F458480

General Info

Members Datasets Scaffolds Average Seq Length
519 321 1038 318

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2579778521|2579854798
Length 378
Sequence AIATTLTPGPPGFTDVRVFPAAARDGRADYGRGMRGLLVVNPVATTTTERVRDVLASALAADVAMETVLTKGRGHGVELGARAVELGVDVVIALGGDGTVNEITNGLLQNGPIDDGPALAVVPGGSTNVFARALGYSASPVEATGELLDALREGRSRRISIGRAEYGDEGRWFTFCFGIGLDARVVAQAEEKRRKGRRNSAGLFLRTAAGQVTRGADRGAPPITLETTDAHSLPVDAALPADAALPADASVPADSGQADAEAAGSAEERIALGIVCNTRPWTYLNSRPVLACPEASFDTGLDLLALRRVRLSSVLRTASQILGDGRGPHGRNVVRRHDAAVIRFLADHPLPLQMDGEYLGEYVDVTLTHHPRALRVIA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
135 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
187 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
233 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
234 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
235 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
236 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
237 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
238 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
246 2506783011 Frankia datiscae Dg1 Isolate Nodule
247 2508501039 Frankia saprophytica CN3 Isolate Nodule
248 2517572101 Frankia sp. DC12 Isolate Nodule
249 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
250 2527291627 Frankia casuarinae Thr Isolate Nodule
251 2527291629 Frankia sp. BMG5.23 Isolate Nodule
252 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
253 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
254 2576861822 Frankia sp. CeD Isolate Nodule
255 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
256 2619618881 Frankia sp. ACN1ag Isolate Unclassified
257 2619619003 Frankia sp. CpI1-P Isolate Nodule
258 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
259 2626541554 Frankia sp. AvcI.1 Isolate Nodule
260 2643221692 Nocardia sp. Root136 Isolate Unclassified
261 2671180195 Frankia sp. CcI49 Isolate Nodule
262 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
263 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
264 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
265 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
266 2684623036 Frankia sp. CgIM4 Isolate Nodule
267 2687453737 Frankia sp. BMG5.36 Isolate Nodule
268 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
269 2710264753 Frankia sp. KB5 Isolate Nodule
270 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
271 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
272 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
273 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
274 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
275 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
276 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
277 2773857922 Frankia sp. CcI49 Isolate Nodule
278 2773857924 Frankia sp. CgIS1 Isolate Nodule
279 2773857933 Frankia sp. BMG5.30 Isolate Nodule
280 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
281 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
282 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
283 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
284 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
285 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
286 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
287 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
288 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
289 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
290 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
291 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
292 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
293 2891562705 Microbispora tritici MT50 Isolate Unclassified
294 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
295 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
296 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
297 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
298 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
299 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
300 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
301 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
302 2922554459 Rhodococcus sp. 66b Isolate Unclassified
303 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
304 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
305 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
306 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
307 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
308 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
309 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
310 637000116 Frankia casuarinae CcI3 Isolate Nodule
311 8002775197 Frankia nepalensis CN7 Isolate Nodule
312 8002784119 Frankia sp. AgB1.9 Isolate Nodule
313 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
314 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
315 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
316 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
317 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
318 8054920844 Frankia tisae Agncl-8 Isolate Nodule
319 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
320 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
321 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.2
