metagRoot

F458522

General Info

Members	Datasets	Scaffolds	Average Seq Length
520	236	520	279

Family's Representative Sequence

Representative Sequence	3300006048\|Ga0075363_100084075\|Ga0075363_1000840752
Length	329
Sequence	MLRLLFLGDIIGEPGRRAVAEMLPGLKEAWEIDFVVVNGENSAAGRGITGKISIDLLRAGVAVITTGDHIWDQKELMGYIDTEPRLLRPINYPPETPGRGSIVLETAKGKIGVINVQGRTFMQPSLENPFLTIDEEVRRMRDETRMIFVDVHAETTSEKIAMGRFLEGRVSAVAGTHTHVQTADEQIFPGGTAFICDVGMCGPTESVLGREIQPIVQRFLTSMPVNFPVAKGEVKLHGLLVDIDEITGKALAVRRVAEPHVVVTEVVPATHPVDTGRTNNGEESPTDDSPQGCDENGPSARRAFLNLDTHASKSPNLHLFQRQRTDSSG

Samples

	Sample ID	Description	Type	Environment
1	2162886006	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
4	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
5	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
6	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
7	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
17	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
22	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
25	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
30	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
33	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
34	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
35	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
36	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
37	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
38	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
39	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
40	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
41	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
42	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
43	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
44	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
45	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
46	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
47	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
48	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
49	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
50	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
51	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
52	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
53	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
54	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
55	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
56	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
57	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
58	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
59	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
60	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
61	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
64	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
65	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
66	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
67	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
68	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
69	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
70	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
71	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
72	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
73	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
74	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
75	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
76	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
81	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
82	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
83	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
84	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
87	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
88	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
90	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
91	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
92	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
93	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
94	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
101	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
102	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
103	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
104	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
105	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
106	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
107	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
109	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
160	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
161	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
162	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
163	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
164	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
165	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
166	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
