070686_100132633 Ga0070686_1001326332 179
174 3300005548 Ga0070665_100100858 Ga0070665_1001008584 179
175 3300005548 Ga0070665_100131661 Ga0070665_1001316611 179
176 3300005548 Ga0070665_100490922 Ga0070665_1004909222 179
177 3300005548 Ga0070665_100965293 Ga0070665_1009652932 179
178 3300005548 Ga0070665_101387741 Ga0070665_1013877412 179
179 3300005563 Ga0068855_100038094 Ga0068855_1000380946 179
180 3300005563 Ga0068855_100882741 Ga0068855_1008827412 179
181 3300005563 Ga0068855_101280080 Ga0068855_1012800801 179
182 3300005564 Ga0070664_100171957 Ga0070664_1001719572 179
183 3300005577 Ga0068857_100025776 Ga0068857_1000257766 179
184 3300005578 Ga0068854_100125831 Ga0068854_1001258311 179
185 3300005614 Ga0068856_100323070 Ga0068856_1003230702 179
186 3300005614 Ga0068856_100462538 Ga0068856_1004625382 179
187 3300005614 Ga0068856_100589509 Ga0068856_1005895092 179
188 3300005615 Ga0070702_100276630 Ga0070702_1002766302 179
189 3300005616 Ga0068852_100030155 Ga0068852_1000301552 179
190 3300005616 Ga0068852_100188677 Ga0068852_1001886772 179
191 3300005616 Ga0068852_100363639 Ga0068852_1003636392 179
192 3300005719 Ga0068861_101171061 Ga0068861_1011710611 179
193 3300005834 Ga0068851_10006471 Ga0068851_100064716 179
194 3300005841 Ga0068863_100241989 Ga0068863_1002419892 179
195 3300005842 Ga0068858_100468822 Ga0068858_1004688222 179
196 3300005843 Ga0068860_101995173 Ga0068860_1019951731 179
197 3300005844 Ga0068862_100237880 Ga0068862_1002378802 179
198 3300005983 Ga0081540_1062753 Ga0081540_10627533 179
199 3300005983 Ga0081540_1163381 Ga0081540_11633811 179
200 3300006028 Ga0070717_11206514 Ga0070717_112065141 179
201 3300006038 Ga0075365_10074124 Ga0075365_100741244 179
202 3300006038 Ga0075365_10103142 Ga0075365_101031424 179
203 3300006048 Ga0075363_100001410 Ga0075363_1000014103 179
204 3300006051 Ga0075364_10561494 Ga0075364_105614941 179
205 3300006051 Ga0075364_10564849 Ga0075364_105648491 179
206 3300006175 Ga0070712_100243151 Ga0070712_1002431512 179
207 3300006178 Ga0075367_10008466 Ga0075367_100084665 179
208 3300006186 Ga0075369_10132716 Ga0075369_101327162 179
209 3300006237 Ga0097621_100379278 Ga0097621_1003792781 179
210 3300006353 Ga0075370_10029115 Ga0075370_100291155 179
211 3300006358 Ga0068871_100260839 Ga0068871_1002608394 179
212 3300006358 Ga0068871_100301846 Ga0068871_1003018463 179
213 3300006944 Ga0099823_1023273 Ga0099823_10232737 179
214 3300009093 Ga0105240_10025071 Ga0105240_100250715 179
215 3300009093 Ga0105240_10073053 Ga0105240_100730532 179
216 3300009093 Ga0105240_10122488 Ga0105240_101224882 179
217 3300009098 Ga0105245_10150293 Ga0105245_101502932 179
218 3300009098 Ga0105245_10326876 Ga0105245_103268764 179
219 3300009101 Ga0105247_10118877 Ga0105247_101188773 179
220 3300009101 Ga0105247_10191361 Ga0105247_101913613 179
221 3300009174 Ga0105241_10403215 Ga0105241_104032152 179
222 3300009174 Ga0105241_11006847 Ga0105241_110068472 179
223 3300009176 Ga0105242_11088519 Ga0105242_110885192 179
224 3300009177 Ga0105248_11250062 Ga0105248_112500622 179
225 3300009545 Ga0105237_10014802 Ga0105237_100148022 179
226 3300009545 Ga0105237_10017110 Ga0105237_100171106 179
227 3300009545 Ga0105237_10105484 Ga0105237_101054842 179