Metatranscriptomes 0.96
Isolates 14.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 4.05
Nodule 5.01
Rhizoplane 5.2
Rhizosphere 73.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10004437 3300003320 Bacteria 2350
2 Ga0055540_1003256 3300003792 Bacteria 7954
3 Ga0070658_10003877 3300005327 Bacteria 12264
4 Ga0070658_10100936 3300005327 Bacteria 2385
5 Ga0070676_10194978 3300005328 Bacteria 1324
6 Ga0070683_100223813 3300005329 Bacteria 1788
7 Ga0070683_100360286 3300005329 Bacteria 1385
8 Ga0070680_100000111 3300005336 Bacteria 47136
9 Ga0070680_100245654 3300005336 Bacteria 1513
10 Ga0070680_100265351 3300005336 Bacteria 1453
11 Ga0070682_100008817 3300005337 Bacteria 5693
12 Ga0070660_100193420 3300005339 Bacteria 1648
13 Ga0070668_100007123 3300005347 Bacteria 8287
14 Ga0070671_100032896 3300005355 Bacteria 4287
15 Ga0070667_100011952 3300005367 Bacteria 7184
16 Ga0070709_10052834 3300005434 Bacteria 2556
17 Ga0070709_10116912 3300005434 Bacteria 1801
18 Ga0070714_100000289 3300005435 Bacteria 38421
19 Ga0070714_100005386 3300005435 Bacteria 9765
20 Ga0070663_100327352 3300005455 Bacteria 1234
21 Ga0070681_10000299 3300005458 Bacteria 40221
22 Ga0070681_10396446 3300005458 Bacteria 1291
23 Ga0070685_10313904 3300005466 Bacteria 1060
24 Ga0070679_100000736 3300005530 Bacteria 28309
25 Ga0070679_100037493 3300005530 Bacteria 4816
26 Ga0070679_100125546 3300005530 Bacteria 2548
27 Ga0070684_100060081 3300005535 Bacteria 3324
28 Ga0070684_100084662 3300005535 Bacteria 2811
29 Ga0070665_100001822 3300005548 Bacteria 24187
30 Ga0068855_100017282 3300005563 Bacteria 8681
31 Ga0068857_100059264 3300005577 Bacteria 3401
32 Ga0068857_100124918 3300005577 Bacteria 2318
33 Ga0068856_100035710 3300005614 Bacteria 4872
34 Ga0068856_100407086 3300005614 Bacteria 1380
35 Ga0068852_100111085 3300005616 Bacteria 2492
36 Ga0068859_100000105 3300005617 Bacteria 78213
37 Ga0068859_100006462 3300005617 Bacteria 11891
38 Ga0068864_100010815 3300005618 Bacteria 7539
39 Ga0068863_100000344 3300005841 Bacteria 47416
40 Ga0068863_100012077 3300005841 Bacteria 8343
41 Ga0068863_100028032 3300005841 Bacteria 5376
42 Ga0068858_100003495 3300005842 Bacteria 15581
43 Ga0068860_100000067 3300005843 Bacteria 180176
44 Ga0068862_100000025 3300005844 Bacteria 197313
45 Ga0081455_10000958 3300005937 Bacteria 36892
46 Ga0081455_10075437 3300005937 Bacteria 2782
47 Ga0081540_1034747 3300005983 Bacteria 2712
48 Ga0081539_10004919 3300005985 Bacteria 14234
49 Ga0081539_10008651 3300005985 Bacteria 8773
50 Ga0081539_10027826 3300005985 Bacteria 3571
51 Ga0081539_10029654 3300005985 Bacteria 3412
52 Ga0070717_10206643 3300006028 Bacteria 1722
53 Ga0075363_100065146 3300006048 Bacteria 1969
54 Ga0075364_10001452 3300006051 Bacteria 12866
55 Ga0070712_100071861 3300006175 Bacteria 2477
56 Ga0075428_100002510 3300006844 Bacteria 19936
57 Ga0075428_100051472 3300006844 Bacteria 4516
58 Ga0075428_100124855 3300006844 Bacteria 2801
59 Ga0075428_100220938 3300006844 Bacteria 2046
60 Ga0075428_100467386 3300006844 Bacteria 1350
61 Ga0075430_100110487 3300006846 Bacteria 2292
62 Ga0075431_100015455 3300006847 Bacteria 7734
63 Ga0075429_100120606 3300006880 Bacteria 2292
64 Ga0097620_100000105 3300006931 Bacteria 78213
65 Ga0097620_100006462 3300006931 Bacteria 11891
66 Ga0105240_10012823 3300009093 Bacteria 11548
67 Ga0105240_10048986 3300009093 Bacteria 5337
68 Ga0105240_10111515 3300009093 Bacteria 3309
69 Ga0105240_10309115 3300009093 Bacteria 1806
70 Ga0111539_10370803 3300009094 Bacteria 1666
71 Ga0105245_10091844 3300009098 Bacteria 2794
72 Ga0105245_10239663 3300009098 Bacteria 1757
73 Ga0105247_10000057 3300009101 Bacteria 133165
74 Ga0105247_10059396 3300009101 Bacteria 2367
75 Ga0114129_10002822 3300009147 Bacteria 24241
76 Ga0114129_10295947 3300009147 Bacteria 2159
77 Ga0105243_10000724 3300009148 Bacteria 31687
78 Ga0105248_10001710 3300009177 Bacteria 24413
79 Ga0105248_10046012 3300009177 Bacteria 4892
80 Ga0105248_10052962 3300009177 Bacteria 4554
81 Ga0105238_10230194 3300009551 Bacteria 1830
82 Ga0105249_10011910 3300009553 Bacteria 7649
83 Ga0105249_10195247 3300009553 Bacteria 1978
84 Ga0105249_10201109 3300009553 Bacteria 1950
85 Ga0105239_10013686 3300010375 Bacteria 9008
86 Ga0157370_10046454 3300013104 Bacteria 4163
87 Ga0157369_10004740 3300013105 Bacteria 15981
88 Ga0157369_10006566 3300013105 Bacteria 13460
89 Ga0157369_10050567 3300013105 Bacteria 4500
90 Ga0157369_10073167 3300013105 Bacteria 3677
91 Ga0157378_10049368 3300013297 Bacteria 3743
92 Ga0163162_10276408 3300013306 Bacteria 1811
93 Ga0157372_10000339 3300013307 Bacteria 51491
94 Ga0157375_10070880 3300013308 Bacteria 3497
95 Ga0157375_10497700 3300013308 Bacteria 1383
96 Ga0157375_10511896 3300013308 Bacteria 1364
97 Ga0163163_10022459 3300014325 Bacteria 5975
98 Ga0163163_10234703 3300014325 Bacteria 1884
99 Ga0182008_10114450 3300014497 Bacteria 1338
100 Ga0157379_10015463 3300014968 Bacteria 6696
101 Ga0157379_10023190 3300014968 Bacteria 5505
102 Ga0163161_10127010 3300017792 Bacteria 1921
103 Ga0197907_10246913 3300020069 Bacteria 3311
104 Ga0206356_11156082 3300020070 Bacteria 3165
105 Ga0206354_10231370 3300020081 Bacteria 4477
106 Ga0206353_10206701 3300020082 Bacteria 10401
107 Ga0213876_10000552 3300021384 Bacteria 28013