167	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
168	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
169	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
170	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
172	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
173	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
174	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
175	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
176	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
177	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
178	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
179	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
180	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
181	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
182	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
183	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
184	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
185	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
186	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
187	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
188	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
189	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
190	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
191	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
192	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
193	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
194	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
195	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
196	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
197	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
198	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
199	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
200	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
201	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
202	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
203	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
204	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
205	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
206	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
207	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
208	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
209	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
210	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
211	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
212	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
213	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
214	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
215	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
216	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
217	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
218	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
219	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
220	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
221	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
222	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
223	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
224	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
225	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
226	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
227	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
228	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
229	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
230	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
231	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
232	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
233	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
234	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
235	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
236	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.73
Nodule	0
Rhizoplane	6.35
Rhizosphere	89.23
Stem	0
Stem Tuber	0
Unclassified	2.69

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL3b_contig_4380819	2162886006	Bacteria	1937
2	SwRhRL2b_contig_2151885	2162886007	Bacteria	1715
3	JGI24035J26624_1003117	3300002126	Bacteria	1552
4	JGI24035J26624_1003841	3300002126	Bacteria	1423
5	JGI25406J46586_10019826	3300003203	Bacteria	2732
6	rootH2_10235358	3300003320	Bacteria	1455
7	Ga0065712_10068408	3300005290	Bacteria	10865
8	Ga0065715_10012001	3300005293	Bacteria	2492
9	Ga0065715_10089033	3300005293	Bacteria	16097
10	Ga0065715_10090541	3300005293	Bacteria	6844
11	Ga0065715_10104106	3300005293	Bacteria	2951
12	Ga0070676_10022662	3300005328	Bacteria	3524
13	Ga0070676_10090780	3300005328	Bacteria	1871
14	Ga0070676_10204616	3300005328	Bacteria	1296
15	Ga0070676_10248508	3300005328	Unclassified	1186
16	Ga0070683_100013177	3300005329	Bacteria	7200
17	Ga0070683_100069616	3300005329	Bacteria	3281