228 3300009551 Ga0105238_10001521 Ga0105238_100015214 179
229 3300009551 Ga0105238_10437958 Ga0105238_104379582 179
230 3300009551 Ga0105238_11612842 Ga0105238_116128421 179
231 3300010375 Ga0105239_10059018 Ga0105239_100590186 179
232 3300010375 Ga0105239_10286303 Ga0105239_102863032 179
233 3300010375 Ga0105239_10494692 Ga0105239_104946922 179
234 3300010375 Ga0105239_10872232 Ga0105239_108722322 179
235 3300011119 Ga0105246_10512617 Ga0105246_105126172 179
236 3300013104 Ga0157370_10064495 Ga0157370_100644955 179
237 3300013104 Ga0157370_10225226 Ga0157370_102252262 179
238 3300013105 Ga0157369_10014713 Ga0157369_100147137 179
239 3300013296 Ga0157374_10410884 Ga0157374_104108841 179
240 3300013306 Ga0163162_10913450 Ga0163162_109134501 179
241 3300013307 Ga0157372_11975150 Ga0157372_119751502 179
242 3300014325 Ga0163163_10046845 Ga0163163_100468452 179
243 3300014325 Ga0163163_11376836 Ga0163163_113768362 179
244 3300014326 Ga0157380_10513363 Ga0157380_105133633 179
245 3300014968 Ga0157379_10697726 Ga0157379_106977262 179
246 3300014969 Ga0157376_10354198 Ga0157376_103541982 179
247 3300014969 Ga0157376_10786792 Ga0157376_107867921 179
248 3300025254 Ga0209148_1000944 Ga0209148_100094418 179
249 3300025261 Ga0209233_1027541 Ga0209233_10275412 179
250 3300025272 Ga0209455_1007845 Ga0209455_10078454 179
251 3300025297 Ga0209758_1001853 Ga0209758_10018539 179
252 3300025297 Ga0209758_1016012 Ga0209758_10160126 179
253 3300025297 Ga0209758_1062500 Ga0209758_10625002 179
254 3300025299 Ga0209256_1005602 Ga0209256_10056024 179
255 3300025299 Ga0209256_1051525 Ga0209256_10515251 179
256 3300025302 Ga0207426_1034412 Ga0207426_10344123 179
257 3300025304 Ga0209257_1091455 Ga0209257_10914551 179
258 3300025901 Ga0207688_10111489 Ga0207688_101114892 179
259 3300025903 Ga0207680_10553686 Ga0207680_105536862 179
260 3300025904 Ga0207647_10016170 Ga0207647_100161702 179
261 3300025904 Ga0207647_10469259 Ga0207647_104692592 179
262 3300025906 Ga0207699_10058549 Ga0207699_100585493 179
263 3300025909 Ga0207705_10876807 Ga0207705_108768072 179
264 3300025910 Ga0207684_10321875 Ga0207684_103218752 179
265 3300025911 Ga0207654_10394779 Ga0207654_103947792 179
266 3300025912 Ga0207707_10000706 Ga0207707_1000070612 179
267 3300025913 Ga0207695_10000006 Ga0207695_10000006626 179
268 3300025913 Ga0207695_10032870 Ga0207695_100328705 179
269 3300025913 Ga0207695_10145477 Ga0207695_101454772 179
270 3300025914 Ga0207671_10003296 Ga0207671_100032969 179
271 3300025917 Ga0207660_10002043 Ga0207660_100020435 179
272 3300025919 Ga0207657_10004672 Ga0207657_1000467217 179
273 3300025921 Ga0207652_10003935 Ga0207652_1000393514 179
274 3300025923 Ga0207681_10387383 Ga0207681_103873832 179
275 3300025931 Ga0207644_10900729 Ga0207644_109007291 179
276 3300025932 Ga0207690_10150765 Ga0207690_101507652 179
277 3300025933 Ga0207706_10249322 Ga0207706_102493222 179
278 3300025934 Ga0207686_10083041 Ga0207686_100830412 179
279 3300025934 Ga0207686_10255276 Ga0207686_102552762 179
280 3300025935 Ga0207709_10070549 Ga0207709_100705492 179
281 3300025935 Ga0207709_10866387 Ga0207709_108663871 179
282 3300025936 Ga0207670_10202098 Ga0207670_102020982 179
283 3300025937 Ga0207669_10031977 Ga0207669_100319773 179
284 3300025939 Ga0207665_10506590 Ga0207665_105065902 179