108 Ga0224712_10008617 3300022467 Bacteria 3033
109 Ga0207710_10000011 3300025900 Bacteria 428560
110 Ga0207647_10058807 3300025904 Bacteria 2353
111 Ga0207705_10001286 3300025909 Bacteria 20143
112 Ga0207707_10000341 3300025912 Bacteria 49363
113 Ga0207695_10029050 3300025913 Bacteria 6119
114 Ga0207695_10177150 3300025913 Bacteria 2054
115 Ga0207693_10080526 3300025915 Bacteria 2550
116 Ga0207693_10096023 3300025915 Bacteria 2324
117 Ga0207660_10001783 3300025917 Bacteria 14392
118 Ga0207657_10084439 3300025919 Bacteria 2661
119 Ga0207657_10240018 3300025919 Bacteria 1447
120 Ga0207652_10000143 3300025921 Bacteria 76508
121 Ga0207652_10141528 3300025921 Bacteria 2151
122 Ga0207664_10000002 3300025929 Bacteria 657053
123 Ga0207664_10007418 3300025929 Bacteria 7604
124 Ga0207644_10015263 3300025931 Bacteria 5153
125 Ga0207709_10020203 3300025935 Bacteria 3754
126 Ga0207711_10000034 3300025941 Bacteria 190060
127 Ga0207711_10010363 3300025941 Bacteria 7740
128 Ga0207711_10052954 3300025941 Bacteria 3480
129 Ga0207711_10076322 3300025941 Bacteria 2918
130 Ga0207661_10128465 3300025944 Bacteria 2167
131 Ga0207661_10132921 3300025944 Bacteria 2134
132 Ga0207667_10043626 3300025949 Bacteria 4758
133 Ga0207667_10260513 3300025949 Bacteria 1773
134 Ga0207712_10008257 3300025961 Bacteria 6581
135 Ga0207658_10027156 3300025986 Bacteria 4020
136 Ga0207703_10009166 3300026035 Bacteria 7791
137 Ga0207678_10005217 3300026067 Bacteria 11644
138 Ga0207702_10024561 3300026078 Bacteria 5001
139 Ga0207702_10360302 3300026078 Bacteria 1394
140 Ga0207641_10002788 3300026088 Bacteria 15906
141 Ga0207641_10016880 3300026088 Bacteria 5978
142 Ga0207676_10058638 3300026095 Bacteria 3037
143 Ga0207674_10063152 3300026116 Bacteria 3739
144 Ga0207674_10128775 3300026116 Bacteria 2496
145 Ga0207698_10246097 3300026142 Bacteria 1633
146 Ga0268266_10027100 3300028379 Bacteria 4875
147 Ga0268265_10000017 3300028380 Bacteria 293875
148 Ga0268264_10000114 3300028381 Bacteria 203211
149 Ga0268264_10291608 3300028381 Bacteria 1532
150 Ga0307517_10000910 3300028786 Bacteria 50175
151 Ga0307517_10106389 3300028786 Bacteria 2170
152 Ga0307517_10151414 3300028786 Bacteria 1590
153 Ga0307515_10000065 3300028794 Bacteria 244497
154 Ga0307515_10013928 3300028794 Bacteria 14970
155 Ga0265327_10000019 3300031251 Bacteria 427653
156 Ga0265327_10000610 3300031251 Bacteria 59085
157 Ga0265327_10001706 3300031251 Bacteria 26244
158 Ga0307513_10068018 3300031456 Bacteria 3733
159 Ga0307509_10016707 3300031507 Bacteria 8481
160 Ga0307509_10198714 3300031507 Bacteria 1845
161 Ga0307508_10001866 3300031616 Bacteria 23226
162 Ga0307508_10050133 3300031616 Bacteria 3716
163 Ga0307508_10126464 3300031616 Bacteria 2159
164 Ga0316576_10009240 3300031727 Bacteria 6355
165 Ga0316576_10009949 3300031727 Bacteria 6156
166 Ga0316576_10079696 3300031727 Bacteria 2427
167 Ga0307516_10004273 3300031730 Bacteria 17755
168 Ga0307516_10025318 3300031730 Bacteria 6044
169 Ga0307405_10051734 3300031731 Bacteria 2550
170 Ga0307413_10050360 3300031824 Bacteria 2502
171 Ga0307413_10207366 3300031824 Bacteria 1420
172 Ga0307410_10162659 3300031852 Bacteria 1674
173 Ga0307410_10170052 3300031852 Bacteria 1641
174 Ga0307406_10017989 3300031901 Bacteria 4123
175 Ga0307406_10050457 3300031901 Bacteria 2638
176 Ga0307406_10083122 3300031901 Bacteria 2134
177 Ga0307406_10089437 3300031901 Bacteria 2069
178 Ga0307407_10023333 3300031903 Bacteria 3227
179 Ga0307407_10129611 3300031903 Bacteria 1611
180 Ga0307409_100018267 3300031995 Bacteria 4707
181 Ga0307409_100114554 3300031995 Bacteria 2268
182 Ga0307409_100250301 3300031995 Bacteria 1619
183 Ga0307416_100010387 3300032002 Bacteria 6146
184 Ga0307416_100019953 3300032002 Bacteria 4768
185 Ga0307416_100101568 3300032002 Bacteria 2505
186 Ga0307416_100118875 3300032002 Bacteria 2350
187 Ga0307414_10046850 3300032004 Bacteria 2971
188 Ga0307414_10203680 3300032004 Bacteria 1612
189 Ga0307414_10224321 3300032004 Bacteria 1545
190 Ga0307414_10225969 3300032004 Bacteria 1540
191 Ga0307414_10284612 3300032004 Bacteria 1391
192 Ga0307411_10038408 3300032005 Bacteria 3020
193 Ga0307411_10096111 3300032005 Bacteria 2082
194 Ga0307411_10106331 3300032005 Bacteria 1997
195 Ga0307415_100026351 3300032126 Bacteria 3665
196 Ga0307415_100054551 3300032126 Bacteria 2729
197 Ga0307415_100095926 3300032126 Bacteria 2160
198 Ga0307415_100108159 3300032126 Bacteria 2056
199 Ga0307507_10000020 3300033179 Bacteria 220880
200 Ga0307510_10057801 3300033180 Bacteria 4022
201 Ga0373960_0053873 3300035121 Bacteria 1202
202 Ga0316574_0006740 3300035398 Bacteria 6237
203 Ga0373947_0023593 3300035725 Bacteria 3581
204 Ga0316584_0126784 3300036712 Bacteria 1906
205 Ga0395899_0013079 3300037312 Bacteria 6347
206 Ga0395899_0095215 3300037312 Bacteria 2154
207 Ga0395900_0004313 3300037418 Bacteria 15078
208 Ga0395900_0007733 3300037418 Bacteria 11086
209 Ga0395900_0024436 3300037418 Bacteria 6188
210 Ga0395900_0087937 3300037418 Bacteria 3194
211 Ga0395900_0173213 3300037418 Bacteria 2196
212 Ga0395900_0342096 3300037418 Bacteria 1471
213 Ga0395898_0013021 3300037466 Bacteria 8572
214 Ga0395898_0087395 3300037466 Bacteria 3003
215 Ga0395898_0112011 3300037466 Bacteria 2615
216 Ga0395905_0003728 3300037471 Bacteria 16140
217 Ga0395901_0004087 3300038443 Bacteria 14704