18	Ga0070683_100319148	3300005329	Bacteria	1478
19	Ga0070690_100114820	3300005330	Bacteria	1801
20	Ga0070670_100028784	3300005331	Unclassified	4783
21	Ga0070670_100054332	3300005331	Unclassified	3438
22	Ga0068869_100188639	3300005334	Bacteria	1620
23	Ga0070666_10111900	3300005335	Bacteria	1888
24	Ga0070682_100109433	3300005337	Bacteria	1839
25	Ga0068868_100113358	3300005338	Bacteria	2205
26	Ga0068868_100163589	3300005338	Bacteria	1839
27	Ga0070660_100340563	3300005339	Bacteria	1234
28	Ga0070689_100123988	3300005340	Bacteria	2066
29	Ga0070689_100360973	3300005340	Bacteria	1221
30	Ga0070687_100053932	3300005343	Bacteria	2093
31	Ga0070661_100375641	3300005344	Bacteria	1120
32	Ga0070668_100113119	3300005347	Bacteria	2162
33	Ga0070668_100354465	3300005347	Bacteria	1243
34	Ga0070669_100107187	3300005353	Bacteria	2116
35	Ga0070669_100301077	3300005353	Bacteria	1290
36	Ga0070669_100334613	3300005353	Unclassified	1225
37	Ga0070675_100020188	3300005354	Bacteria	5317
38	Ga0070675_100021369	3300005354	Bacteria	5172
39	Ga0070675_100079034	3300005354	Unclassified	2740
40	Ga0070675_100139759	3300005354	Bacteria	2069
41	Ga0070675_100160978	3300005354	Bacteria	1930
42	Ga0070675_100283623	3300005354	Bacteria	1456
43	Ga0070671_100004271	3300005355	Bacteria	11305
44	Ga0070671_100016653	3300005355	Bacteria	5943
45	Ga0070671_100039549	3300005355	Bacteria	3914
46	Ga0070671_100041937	3300005355	Bacteria	3804
47	Ga0070671_100115666	3300005355	Bacteria	2255
48	Ga0070671_100196415	3300005355	Bacteria	1710
49	Ga0070674_100004495	3300005356	Bacteria	7958
50	Ga0070674_100021814	3300005356	Bacteria	4120
51	Ga0070674_100068365	3300005356	Bacteria	2502
52	Ga0070674_100083832	3300005356	Bacteria	2284
53	Ga0070673_100015043	3300005364	Bacteria	5416
54	Ga0070673_100033078	3300005364	Bacteria	3899
55	Ga0070688_100011468	3300005365	Bacteria	4925
56	Ga0070688_100030422	3300005365	Unclassified	3241
57	Ga0070659_100020105	3300005366	Bacteria	5070
58	Ga0070667_100020154	3300005367	Bacteria	5537
59	Ga0070667_100044438	3300005367	Bacteria	3731
60	Ga0070709_10010076	3300005434	Bacteria	5224
61	Ga0070714_100038493	3300005435	Bacteria	4020
62	Ga0070711_100008424	3300005439	Bacteria	6316
63	Ga0070711_100053720	3300005439	Bacteria	2777
64	Ga0070711_100069022	3300005439	Bacteria	2486
65	Ga0070705_100003907	3300005440	Bacteria	7287
66	Ga0070700_100072626	3300005441	Bacteria	2200
67	Ga0070694_100193699	3300005444	Bacteria	1511
68	Ga0070708_100021566	3300005445	Bacteria	5450
69	Ga0070708_100030326	3300005445	Bacteria	4674
70	Ga0070708_100126700	3300005445	Bacteria	2361
71	Ga0070708_100166940	3300005445	Unclassified	2053
72	Ga0070708_100298257	3300005445	Unclassified	1517
73	Ga0070663_100032562	3300005455	Bacteria	3594
74	Ga0070663_100086055	3300005455	Bacteria	2321
75	Ga0070678_100172131	3300005456	Bacteria	1765
76	Ga0070678_100236148	3300005456	Bacteria	1526
77	Ga0070678_100237335	3300005456	Unclassified	1523
78	Ga0070662_100085547	3300005457	Bacteria	2357
79	Ga0070681_10231693	3300005458	Bacteria	1761
80	Ga0068867_100074230	3300005459	Unclassified	2549
81	Ga0068867_100488592	3300005459	Bacteria	1056
82	Ga0070685_10088439	3300005466	Bacteria	1871
83	Ga0070706_100000035	3300005467	Bacteria	152107
84	Ga0070706_100002580	3300005467	Bacteria	18211
85	Ga0070706_100004157	3300005467	Bacteria	14075
86	Ga0070706_100032094	3300005467	Bacteria	4844
87	Ga0070706_100055603	3300005467	Bacteria	3653
88	Ga0070706_100090542	3300005467	Bacteria	2837
89	Ga0070706_100102866	3300005467	Bacteria	2656
90	Ga0070707_100001740	3300005468	Bacteria	20969
91	Ga0070707_100007728	3300005468	Bacteria	9989
92	Ga0070707_100015818	3300005468	Bacteria	7083
93	Ga0070707_100049512	3300005468	Unclassified	4028
94	Ga0070707_100078309	3300005468	Unclassified	3189
95	Ga0070707_100169356	3300005468	Bacteria	2129
96	Ga0070707_100221608	3300005468	Bacteria	1842
97	Ga0070707_100296713	3300005468	Unclassified	1570
98	Ga0070707_100312668	3300005468	Bacteria	1527
99	Ga0070707_100402026	3300005468	Bacteria	1330
100	Ga0070698_100000732	3300005471	Bacteria	35269
101	Ga0070698_100010668	3300005471	Bacteria	9788
102	Ga0070698_100049206	3300005471	Bacteria	4304
103	Ga0070698_100070521	3300005471	Bacteria	3506
104	Ga0070699_100042178	3300005518	Bacteria	3948
105	Ga0070699_100052031	3300005518	Bacteria	3546
106	Ga0070699_100057013	3300005518	Bacteria	3383
107	Ga0070699_100158089	3300005518	Unclassified	2005
108	Ga0070699_100158858	3300005518	Bacteria	2000
109	Ga0070699_100239810	3300005518	Bacteria	1618
110	Ga0070679_100069537	3300005530	Bacteria	3511
111	Ga0070684_100026781	3300005535	Bacteria	4860
112	Ga0070697_100005705	3300005536	Bacteria	9588
113	Ga0070697_100012378	3300005536	Bacteria	6684
114	Ga0070697_100022754	3300005536	Bacteria	4980
115	Ga0070697_100057036	3300005536	Bacteria	3178
116	Ga0070697_100183997	3300005536	Bacteria	1772
117	Ga0070697_100216250	3300005536	Bacteria	1632
118	Ga0070697_100224732	3300005536	Unclassified	1600
119	Ga0070697_100417512	3300005536	Unclassified	1166