285 3300025940 Ga0207691_10187184 Ga0207691_101871842 179
286 3300025941 Ga0207711_10807392 Ga0207711_108073922 179
287 3300025944 Ga0207661_10191699 Ga0207661_101916994 179
288 3300025945 Ga0207679_10085456 Ga0207679_100854562 179
289 3300025949 Ga0207667_10007733 Ga0207667_100077336 179
290 3300025949 Ga0207667_10582302 Ga0207667_105823022 179
291 3300025961 Ga0207712_10074342 Ga0207712_100743425 179
292 3300025972 Ga0207668_10006973 Ga0207668_100069734 179
293 3300025972 Ga0207668_10361037 Ga0207668_103610371 179
294 3300025972 Ga0207668_11118364 Ga0207668_111183641 179
295 3300025981 Ga0207640_10351682 Ga0207640_103516822 179
296 3300025981 Ga0207640_10414409 Ga0207640_104144091 179
297 3300026041 Ga0207639_10124224 Ga0207639_101242241 179
298 3300026041 Ga0207639_10351959 Ga0207639_103519592 179
299 3300026041 Ga0207639_11437760 Ga0207639_114377601 179
300 3300026067 Ga0207678_10007033 Ga0207678_1000703310 179
301 3300026067 Ga0207678_10106371 Ga0207678_101063715 179
302 3300026067 Ga0207678_10746719 Ga0207678_107467192 179
303 3300026067 Ga0207678_10942413 Ga0207678_109424131 179
304 3300026075 Ga0207708_10101381 Ga0207708_101013813 179
305 3300026078 Ga0207702_10432309 Ga0207702_104323092 179
306 3300026078 Ga0207702_10523288 Ga0207702_105232882 179
307 3300026078 Ga0207702_10786825 Ga0207702_107868252 179
308 3300026089 Ga0207648_10090589 Ga0207648_100905892 179
309 3300026089 Ga0207648_10697656 Ga0207648_106976562 179
310 3300026095 Ga0207676_10261115 Ga0207676_102611151 179
311 3300026116 Ga0207674_10046693 Ga0207674_100466937 179
312 3300026118 Ga0207675_100810752 Ga0207675_1008107522 179
313 3300026121 Ga0207683_10304244 Ga0207683_103042443 179
314 3300026142 Ga0207698_10029276 Ga0207698_100292765 179
315 3300026142 Ga0207698_11517549 Ga0207698_115175492 179
316 3300027296 Ga0209389_1000039 Ga0209389_100003975 179
317 3300027357 Ga0209589_1000038 Ga0209589_100003847 179
318 3300027361 Ga0209489_100023 Ga0209489_100023146 179
319 3300027361 Ga0209489_100087 Ga0209489_10008775 179
320 3300027363 Ga0209700_100090 Ga0209700_10009041 179
321 3300027512 Ga0209179_1026896 Ga0209179_10268962 179
322 3300027866 Ga0209813_10024980 Ga0209813_100249802 179
323 3300028379 Ga0268266_10001364 Ga0268266_100013646 179
324 3300028379 Ga0268266_10033319 Ga0268266_100333192 179
325 3300028379 Ga0268266_10824591 Ga0268266_108245911 179
326 3300028380 Ga0268265_10128250 Ga0268265_101282503 179
327 3300028556 Ga0265337_1004679 Ga0265337_10046798 179
328 3300028558 Ga0265326_10001084 Ga0265326_100010848 179
329 3300028563 Ga0265319_1004856 Ga0265319_10048568 179
330 3300028573 Ga0265334_10034125 Ga0265334_100341252 179
331 3300028653 Ga0265323_10001297 Ga0265323_1000129714 179
332 3300028654 Ga0265322_10031991 Ga0265322_100319912 179
333 3300028666 Ga0265336_10000620 Ga0265336_1000062010 179
334 3300028800 Ga0265338_10001434 Ga0265338_1000143414 179
335 3300029957 Ga0265324_10002184 Ga0265324_100021845 179
336 3300031507 Ga0307509_10224940 Ga0307509_102249403 179
337 3300033180 Ga0307510_10054119 Ga0307510_100541197 179
338 3300033180 Ga0307510_10105648 Ga0307510_101056482 179
339 3300033442 Ga0315911_1000005 Ga0315911_100000557 179
340 3300035695 Ga0373927_0003781 Ga0373927_0003781_6313_6852 179