218 Ga0395901_0006120 3300038443 Bacteria 12194
219 Ga0395901_0006468 3300038443 Bacteria 11866
220 Ga0395901_0055164 3300038443 Bacteria 4132
221 Ga0395901_0479999 3300038443 Bacteria 1268
222 Ga0436365_1603863 3300039437 Bacteria 1816
223 Ga0436365_1781586 3300039437 Bacteria 55120
224 Ga0439436_0001467 3300041404 Bacteria 6848
225 Ga0439436_0055646 3300041404 Bacteria 1111
226 Ga0439439_0011294 3300041406 Bacteria 2148
227 Ga0451791_1836731 3300041451 Bacteria 1208
228 Ga0451853_0299947 3300041512 Bacteria 11652
229 Ga0439433_0022385 3300041999 Bacteria 1417
230 Ga0439457_006958 3300042014 Bacteria 2735
231 Ga0450920_013794 3300042122 Bacteria 1524
232 Ga0450894_000764 3300042131 Bacteria 5262
233 Ga0450896_000588 3300042133 Bacteria 3915
234 Ga0450899_000143 3300042135 Bacteria 6809
235 Ga0450906_000766 3300042145 Bacteria 6987
236 Ga0466969_0003943 3300044656 Bacteria 7878
237 Ga0466969_0021661 3300044656 Bacteria 3322
238 Ga0466969_0162830 3300044656 Bacteria 1025
239 Ga0466965_0043148 3300044683 Bacteria 2226
240 Ga0466966_0022659 3300044684 Bacteria 4120
241 Ga0466966_0036867 3300044684 Bacteria 3156
242 Ga0466966_0084268 3300044684 Bacteria 1977
243 Ga0466961_0000215 3300044693 Bacteria 38990
244 Ga0466961_0004650 3300044693 Bacteria 8621
245 Ga0466961_0008619 3300044693 Bacteria 6499
246 Ga0466961_0018982 3300044693 Bacteria 4424
247 Ga0466961_0045562 3300044693 Bacteria 2806
248 Ga0466961_0082900 3300044693 Bacteria 2028
249 Ga0466961_0103153 3300044693 Bacteria 1796
250 Ga0466961_0109569 3300044693 Bacteria 1738
251 Ga0466961_0326146 3300044693 Bacteria 936
252 Ga0466963_0011058 3300044694 Bacteria 5487
253 Ga0466963_0082635 3300044694 Bacteria 2178
254 Ga0466963_0088212 3300044694 Bacteria 2110
255 Ga0466963_0131103 3300044694 Bacteria 1732
256 Ga0466963_0138211 3300044694 Bacteria 1687
257 Ga0466963_0143076 3300044694 Bacteria 1657
258 Ga0466963_0168683 3300044694 Bacteria 1525
259 Ga0466963_0191944 3300044694 Bacteria 1427
260 Ga0466963_0219966 3300044694 Bacteria 1330
261 Ga0466963_0229829 3300044694 Bacteria 1300
262 Ga0466964_0043267 3300044706 Bacteria 1826
263 Ga0466971_0000053 3300044719 Bacteria 44476
264 Ga0466971_0000895 3300044719 Bacteria 12201
265 Ga0466971_0001960 3300044719 Bacteria 8714
266 Ga0466957_0043546 3300044842 Bacteria 2719
267 Ga0466957_0101439 3300044842 Bacteria 1815
268 Ga0466957_0184685 3300044842 Bacteria 1363
269 Ga0466960_0008621 3300044901 Bacteria 4180
270 Ga0466960_0040304 3300044901 Bacteria 2208
271 Ga0466959_0000672 3300045049 Bacteria 19951
272 Ga0466959_0002842 3300045049 Bacteria 11156
273 Ga0466959_0034944 3300045049 Bacteria 3717
274 Ga0466959_0036606 3300045049 Bacteria 3626
275 Ga0466959_0105666 3300045049 Bacteria 2013
276 Ga0466959_0227526 3300045049 Bacteria 1292
277 Ga0466958_0004754 3300045836 Bacteria 7220
278 Ga0466958_0010153 3300045836 Bacteria 5264
279 Ga0466958_0029444 3300045836 Bacteria 3259
280 Ga0466958_0058964 3300045836 Bacteria 2334
281 Ga0466967_0000899 3300045976 Bacteria 15915
282 Ga0466967_0006912 3300045976 Bacteria 8109
283 Ga0466967_0007198 3300045976 Bacteria 7992
284 Ga0466967_0166950 3300045976 Bacteria 2069
285 Ga0466967_0255838 3300045976 Bacteria 1674
286 Ga0466967_0294897 3300045976 Bacteria 1559
287 Ga0466967_0310265 3300045976 Bacteria 1519
288 Ga0466967_0556377 3300045976 Bacteria 1129
289 Ga0466967_0701600 3300045976 Bacteria 1002
290 Ga0495592_0028757 3300046454 Bacteria 4207
291 Ga0495603_0009852 3300046455 Bacteria 5782
292 Ga0495629_0044945 3300046459 Bacteria 3099
293 Ga0495629_0153148 3300046459 Bacteria 1602
294 Ga0495629_0230259 3300046459 Bacteria 1277
295 Ga0495641_0012759 3300046461 Bacteria 4671
296 Ga0495651_0000320 3300046462 Bacteria 37248
297 Ga0495651_0046716 3300046462 Bacteria 3350
298 Ga0495653_0019527 3300046463 Bacteria 5495
299 Ga0495662_0002463 3300046476 Bacteria 9318
300 Ga0495664_0079358 3300046477 Bacteria 1967
301 Ga0495594_0003940 3300046499 Bacteria 7640
302 Ga0495594_0005834 3300046499 Bacteria 6325
303 Ga0495594_0030310 3300046499 Bacteria 2925
304 Ga0495608_0001452 3300046511 Bacteria 16837
305 Ga0495608_0065594 3300046511 Bacteria 2378
306 Ga0495618_0054974 3300046514 Bacteria 2520
307 Ga0495628_0003783 3300046516 Bacteria 13468
308 Ga0495628_0055292 3300046516 Bacteria 3126
309 Ga0495643_0009480 3300046522 Bacteria 6048
310 Ga0495648_0017498 3300046524 Bacteria 5120
311 Ga0495666_0019900 3300046526 Bacteria 3329
312 Ga0495652_0062094 3300046529 Bacteria 3151
313 Ga0495665_0002887 3300046531 Bacteria 9290
314 Ga0495665_0045660 3300046531 Bacteria 2327
315 Ga0495640_0167902 3300046533 Bacteria 1403
316 Ga0495586_0006900 3300046535 Bacteria 6052
317 Ga0495645_0019064 3300046543 Bacteria 4939
318 Ga0495667_0004437 3300046559 Bacteria 9470
319 Ga0495656_0088409 3300046615 Bacteria 1412
320 Ga0495635_0002575 3300046663 Bacteria 12411
321 Ga0495588_0048357 3300046674 Bacteria 2184
322 Ga0495657_0012072 3300046675 Bacteria 6427
323 Ga0495623_0037466 3300046679 Bacteria 3102
324 Ga0495623_0097227 3300046679 Bacteria 1798
325 Ga0495646_0074696 3300046680 Bacteria 1988
326 Ga0495658_0035584 3300046683 Bacteria 2741
327 Ga0495613_0002174 3300046689 Bacteria 14854
328 Ga0495613_0135774 3300046689 Bacteria 1760
329 Ga0495670_0060652 3300046691 Bacteria 1901
330 Ga0495670_0204515 3300046691 Bacteria 1046