120	Ga0070697_100568435	3300005536	Bacteria	995
121	Ga0068853_100000012	3300005539	Bacteria	228770
122	Ga0070672_100019475	3300005543	Bacteria	4926
123	Ga0070686_100069155	3300005544	Bacteria	2305
124	Ga0070695_100184367	3300005545	Bacteria	1481
125	Ga0070695_100290075	3300005545	Bacteria	1206
126	Ga0070693_100406627	3300005547	Unclassified	945
127	Ga0070665_100025077	3300005548	Bacteria	6010
128	Ga0070665_100298580	3300005548	Bacteria	1613
129	Ga0070704_100007443	3300005549	Bacteria	6523
130	Ga0070664_100060943	3300005564	Bacteria	3214
131	Ga0070664_100271492	3300005564	Bacteria	1528
132	Ga0070664_100348881	3300005564	Bacteria	1346
133	Ga0068856_100077503	3300005614	Bacteria	3293
134	Ga0070702_100045738	3300005615	Bacteria	2478
135	Ga0068852_100113197	3300005616	Bacteria	2471
136	Ga0068864_100061025	3300005618	Bacteria	3265
137	Ga0068866_10135681	3300005718	Unclassified	1406
138	Ga0068861_100377991	3300005719	Bacteria	1251
139	Ga0068863_100007852	3300005841	Bacteria	10434
140	Ga0068863_100344513	3300005841	Bacteria	1450
141	Ga0068858_100035942	3300005842	Bacteria	4594
142	Ga0068858_100232883	3300005842	Bacteria	1746
143	Ga0068860_100002169	3300005843	Bacteria	20676
144	Ga0068860_100052268	3300005843	Bacteria	3887
145	Ga0068860_100089425	3300005843	Bacteria	2932
146	Ga0068860_100833972	3300005843	Unclassified	936
147	Ga0068862_100155480	3300005844	Bacteria	2038
148	Ga0081455_10004605	3300005937	Bacteria	15400
149	Ga0081455_10023501	3300005937	Bacteria	5733
150	Ga0081455_10024366	3300005937	Bacteria	5605
151	Ga0081455_10055884	3300005937	Bacteria	3355
152	Ga0081455_10088244	3300005937	Bacteria	2521
153	Ga0081540_1000018	3300005983	Bacteria	164931
154	Ga0081539_10000052	3300005985	Bacteria	268240
155	Ga0081539_10075450	3300005985	Unclassified	1791
156	Ga0081539_10075579	3300005985	Bacteria	1789
157	Ga0070717_10015256	3300006028	Bacteria	5929
158	Ga0070717_10017681	3300006028	Bacteria	5552
159	Ga0070717_10024883	3300006028	Bacteria	4756
160	Ga0070717_10030036	3300006028	Bacteria	4365
161	Ga0070717_10118280	3300006028	Bacteria	2268
162	Ga0070717_10214465	3300006028	Unclassified	1690
163	Ga0070717_10285178	3300006028	Bacteria	1465
164	Ga0075363_100084075	3300006048	Bacteria	1744
165	Ga0070715_10046629	3300006163	Bacteria	1843
166	Ga0070716_100076952	3300006173	Bacteria	1979
167	Ga0070712_100110243	3300006175	Bacteria	2052
168	Ga0070712_100279235	3300006175	Bacteria	1345
169	Ga0070712_100338327	3300006175	Unclassified	1228
170	Ga0075362_10004823	3300006177	Bacteria	4868
171	Ga0075366_10086151	3300006195	Bacteria	1879
172	Ga0097621_100086966	3300006237	Bacteria	2609
173	Ga0097621_100317713	3300006237	Bacteria	1379
174	Ga0097621_100486109	3300006237	Unclassified	1116
175	Ga0068871_100007276	3300006358	Bacteria	7896
176	Ga0068871_100010040	3300006358	Bacteria	6885
177	Ga0075428_100116523	3300006844	Bacteria	2910
178	Ga0075433_10642319	3300006852	Bacteria	931
179	Ga0075434_100273078	3300006871	Bacteria	1710
180	Ga0075436_100011369	3300006914	Bacteria	6111
181	Ga0075436_100303866	3300006914	Bacteria	1144
182	Ga0075435_100145178	3300007076	Bacteria	1993
183	Ga0105240_10000043	3300009093	Bacteria	254256
184	Ga0105240_10316844	3300009093	Bacteria	1779
185	Ga0111539_10448962	3300009094	Bacteria	1501
186	Ga0111539_10537689	3300009094	Bacteria	1361
187	Ga0105245_10043951	3300009098	Unclassified	3986
188	Ga0105247_10166882	3300009101	Bacteria	1461
189	Ga0114129_10010037	3300009147	Bacteria	13498
190	Ga0105249_10142545	3300009553	Bacteria	2299
191	Ga0099796_10011641	3300010159	Bacteria	2460
192	Ga0099796_10015935	3300010159	Unclassified	2209
193	Ga0099796_10033131	3300010159	Bacteria	1698
194	Ga0105239_10059125	3300010375	Bacteria	4207
195	Ga0105239_10169758	3300010375	Bacteria	2439
196	Ga0105239_10217306	3300010375	Bacteria	2143
197	Ga0105239_10513195	3300010375	Bacteria	1363
198	Ga0157371_10037492	3300013102	Bacteria	3469
199	Ga0157371_10077218	3300013102	Bacteria	2358
200	Ga0157369_10022226	3300013105	Bacteria	7084
201	Ga0157374_10000059	3300013296	Bacteria	116409
202	Ga0157374_10005835	3300013296	Bacteria	10404
203	Ga0157374_10079502	3300013296	Bacteria	3108
204	Ga0157374_10080215	3300013296	Unclassified	3094
205	Ga0157374_10220913	3300013296	Bacteria	1859
206	Ga0157374_10271104	3300013296	Bacteria	1673
207	Ga0157374_10275658	3300013296	Bacteria	1659
208	Ga0157374_10285377	3300013296	Unclassified	1630
209	Ga0157378_10008025	3300013297	Bacteria	9216
210	Ga0157378_10013750	3300013297	Bacteria	7079
211	Ga0157378_10045474	3300013297	Unclassified	3901
212	Ga0157378_10055922	3300013297	Bacteria	3516
213	Ga0157378_10079190	3300013297	Unclassified	2966
214	Ga0157378_10084520	3300013297	Bacteria	2874
215	Ga0157378_10095219	3300013297	Unclassified	2712
216	Ga0157378_10219401	3300013297	Bacteria	1807
217	Ga0157378_10896050	3300013297	Unclassified	917
218	Ga0163162_10009133	3300013306	Bacteria	9642
219	Ga0163162_10014878	3300013306	Bacteria	7598
220	Ga0163162_10020371	3300013306	Bacteria	6516
221	Ga0163162_10063861	3300013306	Unclassified	3726