341 3300035725 Ga0373947_0018352 Ga0373947_0018352_1219_1758 179
342 3300036459 Ga0372808_015401 Ga0372808_015401_74_613 179
343 3300037068 Ga0373925_0060389 Ga0373925_0060389_910_1449 179
344 3300037312 Ga0395899_0049253 Ga0395899_0049253_1736_2275 179
345 3300037418 Ga0395900_0003044 Ga0395900_0003044_291_830 179
346 3300037418 Ga0395900_0194094 Ga0395900_0194094_1111_1650 179
347 3300037466 Ga0395898_0003078 Ga0395898_0003078_6821_7360 179
348 3300037471 Ga0395905_0104481 Ga0395905_0104481_680_1219 179
349 3300038443 Ga0395901_0022715 Ga0395901_0022715_2089_2628 179
350 3300038443 Ga0395901_0230464 Ga0395901_0230464_1153_1692 179
351 3300039453 Ga0436362_0220972 Ga0436362_0220972_4676_5215 179
352 3300039453 Ga0436362_1191051 Ga0436362_1191051_413_955 179
353 3300041491 Ga0451833_0561817 Ga0451833_0561817_554_1093 179
354 3300041512 Ga0451853_1322345 Ga0451853_1322345_364_903 179
355 3300046452 Ga0495617_165738 Ga0495617_165738_85_642 179
356 3300046454 Ga0495592_0043578 Ga0495592_0043578_1418_1957 179
357 3300046455 Ga0495603_0026413 Ga0495603_0026413_200_739 179
358 3300046455 Ga0495603_0027767 Ga0495603_0027767_2716_3255 179
359 3300046459 Ga0495629_0003885 Ga0495629_0003885_6906_7445 179
360 3300046459 Ga0495629_0705419 Ga0495629_0705419_121_660 179
361 3300046460 Ga0495638_0019535 Ga0495638_0019535_1083_1622 179
362 3300046462 Ga0495651_0026825 Ga0495651_0026825_113_652 179
363 3300046463 Ga0495653_0612110 Ga0495653_0612110_113_652 179
364 3300046507 Ga0495606_0076424 Ga0495606_0076424_643_1182 179
365 3300046507 Ga0495606_0433611 Ga0495606_0433611_13_552 179
366 3300046511 Ga0495608_0308392 Ga0495608_0308392_145_684 179
367 3300046512 Ga0495610_0080963 Ga0495610_0080963_794_1333 179
368 3300046514 Ga0495618_0035880 Ga0495618_0035880_1660_2199 179
369 3300046515 Ga0495620_0054254 Ga0495620_0054254_74_613 179
370 3300046516 Ga0495628_0520104 Ga0495628_0520104_64_603 179
371 3300046522 Ga0495643_0053818 Ga0495643_0053818_87_626 179
372 3300046522 Ga0495643_0143795 Ga0495643_0143795_14_553 179
373 3300046523 Ga0495644_0066016 Ga0495644_0066016_386_943 179
374 3300046524 Ga0495648_0001207 Ga0495648_0001207_8423_8962 179
375 3300046524 Ga0495648_0055521 Ga0495648_0055521_167_706 179
376 3300046524 Ga0495648_0154757 Ga0495648_0154757_127_666 179
377 3300046529 Ga0495652_0557005 Ga0495652_0557005_216_755 179
378 3300046533 Ga0495640_0019349 Ga0495640_0019349_4349_4888 179
379 3300046536 Ga0495587_0335757 Ga0495587_0335757_64_603 179
380 3300046537 Ga0495598_0104903 Ga0495598_0104903_368_907 179
381 3300046542 Ga0495597_0027670 Ga0495597_0027670_1582_2121 179
382 3300046543 Ga0495645_0318804 Ga0495645_0318804_246_785 179
383 3300046557 Ga0495622_0033954 Ga0495622_0033954_1320_1859 179
384 3300046557 Ga0495622_0049422 Ga0495622_0049422_386_925 179
385 3300046559 Ga0495667_0332104 Ga0495667_0332104_272_811 179
386 3300046615 Ga0495656_0008009 Ga0495656_0008009_1405_1962 179
387 3300046616 Ga0495668_0183593 Ga0495668_0183593_143_682 179
388 3300046616 Ga0495668_0353773 Ga0495668_0353773_94_651 179
389 3300046660 Ga0495625_0052558 Ga0495625_0052558_29_568 179
390 3300046660 Ga0495625_0172256 Ga0495625_0172256_521_1078 179
391 3300046660 Ga0495625_0213420 Ga0495625_0213420_495_1034 179