331 Ga0495589_0059989 3300046794 Bacteria 1869
332 Ga0495600_0003318 3300046809 Bacteria 9447
333 Ga0495581_0064138 3300047315 Bacteria 2122
334 Ga0495581_0121230 3300047315 Bacteria 1522
335 Ga0495604_0001708 3300047317 Bacteria 18046
336 Ga0495636_0013254 3300047318 Bacteria 3271
337 Ga0495674_0207327 3300047319 Bacteria 1625
338 Ga0495683_0007285 3300047323 Bacteria 5999
339 Ga0495683_0063845 3300047323 Bacteria 1819
340 Ga0495675_0023809 3300047444 Bacteria 3901
341 Ga0495679_024518 3300047446 Bacteria 2031
342 Ga0495685_024843 3300047447 Bacteria 2062
343 Ga0495685_080229 3300047447 Bacteria 1087
344 Ga0495684_0149125 3300047471 Bacteria 1749
345 Ga0495602_0027676 3300048088 Bacteria 5444
346 Ga0495614_0038618 3300048089 Bacteria 2049
347 Ga0496101_0235501 3300048904 Bacteria 1424
348 Ga0496101_0385725 3300048904 Bacteria 1102
349 Ga0496102_0028784 3300048905 Bacteria 4967
350 Ga0496104_0030429 3300048907 Bacteria 5016
351 Ga0496104_0148592 3300048907 Bacteria 2250
352 Ga0496105_0077277 3300048908 Bacteria 2749
353 Ga0496105_0174892 3300048908 Bacteria 1759
354 Ga0496105_0191417 3300048908 Bacteria 1672
355 Ga0496107_0353945 3300048910 Bacteria 1093
356 Ga0496108_0011268 3300048911 Bacteria 7265
357 Ga0496108_0019404 3300048911 Bacteria 5583
358 Ga0496109_0022864 3300048912 Bacteria 5541
359 Ga0496109_0444488 3300048912 Bacteria 1225
360 Ga0496110_0003656 3300048913 Bacteria 11830
361 Ga0496110_0113157 3300048913 Bacteria 2440
362 Ga0496112_0055710 3300048915 Bacteria 3889
363 Ga0496112_0184380 3300048915 Bacteria 2051
364 Ga0496113_0011739 3300048916 Bacteria 5863
365 Ga0496113_0012991 3300048916 Bacteria 5618
366 Ga0496113_0031996 3300048916 Bacteria 3821
367 Ga0496114_0028358 3300048917 Bacteria 4593
368 Ga0496114_0057180 3300048917 Bacteria 3256
369 Ga0496114_0118021 3300048917 Bacteria 2279
370 Ga0496114_0174199 3300048917 Bacteria 1876
371 Ga0496115_0416649 3300048918 Bacteria 1088
372 Ga0496116_0000202 3300048919 Bacteria 115317
373 Ga0496117_0019409 3300048920 Bacteria 5583
374 Ga0496117_0037091 3300048920 Bacteria 3636
375 Ga0496118_0003458 3300048921 Bacteria 19860
376 Ga0496118_0011923 3300048921 Bacteria 8411
377 Ga0496118_0043004 3300048921 Bacteria 3557
378 Ga0496119_0000886 3300048922 Bacteria 39208
379 Ga0496119_0023190 3300048922 Bacteria 4413
380 Ga0496120_0000072 3300048923 Bacteria 164400
381 Ga0496120_0066910 3300048923 Bacteria 1986
382 Ga0496121_0011421 3300048924 Bacteria 9864
383 Ga0496126_0105003 3300048929 Bacteria 2468
384 Ga0501032_0040796 3300049569 Bacteria 3154
385 Ga0501032_0123390 3300049569 Bacteria 1712
386 Ga0501032_0304591 3300049569 Bacteria 1030
387 Ga0501034_0107911 3300049571 Bacteria 2776
388 Ga0501034_0358354 3300049571 Bacteria 1386
389 Ga0501036_0489711 3300049572 Bacteria 1023
390 Ga0501039_0208069 3300049575 Bacteria 1538
391 Ga0501043_0070337 3300049579 Bacteria 2749
392 Ga0501047_0157074 3300049581 Bacteria 2148
393 Ga0501069_0010625 3300049585 Bacteria 4877
394 Ga0501070_0001163 3300049586 Bacteria 23531
395 Ga0501070_0012214 3300049586 Bacteria 7247
396 Ga0501070_0020672 3300049586 Bacteria 5522
397 Ga0501070_0026751 3300049586 Bacteria 4838
398 Ga0501072_0238027 3300049588 Bacteria 1450
399 Ga0501073_0048057 3300049589 Bacteria 2997
400 Ga0501073_0169793 3300049589 Bacteria 1510
401 Ga0501074_0015565 3300049590 Bacteria 5528
402 Ga0501074_0137827 3300049590 Bacteria 1746
403 Ga0501074_0265530 3300049590 Bacteria 1220
404 Ga0501079_0000971 3300049741 Bacteria 19779
405 Ga0501080_0000278 3300049742 Bacteria 38585
406 Ga0501080_0008725 3300049742 Bacteria 9205
407 Ga0501080_0038259 3300049742 Bacteria 4479
408 Ga0501080_0213563 3300049742 Bacteria 1768
409 Ga0501044_0018872 3300049823 Bacteria 7385
410 Ga0501044_0136491 3300049823 Bacteria 2444
411 Ga0501044_0221946 3300049823 Bacteria 1840
412 nmdc:mga00v17_8385_c1 3300050491 Bacteria 5559
413 nmdc:mga05p37_148441_c1 3300050507 Bacteria 2869
414 nmdc:mga05p37_2166_c1 3300050507 Bacteria 22891
415 nmdc:mga09592_534_c2 3300050508 Bacteria 20140
416 nmdc:mga0qj67_15_c3 3300050509 Bacteria 20140
417 nmdc:mga06r32_447_c1 3300050510 Bacteria 28100
418 nmdc:mga06r32_5309_c1 3300050510 Bacteria 11599
419 Ga0500610_0101991 3300053079 Bacteria 1484
420 Ga0495619_0028492 3300053085 Bacteria 3603
421 Ga0495619_0136863 3300053085 Bacteria 1685
422 Ga0500644_0051291 3300053088 Bacteria 1416
423 Ga0500646_0000256 3300053090 Bacteria 16334
424 Ga0500646_0007393 3300053090 Bacteria 2806
425 Ga0500583_0007015 3300053092 Bacteria 3928
426 Ga0500660_062353 3300053100 Bacteria 1789
427 Ga0500660_063592 3300053100 Bacteria 1764
428 Ga0500553_063602 3300053101 Bacteria 1722
429 Ga0500628_010833 3300053129 Bacteria 1642
430 Ga0500658_0003541 3300053134 Bacteria 5892
431 Ga0500561_0009492 3300053137 Bacteria 1978
432 Ga0500573_0118643 3300053140 Bacteria 1475
433 Ga0500588_0002124 3300053146 Bacteria 3961
434 Ga0500588_0039407 3300053146 Bacteria 1415
435 Ga0500604_0026332 3300053151 Bacteria 1677
436 Ga0500616_0016347 3300053153 Bacteria 4226
437 Ga0500634_0006481 3300053161 Bacteria 5672
438 Ga0466962_0004732 3300061719 Bacteria 6543
439 Ga0466962_0005010 3300061719 Bacteria 6369
440 Ga0466962_0006694 3300061719 Bacteria 5526
441 Ga0466962_0057712 3300061719 Bacteria 1853
442 Ga0466962_0116314 3300061719 Bacteria 1288