222	Ga0163162_10066505	3300013306	Bacteria	3653
223	Ga0163162_10339843	3300013306	Bacteria	1634
224	Ga0157372_10039614	3300013307	Bacteria	5201
225	Ga0157372_10566100	3300013307	Bacteria	1325
226	Ga0157375_10022497	3300013308	Bacteria	5802
227	Ga0157375_10078089	3300013308	Bacteria	3342
228	Ga0157375_10141809	3300013308	Unclassified	2530
229	Ga0157375_10152262	3300013308	Bacteria	2449
230	Ga0157375_10249996	3300013308	Bacteria	1934
231	Ga0163163_10068453	3300014325	Bacteria	3532
232	Ga0163163_10088694	3300014325	Bacteria	3104
233	Ga0163163_10136167	3300014325	Bacteria	2497
234	Ga0163163_10231246	3300014325	Bacteria	1898
235	Ga0163163_10315513	3300014325	Unclassified	1617
236	Ga0163163_10382053	3300014325	Bacteria	1466
237	Ga0157379_10073005	3300014968	Bacteria	3071
238	Ga0157376_10052631	3300014969	Bacteria	3386
239	Ga0157376_10089775	3300014969	Bacteria	2658
240	Ga0157376_10096074	3300014969	Unclassified	2578
241	Ga0157376_10194858	3300014969	Bacteria	1860
242	Ga0182005_1024284	3300015265	Bacteria	1656
243	Ga0213872_10038979	3300021361	Bacteria	2169
244	Ga0213872_10106244	3300021361	Bacteria	1249
245	Ga0213872_10107496	3300021361	Bacteria	1240
246	Ga0213874_10038824	3300021377	Unclassified	1415
247	Ga0213876_10024479	3300021384	Bacteria	3187
248	Ga0213876_10036263	3300021384	Bacteria	2601
249	Ga0213871_10025265	3300021441	Bacteria	1511
250	Ga0213871_10038566	3300021441	Bacteria	1276
251	Ga0207666_1001009	3300025271	Bacteria	3343
252	Ga0207673_1000545	3300025290	Bacteria	4006
253	Ga0207673_1000692	3300025290	Bacteria	3595
254	Ga0207697_10000337	3300025315	Bacteria	26165
255	Ga0207697_10003599	3300025315	Bacteria	7605
256	Ga0207697_10003976	3300025315	Bacteria	7171
257	Ga0207697_10011356	3300025315	Bacteria	3768
258	Ga0207697_10011641	3300025315	Unclassified	3714
259	Ga0207697_10017738	3300025315	Bacteria	2925
260	Ga0207697_10021911	3300025315	Bacteria	2618
261	Ga0207697_10028587	3300025315	Bacteria	2280
262	Ga0207653_10013151	3300025885	Bacteria	2590
263	Ga0207653_10021869	3300025885	Bacteria	2030
264	Ga0207682_10036200	3300025893	Unclassified	1997
265	Ga0207692_10023160	3300025898	Bacteria	2868
266	Ga0207642_10082072	3300025899	Bacteria	1569
267	Ga0207688_10003691	3300025901	Bacteria	8366
268	Ga0207680_10071164	3300025903	Bacteria	2155
269	Ga0207647_10022346	3300025904	Bacteria	4202
270	Ga0207647_10140147	3300025904	Bacteria	1417
271	Ga0207699_10044441	3300025906	Bacteria	2586
272	Ga0207645_10008167	3300025907	Bacteria	7330
273	Ga0207645_10013361	3300025907	Bacteria	5536
274	Ga0207645_10089461	3300025907	Unclassified	1980
275	Ga0207645_10230628	3300025907	Bacteria	1222
276	Ga0207705_10010182	3300025909	Bacteria	6840
277	Ga0207705_10080818	3300025909	Bacteria	2369
278	Ga0207684_10000043	3300025910	Bacteria	259939
279	Ga0207684_10005045	3300025910	Bacteria	12304
280	Ga0207684_10027326	3300025910	Bacteria	4863
281	Ga0207684_10027522	3300025910	Bacteria	4843
282	Ga0207684_10032316	3300025910	Bacteria	4451
283	Ga0207684_10057695	3300025910	Unclassified	3294
284	Ga0207684_10084218	3300025910	Bacteria	2708
285	Ga0207684_10086934	3300025910	Bacteria	2663
286	Ga0207684_10105672	3300025910	Bacteria	2408
287	Ga0207684_10132505	3300025910	Bacteria	2139
288	Ga0207684_10153928	3300025910	Unclassified	1979
289	Ga0207684_10465094	3300025910	Unclassified	1085
290	Ga0207695_10000181	3300025913	Bacteria	185042
291	Ga0207693_10002399	3300025915	Bacteria	16263
292	Ga0207693_10007118	3300025915	Bacteria	9227
293	Ga0207693_10062793	3300025915	Bacteria	2910
294	Ga0207693_10099152	3300025915	Bacteria	2284
295	Ga0207693_10394230	3300025915	Unclassified	1082
296	Ga0207663_10090453	3300025916	Bacteria	2029
297	Ga0207662_10080305	3300025918	Bacteria	1989
298	Ga0207649_10137512	3300025920	Bacteria	1668
299	Ga0207646_10001979	3300025922	Bacteria	24592
300	Ga0207646_10002145	3300025922	Bacteria	23583
301	Ga0207646_10027642	3300025922	Bacteria	5171
302	Ga0207646_10041019	3300025922	Bacteria	4162
303	Ga0207646_10050265	3300025922	Bacteria	3731
304	Ga0207646_10107610	3300025922	Bacteria	2501
305	Ga0207646_10110803	3300025922	Unclassified	2463
306	Ga0207646_10121273	3300025922	Bacteria	2349
307	Ga0207646_10149476	3300025922	Bacteria	2106
308	Ga0207646_10177735	3300025922	Bacteria	1922
309	Ga0207646_10184180	3300025922	Unclassified	1886
310	Ga0207646_10235484	3300025922	Unclassified	1654
311	Ga0207681_10024067	3300025923	Bacteria	3904
312	Ga0207681_10506057	3300025923	Unclassified	989
313	Ga0207650_10105416	3300025925	Unclassified	2176
314	Ga0207659_10061951	3300025926	Bacteria	2698
315	Ga0207659_10125675	3300025926	Bacteria	1972
316	Ga0207659_10145509	3300025926	Bacteria	1845
317	Ga0207700_10094542	3300025928	Bacteria	2369
318	Ga0207700_10137832	3300025928	Bacteria	2001
319	Ga0207700_10166638	3300025928	Unclassified	1834
320	Ga0207644_10021116	3300025931	Unclassified	4433
321	Ga0207644_10112877	3300025931	Bacteria	2057
322	Ga0207644_10115976	3300025931	Bacteria	2032
323	Ga0207644_10133823	3300025931	Unclassified	1901