392 3300046663 Ga0495635_0510112 Ga0495635_0510112_90_629 179
393 3300046665 Ga0495661_0038077 Ga0495661_0038077_1123_1662 179
394 3300046665 Ga0495661_0199415 Ga0495661_0199415_144_683 179
395 3300046675 Ga0495657_0290050 Ga0495657_0290050_404_943 179
396 3300046678 Ga0495599_0046793 Ga0495599_0046793_719_1258 179
397 3300046680 Ga0495646_0169857 Ga0495646_0169857_191_730 179
398 3300046683 Ga0495658_0332785 Ga0495658_0332785_394_933 179
399 3300046684 Ga0495669_0005120 Ga0495669_0005120_26_583 179
400 3300046690 Ga0495624_0261696 Ga0495624_0261696_64_603 179
401 3300046694 Ga0495649_0028321 Ga0495649_0028321_2292_2831 179
402 3300046694 Ga0495649_0348310 Ga0495649_0348310_121_660 179
403 3300046794 Ga0495589_0082769 Ga0495589_0082769_398_955 179
404 3300046809 Ga0495600_0000832 Ga0495600_0000832_5796_6335 179
405 3300046809 Ga0495600_0133892 Ga0495600_0133892_968_1507 179
406 3300046810 Ga0495660_0227519 Ga0495660_0227519_200_739 179
407 3300047315 Ga0495581_0119377 Ga0495581_0119377_281_820 179
408 3300047315 Ga0495581_0440889 Ga0495581_0440889_91_630 179
409 3300047315 Ga0495581_0577771 Ga0495581_0577771_21_560 179
410 3300047317 Ga0495604_0010490 Ga0495604_0010490_737_1276 179
411 3300047317 Ga0495604_0367612 Ga0495604_0367612_369_908 179
412 3300047321 Ga0495676_0222941 Ga0495676_0222941_684_1223 179
413 3300047322 Ga0495680_0257390 Ga0495680_0257390_374_913 179
414 3300047443 Ga0495687_005686 Ga0495687_005686_4782_5321 179
415 3300047445 Ga0495677_0115282 Ga0495677_0115282_368_925 179
416 3300047469 Ga0495673_0052082 Ga0495673_0052082_1237_1776 179
417 3300047469 Ga0495673_0116210 Ga0495673_0116210_90_629 179
418 3300047471 Ga0495684_0084916 Ga0495684_0084916_224_763 179
419 3300047472 Ga0495686_0238978 Ga0495686_0238978_299_838 179
420 3300048091 Ga0495626_0235979 Ga0495626_0235979_161_700 179
421 3300048903 Ga0496100_0137553 Ga0496100_0137553_30_572 179
422 3300048903 Ga0496100_0799227 Ga0496100_0799227_117_656 179
423 3300048904 Ga0496101_0357721 Ga0496101_0357721_247_789 179
424 3300048904 Ga0496101_0416376 Ga0496101_0416376_111_650 179
425 3300048905 Ga0496102_0347329 Ga0496102_0347329_275_829 179
426 3300048905 Ga0496102_0435124 Ga0496102_0435124_157_696 179
427 3300048905 Ga0496102_0660593 Ga0496102_0660593_251_790 179
428 3300048905 Ga0496102_0861939 Ga0496102_0861939_46_588 179
429 3300048905 Ga0496102_0948710 Ga0496102_0948710_30_587 179
430 3300048907 Ga0496104_0262848 Ga0496104_0262848_121_660 179
431 3300048908 Ga0496105_0107446 Ga0496105_0107446_876_1415 179
432 3300048908 Ga0496105_0413109 Ga0496105_0413109_264_806 179
433 3300048908 Ga0496105_0439215 Ga0496105_0439215_192_749 179
434 3300048909 Ga0496106_0158994 Ga0496106_0158994_729_1286 179
435 3300048909 Ga0496106_0464242 Ga0496106_0464242_105_662 179
436 3300048909 Ga0496106_0656890 Ga0496106_0656890_118_657 179
437 3300048910 Ga0496107_0143232 Ga0496107_0143232_577_1134 179
438 3300048910 Ga0496107_0188578 Ga0496107_0188578_574_1113 179
439 3300048910 Ga0496107_0269821 Ga0496107_0269821_373_930 179
440 3300048910 Ga0496107_0591479 Ga0496107_0591479_118_657 179
441 3300048911 Ga0496108_0141180 Ga0496108_0141180_1019_1558 179
442 3300048911 Ga0496108_0750288 Ga0496108_0750288_174_713 179
443 3300048912 Ga0496109_0140646 Ga0496109_0140646_1070_1609 179