443 2579854798 2579778521 Bacteria 7624758
444 2506865530 2506783011 Bacteria 5323186
445 2508672444 2508501039 Bacteria 9978592
446 2517760628 2517572101 Bacteria 6884336
447 2523385823 2523231044 Bacteria 6434991
448 2528205236 2527291627 Bacteria 5309833
449 2528215326 2527291629 Bacteria 5267418
450 2546950874 2546825537 Bacteria 5389291
451 2552110163 2551306166 Bacteria 9731570
452 2579750299 2576861822 Bacteria 5004595
453 2585318601 2582581314 Bacteria 11452267
454 2619856532 2619618881 Bacteria 7521104
455 2620351767 2619619003 Bacteria 7619552
456 2623501665 2622736605 Bacteria 4992138
457 2626636197 2626541554 Bacteria 7741902
458 2644513497 2643221692 Bacteria 7282860
459 2671838989 2671180195 Bacteria 9757215
460 2676198155 2675902999 Bacteria 9438463
461 2676481197 2675903059 Bacteria 8644972
462 2676489114 2675903060 Bacteria 10051191
463 2686534017 2684623035 Bacteria 8032739
464 2686543288 2684623036 Bacteria 5199090
465 2689959583 2687453737 Bacteria 11203906
466 2689995452 2687453743 Bacteria 8361025
467 2710604483 2710264753 Bacteria 5455564
468 2731908334 2731639228 Bacteria 4187555
469 2739236611 2738543011 Bacteria 5731169
470 2739367003 2738543034 Bacteria 6084756
471 2753035574 2751185725 Bacteria 5740550
472 2753326400 2751185792 Bacteria 5739090
473 2768643186 2767802112 Bacteria 6465194
474 2774842733 2773857921 Bacteria 9435764
475 2774857145 2773857922 Bacteria 9757215
476 2774866359 2773857924 Bacteria 5256821
477 2774901145 2773857933 Bacteria 5818019
478 2785341327 2784746763 Bacteria 9783172
479 2831938437 2831935698 Bacteria 5963223
480 2856747643 2856741275 Bacteria 8096094
481 2862179079 2862178590 Bacteria 8583590
482 2862388764 2862382967 Bacteria 10317375
483 2862707087 2862705112 Bacteria 6563286
484 2863408482 2863404153 Bacteria 9672205
485 2867351070 2867346516 Bacteria 7608576
486 2873317099 2873314349 Bacteria 8512634
487 2884702760 2884693830 Bacteria 11273186
488 2889306097 2889300758 Bacteria 5690814
489 2891401143 2891395885 Bacteria 9251614
490 2891559856 2891554331 Bacteria 8812224
491 2891566065 2891562705 Bacteria 8039471
492 2895436452 2895427314 Bacteria 13147766
493 2895449075 2895442618 Bacteria 11027144
494 2895880870 2895880812 Bacteria 11255272
495 2904765904 2904765812 Bacteria 5369154
496 2904773605 2904770941 Bacteria 5580202
497 2908814897 2908811453 Bacteria 5478616
498 2919424205 2919420072 Bacteria 5390363
499 2919437211 2919432681 Bacteria 5390474
500 2922559441 2922554459 Bacteria 6683962
501 2939744227 2939743619 Bacteria 5762299
502 2956941705 2956939328 Bacteria 3474458
503 2974317933 2974315732 Bacteria 4602776
504 2984526148 2984523437 Bacteria 4508481
505 2990048630 2990044586 Bacteria 6603797
506 2990064505 2990059506 Bacteria 9321252
507 3001120922 3001119090 Bacteria 3449530
508 637881083 637000116 Bacteria 5433628
509 8002779727 8002775197 Bacteria 10728764
510 8002787295 8002784119 Bacteria 9788632
511 8008487801 8008485437 Bacteria 7198341
512 8008562653 8008558824 Bacteria 10610750
513 8025526680 8025524527 Bacteria 7197316
514 8048406588 8048406513 Bacteria 8936924
515 8054918232 8054913762 Bacteria 7713009
516 8054923622 8054920844 Bacteria 7068637
517 8055073401 8055066027 Bacteria 9479577
518 8055162551 8055157932 Bacteria 6429399
519 8055180216 8055172936 Bacteria 9305943
520 rootH2_10004437
521 Ga0055540_1003256
522 Ga0070658_10003877
523 Ga0070658_10100936
524 Ga0070676_10194978
525 Ga0070683_100223813
526 Ga0070683_100360286
527 Ga0070680_100000111
528 Ga0070680_100245654
529 Ga0070680_100265351
530 Ga0070682_100008817
531 Ga0070660_100193420
532 Ga0070668_100007123
533 Ga0070671_100032896
534 Ga0070667_100011952
535 Ga0070709_10052834
536 Ga0070709_10116912
537 Ga0070714_100000289
538 Ga0070714_100005386
539 Ga0070663_100327352
540 Ga0070681_10000299
541 Ga0070681_10396446
542 Ga0070685_10313904
543 Ga0070679_100000736
544 Ga0070679_100037493
545 Ga0070679_100125546
546 Ga0070684_100060081
547 Ga0070684_100084662
548 Ga0070665_100001822
549 Ga0068855_100017282
550 Ga0068857_100059264
551 Ga0068857_100124918
552 Ga0068856_100035710
553 Ga0068856_100407086
554 Ga0068852_100111085
555 Ga0068859_100000105
556 Ga0068859_100006462
557 Ga0068864_100010815
558 Ga0068863_100000344
559 Ga0068863_100012077
560 Ga0068863_100028032
561 Ga0068858_100003495
562 Ga0068860_100000067
563 Ga0068862_100000025
564 Ga0081455_10000958
565 Ga0081455_10075437
566 Ga0081540_1034747
567 Ga0081539_10004919
568 Ga0081539_10008651
569 Ga0081539_10027826
570 Ga0081539_10029654
571 Ga0070717_10206643
572 Ga0075363_100065146
573 Ga0075364_10001452
574 Ga0070712_100071861
575 Ga0075428_100002510
576 Ga0075428_100051472
577 Ga0075428_100124855
578 Ga0075428_100220938
579 Ga0075428_100467386
580 Ga0075430_100110487
581 Ga0075431_100015455
582 Ga0075429_100120606
583 Ga0097620_100000105
584 Ga0097620_100006462
585 Ga0105240_10012823
586 Ga0105240_10048986
587 Ga0105240_10111515
588 Ga0105240_10309115
589 Ga0111539_10370803
590 Ga0105245_10091844
591 Ga0105245_10239663
592 Ga0105247_10000057
593 Ga0105247_10059396
594 Ga0114129_10002822
595 Ga0114129_10295947
596 Ga0105243_10000724
597 Ga0105248_10001710
598 Ga0105248_10046012
599 Ga0105248_10052962
600 Ga0105238_10230194
601 Ga0105249_10011910
602 Ga0105249_10195247
603 Ga0105249_10201109
604 Ga0105239_10013686