324	Ga0207644_10201534	3300025931	Bacteria	1570
325	Ga0207690_10033086	3300025932	Bacteria	3322
326	Ga0207706_10026724	3300025933	Bacteria	5167
327	Ga0207706_10075167	3300025933	Bacteria	2971
328	Ga0207706_10098803	3300025933	Bacteria	2568
329	Ga0207670_10012113	3300025936	Bacteria	5032
330	Ga0207670_10038569	3300025936	Unclassified	3121
331	Ga0207670_10080154	3300025936	Bacteria	2281
332	Ga0207669_10030578	3300025937	Bacteria	2994
333	Ga0207669_10072268	3300025937	Unclassified	2171
334	Ga0207704_10192023	3300025938	Unclassified	1486
335	Ga0207704_10234403	3300025938	Bacteria	1367
336	Ga0207665_10008481	3300025939	Bacteria	6768
337	Ga0207665_10028236	3300025939	Bacteria	3706
338	Ga0207665_10074216	3300025939	Bacteria	2328
339	Ga0207665_10151278	3300025939	Bacteria	1662
340	Ga0207691_10002283	3300025940	Bacteria	18765
341	Ga0207691_10007180	3300025940	Bacteria	10747
342	Ga0207691_10012683	3300025940	Bacteria	8073
343	Ga0207691_10059318	3300025940	Bacteria	3480
344	Ga0207661_10031734	3300025944	Bacteria	4085
345	Ga0207661_10046233	3300025944	Bacteria	3451
346	Ga0207679_10254232	3300025945	Bacteria	1495
347	Ga0207679_10318347	3300025945	Bacteria	1346
348	Ga0207651_10003656	3300025960	Bacteria	7590
349	Ga0207651_10006112	3300025960	Bacteria	6258
350	Ga0207651_10060214	3300025960	Bacteria	2635
351	Ga0207651_10095081	3300025960	Bacteria	2193
352	Ga0207651_10214791	3300025960	Bacteria	1551
353	Ga0207712_10027858	3300025961	Bacteria	3775
354	Ga0207668_10119343	3300025972	Bacteria	1994
355	Ga0207640_10158611	3300025981	Bacteria	1671
356	Ga0207658_10010884	3300025986	Bacteria	6191
357	Ga0207658_10098842	3300025986	Unclassified	2281
358	Ga0207658_10102454	3300025986	Bacteria	2245
359	Ga0207658_10193009	3300025986	Bacteria	1695
360	Ga0207677_10352843	3300026023	Unclassified	1233
361	Ga0207677_10376060	3300026023	Bacteria	1198
362	Ga0207703_10051997	3300026035	Bacteria	3324
363	Ga0207703_10112041	3300026035	Bacteria	2330
364	Ga0207639_10000017	3300026041	Bacteria	256177
365	Ga0207678_10018450	3300026067	Bacteria	6127
366	Ga0207708_10003672	3300026075	Bacteria	11335
367	Ga0207641_10024418	3300026088	Bacteria	4983
368	Ga0207641_10093197	3300026088	Bacteria	2640
369	Ga0207648_10229849	3300026089	Unclassified	1650
370	Ga0207676_10171951	3300026095	Bacteria	1889
371	Ga0207675_100430796	3300026118	Bacteria	1304
372	Ga0207683_10015360	3300026121	Bacteria	6520
373	Ga0207683_10017265	3300026121	Bacteria	6147
374	Ga0207683_10026147	3300026121	Bacteria	5038
375	Ga0207683_10039292	3300026121	Bacteria	4128
376	Ga0207683_10049808	3300026121	Bacteria	3668
377	Ga0207683_10111185	3300026121	Bacteria	2453
378	Ga0268266_10016163	3300028379	Bacteria	6382
379	Ga0268266_10016468	3300028379	Bacteria	6319
380	Ga0268266_10018759	3300028379	Bacteria	5893
381	Ga0268266_10064412	3300028379	Unclassified	3166
382	Ga0268266_10079067	3300028379	Bacteria	2863
383	Ga0268266_10210714	3300028379	Bacteria	1782
384	Ga0268265_10093360	3300028380	Bacteria	2411
385	Ga0268264_10001609	3300028381	Bacteria	20890
386	Ga0268264_10578817	3300028381	Bacteria	1104
387	Ga0265328_10006742	3300031239	Bacteria	4833
388	Ga0265316_10134739	3300031344	Bacteria	1859
389	Ga0265314_10000020	3300031711	Bacteria	307052
390	Ga0373943_0032552	3300035170	Bacteria	2479
391	Ga0373943_0067536	3300035170	Bacteria	1803
392	Ga0373943_0153251	3300035170	Bacteria	1250
393	Ga0373946_0088892	3300035171	Bacteria	1366
394	Ga0373955_0161269	3300035172	Unclassified	1324
395	Ga0373955_0273616	3300035172	Bacteria	1015
396	Ga0373931_0091597	3300035691	Unclassified	1695
397	Ga0373931_0093386	3300035691	Bacteria	1680
398	Ga0373931_0167891	3300035691	Bacteria	1291
399	Ga0373935_0188621	3300035692	Bacteria	1419
400	Ga0373927_0107215	3300035695	Bacteria	1820
401	Ga0373927_0263303	3300035695	Bacteria	1134
402	Ga0373927_0342463	3300035695	Bacteria	985
403	Ga0373947_0114711	3300035725	Bacteria	1706
404	Ga0373937_0287381	3300036401	Bacteria	1553
405	Ga0373937_0373219	3300036401	Unclassified	1352
406	Ga0373925_0094942	3300037068	Bacteria	2284
407	Ga0373925_0105469	3300037068	Unclassified	2172
408	Ga0373925_0185087	3300037068	Bacteria	1651
409	Ga0395900_0110389	3300037418	Unclassified	2825
410	Ga0395898_0006727	3300037466	Bacteria	12258
411	Ga0395898_0097481	3300037466	Unclassified	2824
412	Ga0395905_0112347	3300037471	Bacteria	2559
413	Ga0395905_0236071	3300037471	Unclassified	1709
414	Ga0395905_0540875	3300037471	Unclassified	1066
415	Ga0436364_0001908	3300037853	Bacteria	3522
416	Ga0436364_0784346	3300037853	Bacteria	2536
417	Ga0436364_1317185	3300037853	Bacteria	2273
418	Ga0395901_0009988	3300038443	Bacteria	9619
419	Ga0395901_0179629	3300038443	Unclassified	2219
420	Ga0395901_0243737	3300038443	Bacteria	1874
421	Ga0436365_0274631	3300039437	Bacteria	71187
422	Ga0436365_0292643	3300039437	Bacteria	6395
423	Ga0436365_0511548	3300039437	Unclassified	1260
424	Ga0436365_0774305	3300039437	Bacteria	92788
425	Ga0436365_1153529	3300039437	Bacteria	6997
426	Ga0436360_0064177	3300039438	Bacteria	2548