444 3300048913 Ga0496110_0058619 Ga0496110_0058619_538_1077 179
445 3300048913 Ga0496110_0382203 Ga0496110_0382203_494_1036 179
446 3300048914 Ga0496111_0296413 Ga0496111_0296413_431_970 179
447 3300048915 Ga0496112_0338172 Ga0496112_0338172_324_881 179
448 3300048915 Ga0496112_0377807 Ga0496112_0377807_151_690 179
449 3300048915 Ga0496112_0649103 Ga0496112_0649103_293_832 179
450 3300048915 Ga0496112_0722491 Ga0496112_0722491_243_782 179
451 3300048916 Ga0496113_0522441 Ga0496113_0522441_287_826 179
452 3300048917 Ga0496114_0356349 Ga0496114_0356349_97_636 179
453 3300048917 Ga0496114_0475345 Ga0496114_0475345_401_940 179
454 3300048918 Ga0496115_0029999 Ga0496115_0029999_1147_1686 179
455 3300048918 Ga0496115_0100912 Ga0496115_0100912_638_1195 179
456 3300048918 Ga0496115_0333224 Ga0496115_0333224_516_1055 179
457 3300048918 Ga0496115_0356483 Ga0496115_0356483_426_983 179
458 3300048919 Ga0496116_0177935 Ga0496116_0177935_474_1013 179
459 3300048921 Ga0496118_0184317 Ga0496118_0184317_622_1161 179
460 3300048922 Ga0496119_0016625 Ga0496119_0016625_4236_4775 179
461 3300048922 Ga0496119_0035070 Ga0496119_0035070_133_672 179
462 3300048923 Ga0496120_0012617 Ga0496120_0012617_541_1080 179
463 3300048923 Ga0496120_0139495 Ga0496120_0139495_433_972 179
464 3300048924 Ga0496121_0024927 Ga0496121_0024927_4322_4861 179
465 3300048924 Ga0496121_0066148 Ga0496121_0066148_1770_2309 179
466 3300048925 Ga0496122_0277299 Ga0496122_0277299_293_832 179
467 3300048927 Ga0496124_0080375 Ga0496124_0080375_1360_1899 179
468 3300048929 Ga0496126_0071815 Ga0496126_0071815_2405_2944 179
469 3300048929 Ga0496126_0089962 Ga0496126_0089962_1098_1637 179
470 3300048929 Ga0496126_0125076 Ga0496126_0125076_523_1062 179
471 3300048929 Ga0496126_0227015 Ga0496126_0227015_219_758 179
472 3300048929 Ga0496126_0341203 Ga0496126_0341203_314_868 179
473 3300049460 Ga0495682_0050416 Ga0495682_0050416_129_668 179
474 3300049460 Ga0495682_0140629 Ga0495682_0140629_221_760 179
475 3300049575 Ga0501039_0537093 Ga0501039_0537093_345_884 179
476 3300050490 nmdc:mga03n38_58970_c1 nmdc:mga03n38_58970_c1_1086_1643 179
477 3300050491 nmdc:mga00v17_210556_c1 nmdc:mga00v17_210556_c1_39_596 179
478 3300050491 nmdc:mga00v17_314580_c1 nmdc:mga00v17_314580_c1_136_675 179
479 3300050492 nmdc:mga0yw44_28850_c1 nmdc:mga0yw44_28850_c1_1652_2191 179
480 3300050492 nmdc:mga0yw44_52270_c1 nmdc:mga0yw44_52270_c1_654_1211 179
481 3300050495 nmdc:mga04h51_15963_c1 nmdc:mga04h51_15963_c1_1531_2070 179
482 3300053086 Ga0500578_0098299 Ga0500578_0098299_804_1343 179
483 3300053086 Ga0500578_0141006 Ga0500578_0141006_741_1280 179
484 3300053087 Ga0500643_000168 Ga0500643_000168_23876_24415 179
485 3300053090 Ga0500646_0043653 Ga0500646_0043653_160_699 179
486 3300053093 Ga0500651_0061214 Ga0500651_0061214_1607_2146 179
487 3300053094 Ga0500566_0212098 Ga0500566_0212098_329_868 179
488 3300053094 Ga0500566_0218926 Ga0500566_0218926_61_600 179
489 3300053094 Ga0500566_0366552 Ga0500566_0366552_15_554 179
490 3300053103 Ga0500555_003109 Ga0500555_003109_376_915 179
491 3300053109 Ga0500569_001709 Ga0500569_001709_2134_2673 179
492 3300053111 Ga0500572_000255 Ga0500572_000255_3197_3736 179
493 3300053111 Ga0500572_018357 Ga0500572_018357_560_1099 179