605 Ga0157370_10046454
606 Ga0157369_10004740
607 Ga0157369_10006566
608 Ga0157369_10050567
609 Ga0157369_10073167
610 Ga0157378_10049368
611 Ga0163162_10276408
612 Ga0157372_10000339
613 Ga0157375_10070880
614 Ga0157375_10497700
615 Ga0157375_10511896
616 Ga0163163_10022459
617 Ga0163163_10234703
618 Ga0182008_10114450
619 Ga0157379_10015463
620 Ga0157379_10023190
621 Ga0163161_10127010
622 Ga0197907_10246913
623 Ga0206356_11156082
624 Ga0206354_10231370
625 Ga0206353_10206701
626 Ga0213876_10000552
627 Ga0224712_10008617
628 Ga0207710_10000011
629 Ga0207647_10058807
630 Ga0207705_10001286
631 Ga0207707_10000341
632 Ga0207695_10029050
633 Ga0207695_10177150
634 Ga0207693_10080526
635 Ga0207693_10096023
636 Ga0207660_10001783
637 Ga0207657_10084439
638 Ga0207657_10240018
639 Ga0207652_10000143
640 Ga0207652_10141528
641 Ga0207664_10000002
642 Ga0207664_10007418
643 Ga0207644_10015263
644 Ga0207709_10020203
645 Ga0207711_10000034
646 Ga0207711_10010363
647 Ga0207711_10052954
648 Ga0207711_10076322
649 Ga0207661_10128465
650 Ga0207661_10132921
651 Ga0207667_10043626
652 Ga0207667_10260513
653 Ga0207712_10008257
654 Ga0207658_10027156
655 Ga0207703_10009166
656 Ga0207678_10005217
657 Ga0207702_10024561
658 Ga0207702_10360302
659 Ga0207641_10002788
660 Ga0207641_10016880
661 Ga0207676_10058638
662 Ga0207674_10063152
663 Ga0207674_10128775
664 Ga0207698_10246097
665 Ga0268266_10027100
666 Ga0268265_10000017
667 Ga0268264_10000114
668 Ga0268264_10291608
669 Ga0307517_10000910
670 Ga0307517_10106389
671 Ga0307517_10151414
672 Ga0307515_10000065
673 Ga0307515_10013928
674 Ga0265327_10000019
675 Ga0265327_10000610
676 Ga0265327_10001706
677 Ga0307513_10068018
678 Ga0307509_10016707
679 Ga0307509_10198714
680 Ga0307508_10001866
681 Ga0307508_10050133
682 Ga0307508_10126464
683 Ga0316576_10009240
684 Ga0316576_10009949
685 Ga0316576_10079696
686 Ga0307516_10004273
687 Ga0307516_10025318
688 Ga0307405_10051734
689 Ga0307413_10050360
690 Ga0307413_10207366
691 Ga0307410_10162659
692 Ga0307410_10170052
693 Ga0307406_10017989
694 Ga0307406_10050457
695 Ga0307406_10083122
696 Ga0307406_10089437
697 Ga0307407_10023333
698 Ga0307407_10129611
699 Ga0307409_100018267
700 Ga0307409_100114554
701 Ga0307409_100250301
702 Ga0307416_100010387
703 Ga0307416_100019953
704 Ga0307416_100101568
705 Ga0307416_100118875
706 Ga0307414_10046850
707 Ga0307414_10203680
708 Ga0307414_10224321
709 Ga0307414_10225969
710 Ga0307414_10284612
711 Ga0307411_10038408
712 Ga0307411_10096111
713 Ga0307411_10106331
714 Ga0307415_100026351
715 Ga0307415_100054551
716 Ga0307415_100095926
717 Ga0307415_100108159
718 Ga0307507_10000020
719 Ga0307510_10057801
720 Ga0373960_0053873
721 Ga0316574_0006740
722 Ga0373947_0023593
723 Ga0316584_0126784
724 Ga0395899_0013079
725 Ga0395899_0095215
726 Ga0395900_0004313
727 Ga0395900_0007733
728 Ga0395900_0024436
729 Ga0395900_0087937
730 Ga0395900_0173213
731 Ga0395900_0342096
732 Ga0395898_0013021
733 Ga0395898_0087395
734 Ga0395898_0112011
735 Ga0395905_0003728
736 Ga0395901_0004087
737 Ga0395901_0006120
738 Ga0395901_0006468
739 Ga0395901_0055164
740 Ga0395901_0479999
741 Ga0436365_1603863
742 Ga0436365_1781586
743 Ga0439436_0001467
744 Ga0439436_0055646
745 Ga0439439_0011294
746 Ga0451791_1836731
747 Ga0451853_0299947
748 Ga0439433_0022385
749 Ga0439457_006958
750 Ga0450920_013794
751 Ga0450894_000764
752 Ga0450896_000588
753 Ga0450899_000143
754 Ga0450906_000766
755 Ga0466969_0003943
756 Ga0466969_0021661
757 Ga0466969_0162830
758 Ga0466965_0043148
759 Ga0466966_0022659
760 Ga0466966_0036867
761 Ga0466966_0084268
762 Ga0466961_0000215
763 Ga0466961_0004650
764 Ga0466961_0008619
765 Ga0466961_0018982
766 Ga0466961_0045562
767 Ga0466961_0082900
768 Ga0466961_0103153
769 Ga0466961_0109569
770 Ga0466961_0326146
771 Ga0466963_0011058
772 Ga0466963_0082635
773 Ga0466963_0088212
774 Ga0466963_0131103
775 Ga0466963_0138211
776 Ga0466963_0143076
777 Ga0466963_0168683
778 Ga0466963_0191944
779 Ga0466963_0219966
780 Ga0466963_0229829
781 Ga0466964_0043267
782 Ga0466971_0000053
783 Ga0466971_0000895
784 Ga0466971_0001960
785 Ga0466957_0043546
786 Ga0466957_0101439
787 Ga0466957_0184685
788 Ga0466960_0008621
789 Ga0466960_0040304
790 Ga0466959_0000672
791 Ga0466959_0002842
792 Ga0466959_0034944
793 Ga0466959_0036606
794 Ga0466959_0105666
795 Ga0466959_0227526
796 Ga0466958_0004754
797 Ga0466958_0010153
798 Ga0466958_0029444
799 Ga0466958_0058964
800 Ga0466967_0000899
801 Ga0466967_0006912
802 Ga0466967_0007198
803 Ga0466967_0166950
804 Ga0466967_0255838
805 Ga0466967_0294897
806 Ga0466967_0310265
807 Ga0466967_0556377
808 Ga0466967_0701600
809 Ga0495592_0028757
810 Ga0495603_0009852
811 Ga0495629_0044945
812 Ga0495629_0153148
813 Ga0495629_0230259
814 Ga0495641_0012759
815 Ga0495651_0000320
816 Ga0495651_0046716
817 Ga0495653_0019527
818 Ga0495662_0002463
819 Ga0495664_0079358
820 Ga0495594_0003940
821 Ga0495594_0005834
822 Ga0495594_0030310
823 Ga0495608_0001452
824 Ga0495608_0065594
825 Ga0495618_0054974
826 Ga0495628_0003783
827 Ga0495628_0055292
828 Ga0495643_0009480
829 Ga0495648_0017498
830 Ga0495666_0019900
831 Ga0495652_0062094
832 Ga0495665_0002887
833 Ga0495665_0045660
834 Ga0495640_0167902
835 Ga0495586_0006900
836 Ga0495645_0019064
837 Ga0495667_0004437
838 Ga0495656_0088409
839 Ga0495635_0002575
840 Ga0495588_0048357