427	Ga0436360_0181157	3300039438	Bacteria	999
428	Ga0436360_0890065	3300039438	Bacteria	1495
429	Ga0436360_0999617	3300039438	Bacteria	4105
430	Ga0436361_0219401	3300039447	Bacteria	3049
431	Ga0436361_0444714	3300039447	Bacteria	20038
432	Ga0436361_0536230	3300039447	Bacteria	2142
433	Ga0436361_0654100	3300039447	Bacteria	6430
434	Ga0436361_0809872	3300039447	Bacteria	2053
435	Ga0436361_0874588	3300039447	Bacteria	2848
436	Ga0436361_0971942	3300039447	Bacteria	1225
437	Ga0436363_0064540	3300039450	Bacteria	9122
438	Ga0436363_0329569	3300039450	Bacteria	6490
439	Ga0436362_0603905	3300039453	Bacteria	5971
440	Ga0439455_0015001	3300042012	Bacteria	1777
441	Ga0451576_0507658	3300045051	Bacteria	1267
442	Ga0495629_0096243	3300046459	Bacteria	2065
443	Ga0495651_0272146	3300046462	Unclassified	1148
444	Ga0495580_0210503	3300046472	Unclassified	1338
445	Ga0495582_0231902	3300046473	Unclassified	1057
446	Ga0495664_0257143	3300046477	Bacteria	1056
447	Ga0495628_0227629	3300046516	Bacteria	1398
448	Ga0495630_0140410	3300046517	Unclassified	1837
449	Ga0495630_0182057	3300046517	Bacteria	1602
450	Ga0495644_0049052	3300046523	Bacteria	1586
451	Ga0495642_0032015	3300046528	Bacteria	2109
452	Ga0495652_0077079	3300046529	Bacteria	2764
453	Ga0495652_0214261	3300046529	Bacteria	1451
454	Ga0495640_0262508	3300046533	Unclassified	1079
455	Ga0495586_0113849	3300046535	Bacteria	1507
456	Ga0495587_0073323	3300046536	Unclassified	1989
457	Ga0495587_0211389	3300046536	Bacteria	1095
458	Ga0495645_0170602	3300046543	Unclassified	1498
459	Ga0495634_0034465	3300046642	Bacteria	3474
460	Ga0495659_0007145	3300046664	Bacteria	3535
461	Ga0495661_0089556	3300046665	Bacteria	1754
462	Ga0495623_0011180	3300046679	Bacteria	5807
463	Ga0495658_0013423	3300046683	Bacteria	4170
464	Ga0495658_0154816	3300046683	Bacteria	1410
465	Ga0495669_0004171	3300046684	Bacteria	5944
466	Ga0495669_0095637	3300046684	Bacteria	1376
467	Ga0495613_0068710	3300046689	Bacteria	2584
468	Ga0495674_0376771	3300047319	Unclassified	1149
469	Ga0495676_0033751	3300047321	Bacteria	4303
470	Ga0495680_0349844	3300047322	Bacteria	1029
471	Ga0495675_0073979	3300047444	Bacteria	2148
472	Ga0495602_0214849	3300048088	Bacteria	1456
473	Ga0496100_0105732	3300048903	Unclassified	1947
474	Ga0496100_0270407	3300048903	Bacteria	1263
475	Ga0496100_0428128	3300048903	Bacteria	1012
476	Ga0496100_0458561	3300048903	Bacteria	978
477	Ga0496101_0017167	3300048904	Bacteria	4905
478	Ga0496102_0099378	3300048905	Bacteria	2701
479	Ga0496102_0208232	3300048905	Bacteria	1844
480	Ga0496102_0428965	3300048905	Bacteria	1241
481	Ga0496102_0626484	3300048905	Unclassified	999
482	Ga0496104_0234103	3300048907	Unclassified	1749
483	Ga0496105_0077918	3300048908	Bacteria	2737
484	Ga0496106_0088840	3300048909	Bacteria	2383
485	Ga0496107_0067905	3300048910	Bacteria	2587
486	Ga0496108_0133259	3300048911	Bacteria	2136
487	Ga0496108_0358870	3300048911	Bacteria	1272
488	Ga0496109_0070848	3300048912	Bacteria	3200
489	Ga0496109_0286023	3300048912	Bacteria	1554
490	Ga0496109_0308522	3300048912	Bacteria	1493
491	Ga0496109_0335444	3300048912	Bacteria	1428
492	Ga0496109_0357789	3300048912	Bacteria	1379
493	Ga0496110_0063577	3300048913	Bacteria	3261
494	Ga0496110_0232728	3300048913	Bacteria	1676
495	Ga0496111_0092571	3300048914	Bacteria	2216
496	Ga0496111_0199750	3300048914	Bacteria	1487
497	Ga0496112_0019051	3300048915	Bacteria	6469
498	Ga0496112_0044863	3300048915	Bacteria	4332
499	Ga0496112_0049274	3300048915	Bacteria	4129
500	Ga0496112_0158997	3300048915	Unclassified	2226
501	Ga0496112_0307877	3300048915	Bacteria	1529
502	Ga0496113_0284786	3300048916	Bacteria	1322
503	Ga0496114_0035734	3300048917	Bacteria	4104
504	Ga0496114_0233145	3300048917	Bacteria	1618
505	Ga0496115_0003467	3300048918	Bacteria	11336
506	Ga0501073_0240786	3300049589	Bacteria	1249
507	nmdc:mga03683_429_c1	3300050489	Bacteria	12155
508	nmdc:mga0k408_27225_c1	3300050493	Bacteria	3246
509	nmdc:mga05p37_185653_c1	3300050507	Unclassified	2528
510	nmdc:mga05p37_27974_c1	3300050507	Bacteria	6868
511	nmdc:mga0n895_83349_c1	3300050512	Unclassified	3188
512	nmdc:mga0rr50_150778_c1	3300050513	Bacteria	1878
513	nmdc:mga08x19_10573_c1	3300050514	Bacteria	5546
514	nmdc:mga08x19_221388_c1	3300050514	Bacteria	1300
515	nmdc:mga0a205_259270_c1	3300050515	Bacteria	1616
516	Ga0495612_0025091	3300053078	Bacteria	2394
517	Ga0500555_000080	3300053103	Bacteria	46241
518	Ga0500556_0000010	3300053104	Bacteria	258288
519	Ga0500642_0039326	3300053130	Bacteria	2033
520	Ga0500616_0001795	3300053153	Bacteria	19545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050489	nmdc:mga03683_429_c1	nmdc:mga03683_429_c1_3737_4663	256
2	3300050493	nmdc:mga0k408_27225_c1	nmdc:mga0k408_27225_c1_450_1307	256
3	3300053103	Ga0500555_000080	Ga0500555_000080_14710_15567	256
4	3300053104	Ga0500556_0000010	Ga0500556_0000010_206736_207593	256
5	3300053130	Ga0500642_0039326	Ga0500642_0039326_866_1723	256
6	3300003320	rootH2_10235358	rootH2_102353582	260
7	3300009093	Ga0105240_10000043	Ga0105240_10000043137	261