494 3300053118 Ga0500594_0088751 Ga0500594_0088751_167_706 179
495 3300053119 Ga0500595_078177 Ga0500595_078177_203_742 179
496 3300053119 Ga0500595_115635 Ga0500595_115635_82_621 179
497 3300053123 Ga0500614_027260 Ga0500614_027260_723_1262 179
498 3300053131 Ga0500652_032290 Ga0500652_032290_1229_1768 179
499 3300053133 Ga0500655_018677 Ga0500655_018677_287_826 179
500 3300053136 Ga0500559_0000299 Ga0500559_0000299_15841_16380 179
501 3300053136 Ga0500559_0127865 Ga0500559_0127865_109_648 179
502 3300053136 Ga0500559_0261064 Ga0500559_0261064_108_647 179
503 3300053139 Ga0500568_0054363 Ga0500568_0054363_287_826 179
504 3300053146 Ga0500588_0077106 Ga0500588_0077106_219_758 179
505 3300053148 Ga0500590_180501 Ga0500590_180501_93_635 179
506 3300053153 Ga0500616_0070164 Ga0500616_0070164_856_1395 179
507 3300053156 Ga0500622_0077056 Ga0500622_0077056_640_1179 179
508 3300053158 Ga0500627_0228425 Ga0500627_0228425_167_706 179
509 3300053162 Ga0500638_029142 Ga0500638_029142_692_1231 179
510 3300053163 Ga0500639_033573 Ga0500639_033573_18_557 179
511 3300053177 Ga0500636_0000659 Ga0500636_0000659_7937_8476 179
512 3300053727 Ga0500611_160406 Ga0500611_160406_43_582 179
513 3300053730 Ga0500645_136650 Ga0500645_136650_70_609 179
514 3300053731 Ga0500609_001181 Ga0500609_001181_2449_2988 179
515 3300053735 Ga0500596_022801 Ga0500596_022801_354_893 179
516 3300053735 Ga0500596_042465 Ga0500596_042465_57_596 179
517 3300053736 Ga0500599_000860 Ga0500599_000860_460_999 179
518 3300053737 Ga0500601_000475 Ga0500601_000475_4917_5456 179
519 3300055283 Ga0500661_055519 Ga0500661_055519_131_670 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13328

HD_4

HD domain

11

145

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vxa-assembly1.cif.gz_A structure of the human mesh1-nadph complex 0.9256 2 175
3nr1-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.9218 2 176
3nr1-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.9021 2 176
5vxa-assembly1.cif.gz_A structure of the human mesh1-nadph complex 0.9009 2 175
3nqw-assembly1.cif.gz_B a metazoan ortholog of spot hydrolyzes ppgpp and plays a role in starvation responses 0.8794 1 179
ID Description Score Start End Superfamily
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9224 5 175 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9164 7 172 1.10.3210.10
af_O18307_57_228_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9072 5 175 1.10.3210.10
af_Q54KN3_7_177_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8803 7 172 1.10.3210.10
af_P0AG24_2_190_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7309 4 175 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1G7X7K8-F1-model_v4 Very-short-patch-repair endonuclease 0.9967 1 179 GO:0004519
GO:0008893
AF-A0A1G7X7K8-F1-model_v4 Very-short-patch-repair endonuclease 0.9912 1 179 GO:0004519
GO:0008893
AF-A0A7C5ZWP4-F1-model_v4 Bifunctional (P)ppGpp synthetase/guanosine-3',5'-bis(Diphosphate) 3'-pyrophosphohydrolase 0.9611 2 177 GO:0008893
AF-A0A0N4T6P7-F1-model_v4 HD domain-containing protein 0.9553 4 128 GO:0008893
AF-A0A2N5NWT6-F1-model_v4 deleted 0.9551 8 128

Feature Viewer

pLDDT pTM Quality
97.19 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map