841 Ga0495657_0012072
842 Ga0495623_0037466
843 Ga0495623_0097227
844 Ga0495646_0074696
845 Ga0495658_0035584
846 Ga0495613_0002174
847 Ga0495613_0135774
848 Ga0495670_0060652
849 Ga0495670_0204515
850 Ga0495589_0059989
851 Ga0495600_0003318
852 Ga0495581_0064138
853 Ga0495581_0121230
854 Ga0495604_0001708
855 Ga0495636_0013254
856 Ga0495674_0207327
857 Ga0495683_0007285
858 Ga0495683_0063845
859 Ga0495675_0023809
860 Ga0495679_024518
861 Ga0495685_024843
862 Ga0495685_080229
863 Ga0495684_0149125
864 Ga0495602_0027676
865 Ga0495614_0038618
866 Ga0496101_0235501
867 Ga0496101_0385725
868 Ga0496102_0028784
869 Ga0496104_0030429
870 Ga0496104_0148592
871 Ga0496105_0077277
872 Ga0496105_0174892
873 Ga0496105_0191417
874 Ga0496107_0353945
875 Ga0496108_0011268
876 Ga0496108_0019404
877 Ga0496109_0022864
878 Ga0496109_0444488
879 Ga0496110_0003656
880 Ga0496110_0113157
881 Ga0496112_0055710
882 Ga0496112_0184380
883 Ga0496113_0011739
884 Ga0496113_0012991
885 Ga0496113_0031996
886 Ga0496114_0028358
887 Ga0496114_0057180
888 Ga0496114_0118021
889 Ga0496114_0174199
890 Ga0496115_0416649
891 Ga0496116_0000202
892 Ga0496117_0019409
893 Ga0496117_0037091
894 Ga0496118_0003458
895 Ga0496118_0011923
896 Ga0496118_0043004
897 Ga0496119_0000886
898 Ga0496119_0023190
899 Ga0496120_0000072
900 Ga0496120_0066910
901 Ga0496121_0011421
902 Ga0496126_0105003
903 Ga0501032_0040796
904 Ga0501032_0123390
905 Ga0501032_0304591
906 Ga0501034_0107911
907 Ga0501034_0358354
908 Ga0501036_0489711
909 Ga0501039_0208069
910 Ga0501043_0070337
911 Ga0501047_0157074
912 Ga0501069_0010625
913 Ga0501070_0001163
914 Ga0501070_0012214
915 Ga0501070_0020672
916 Ga0501070_0026751
917 Ga0501072_0238027
918 Ga0501073_0048057
919 Ga0501073_0169793
920 Ga0501074_0015565
921 Ga0501074_0137827
922 Ga0501074_0265530
923 Ga0501079_0000971
924 Ga0501080_0000278
925 Ga0501080_0008725
926 Ga0501080_0038259
927 Ga0501080_0213563
928 Ga0501044_0018872
929 Ga0501044_0136491
930 Ga0501044_0221946
931 nmdc:mga00v17_8385_c1
932 nmdc:mga05p37_148441_c1
933 nmdc:mga05p37_2166_c1
934 nmdc:mga09592_534_c2
935 nmdc:mga0qj67_15_c3
936 nmdc:mga06r32_447_c1
937 nmdc:mga06r32_5309_c1
938 Ga0500610_0101991
939 Ga0495619_0028492
940 Ga0495619_0136863
941 Ga0500644_0051291
942 Ga0500646_0000256
943 Ga0500646_0007393
944 Ga0500583_0007015
945 Ga0500660_062353
946 Ga0500660_063592
947 Ga0500553_063602
948 Ga0500628_010833
949 Ga0500658_0003541
950 Ga0500561_0009492
951 Ga0500573_0118643
952 Ga0500588_0002124
953 Ga0500588_0039407
954 Ga0500604_0026332
955 Ga0500616_0016347
956 Ga0500634_0006481
957 Ga0466962_0004732
958 Ga0466962_0005010
959 Ga0466962_0006694
960 Ga0466962_0057712
961 Ga0466962_0116314
962 2579854798
963 2506865530
964 2508672444
965 2517760628
966 2523385823
967 2528205236
968 2528215326
969 2546950874
970 2552110163
971 2579750299
972 2585318601
973 2619856532
974 2620351767
975 2623501665
976 2626636197
977 2644513497
978 2671838989
979 2676198155
980 2676481197
981 2676489114
982 2686534017
983 2686543288
984 2689959583
985 2689995452
986 2710604483
987 2731908334
988 2739236611
989 2739367003
990 2753035574
991 2753326400
992 2768643186
993 2774842733
994 2774857145
995 2774866359
996 2774901145
997 2785341327
998 2831938437
999 2856747643
1000 2862179079
1001 2862388764
1002 2862707087
1003 2863408482
1004 2867351070
1005 2873317099
1006 2884702760
1007 2889306097
1008 2891401143
1009 2891559856
1010 2891566065
1011 2895436452
1012 2895449075
1013 2895880870
1014 2904765904
1015 2904773605
1016 2908814897
1017 2919424205
1018 2919437211
1019 2922559441
1020 2939744227
1021 2956941705
1022 2974317933
1023 2984526148
1024 2990048630
1025 2990064505
1026 3001120922
1027 637881083
1028 8002779727
1029 8002787295
1030 8008487801
1031 8008562653
1032 8025526680
1033 8048406588
1034 8054918232
1035 8054923622
1036 8055073401
1037 8055162551
1038 8055180216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

35

164

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv7-assembly1.cif.gz_A crystal structure of diacylglycerol kinase dgkb in complex with adp and mg 0.8616 4 322
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8605 7 321
2qvl-assembly1.cif.gz_A crystal structure of diacylglycerol kinase 0.8595 1 322
3t5p-assembly1.cif.gz_H crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8578 1 321
3t5p-assembly2.cif.gz_D crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8563 4 321
ID Description Score Start End Superfamily
af_O05848_2_128_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.918 7 125 3.40.50.10330
4werA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9038 6 132 3.40.50.10330
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8955 7 122 3.40.50.10330
3t5pC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8792 1 132 3.40.50.10330
af_Q75M00_1_125_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8728 43 81 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2S9FJE7-F1-model_v4 Diacylglycerol kinase 0.9591 7 124 GO:0004143
GO:0005886
AF-A0A3B9J0X7-F1-model_v4 Diacylglycerol kinase 0.9549 7 79 GO:0016301
AF-A0A5S4ZBP3-F1-model_v4 deleted 0.9538 7 125
AF-A0A537ZQH1-F1-model_v4 DAGKc domain-containing protein 0.9493 2 79 GO:0016301
AF-A0A838PKX8-F1-model_v4 Acylglycerol kinase family protein 0.9471 2 102 GO:0005886
GO:0016301

Map