8	3300025913	Ga0207695_10000181	Ga0207695_1000018186	261
9	3300049589	Ga0501073_0240786	Ga0501073_0240786_365_1228	261
10	3300005518	Ga0070699_100158089	Ga0070699_1001580893	263
11	3300005536	Ga0070697_100224732	Ga0070697_1002247322	263
12	3300005539	Ga0068853_100000012	Ga0068853_10000001261	263
13	3300010375	Ga0105239_10059125	Ga0105239_100591256	263
14	3300025909	Ga0207705_10010182	Ga0207705_100101826	263
15	3300026041	Ga0207639_10000017	Ga0207639_1000001789	263
16	3300031239	Ga0265328_10006742	Ga0265328_100067422	263
17	3300031344	Ga0265316_10134739	Ga0265316_101347392	263
18	3300031711	Ga0265314_10000020	Ga0265314_1000002021	263
19	3300037471	Ga0395905_0112347	Ga0395905_0112347_586_1380	263
20	3300053153	Ga0500616_0001795	Ga0500616_0001795_17997_18830	263
21	3300005467	Ga0070706_100004157	Ga0070706_1000041574	264
22	3300006237	Ga0097621_100086966	Ga0097621_1000869663	264
23	3300013296	Ga0157374_10000059	Ga0157374_1000005994	264
24	3300015265	Ga0182005_1024284	Ga0182005_10242842	264
25	3300025910	Ga0207684_10005045	Ga0207684_1000504511	264
26	3300005445	Ga0070708_100126700	Ga0070708_1001267002	265
27	3300005536	Ga0070697_100216250	Ga0070697_1002162502	265
28	3300009093	Ga0105240_10316844	Ga0105240_103168442	265
29	3300035695	Ga0373927_0263303	Ga0373927_0263303_139_981	265
30	3300037068	Ga0373925_0094942	Ga0373925_0094942_563_1405	265
31	3300005354	Ga0070675_100021369	Ga0070675_1000213692	266
32	3300009553	Ga0105249_10142545	Ga0105249_101425453	266
33	3300013306	Ga0163162_10339843	Ga0163162_103398431	266
34	3300025315	Ga0207697_10011356	Ga0207697_100113562	266
35	3300025907	Ga0207645_10008167	Ga0207645_100081678	266
36	3300025960	Ga0207651_10060214	Ga0207651_100602142	266
37	3300048912	Ga0496109_0070848	Ga0496109_0070848_1268_2119	266
38	3300048915	Ga0496112_0019051	Ga0496112_0019051_1940_2791	266
39	3300003203	JGI25406J46586_10019826	JGI25406J46586_100198262	267
40	3300005328	Ga0070676_10022662	Ga0070676_100226621	267
41	3300005328	Ga0070676_10248508	Ga0070676_102485081	267
42	3300005330	Ga0070690_100114820	Ga0070690_1001148202	267
43	3300005331	Ga0070670_100028784	Ga0070670_1000287842	267
44	3300005331	Ga0070670_100054332	Ga0070670_1000543322	267
45	3300005334	Ga0068869_100188639	Ga0068869_1001886392	267
46	3300005335	Ga0070666_10111900	Ga0070666_101119002	267
47	3300005338	Ga0068868_100113358	Ga0068868_1001133582	267
48	3300005338	Ga0068868_100163589	Ga0068868_1001635892	267
49	3300005347	Ga0070668_100113119	Ga0070668_1001131192	267
50	3300005353	Ga0070669_100107187	Ga0070669_1001071872	267
51	3300005353	Ga0070669_100334613	Ga0070669_1003346132	267
52	3300005354	Ga0070675_100079034	Ga0070675_1000790342	267
53	3300005354	Ga0070675_100160978	Ga0070675_1001609782	267
54	3300005354	Ga0070675_100283623	Ga0070675_1002836232	267
55	3300005355	Ga0070671_100004271	Ga0070671_1000042713	267
56	3300005355	Ga0070671_100016653	Ga0070671_1000166533	267
57	3300005356	Ga0070674_100004495	Ga0070674_1000044956	267
58	3300005364	Ga0070673_100015043	Ga0070673_1000150433	267
59	3300005364	Ga0070673_100033078	Ga0070673_1000330783	267
60	3300005365	Ga0070688_100030422	Ga0070688_1000304222	267
61	3300005367	Ga0070667_100020154	Ga0070667_1000201542	267
62	3300005456	Ga0070678_100236148	Ga0070678_1002361482	267
63	3300005459	Ga0068867_100074230	Ga0068867_1000742302	267
64	3300005518	Ga0070699_100042178	Ga0070699_1000421783	267
65	3300005536	Ga0070697_100005705	Ga0070697_1000057058	267
66	3300005548	Ga0070665_100025077	Ga0070665_1000250772	267
67	3300005548	Ga0070665_100298580	Ga0070665_1002985802	267
68	3300005564	Ga0070664_100271492	Ga0070664_1002714922	267
69	3300005618	Ga0068864_100061025	Ga0068864_1000610252	267
70	3300005718	Ga0068866_10135681	Ga0068866_101356812	267
71	3300005842	Ga0068858_100232883	Ga0068858_1002328832	267
72	3300005843	Ga0068860_100833972	Ga0068860_1008339721	267
73	3300005844	Ga0068862_100155480	Ga0068862_1001554802	267
74	3300005985	Ga0081539_10075579	Ga0081539_100755792	267
75	3300006237	Ga0097621_100317713	Ga0097621_1003177132	267
76	3300006237	Ga0097621_100486109	Ga0097621_1004861092	267
77	3300006358	Ga0068871_100007276	Ga0068871_1000072762	267
78	3300006358	Ga0068871_100010040	Ga0068871_1000100402	267
79	3300006844	Ga0075428_100116523	Ga0075428_1001165232	267
80	3300013296	Ga0157374_10005835	Ga0157374_100058354	267
81	3300013297	Ga0157378_10008025	Ga0157378_100080256	267
82	3300013297	Ga0157378_10013750	Ga0157378_100137504	267
83	3300013297	Ga0157378_10055922	Ga0157378_100559223	267
84	3300013306	Ga0163162_10014878	Ga0163162_100148785	267
85	3300013306	Ga0163162_10063861	Ga0163162_100638613	267
86	3300013306	Ga0163162_10066505	Ga0163162_100665051	267
87	3300013308	Ga0157375_10078089	Ga0157375_100780893	267
88	3300013308	Ga0157375_10152262	Ga0157375_101522623	267
89	3300014325	Ga0163163_10231246	Ga0163163_102312462	267
90	3300014325	Ga0163163_10315513	Ga0163163_103155132	267
91	3300014969	Ga0157376_10096074	Ga0157376_100960743	267
92	3300025315	Ga0207697_10003599	Ga0207697_100035992	267
93	3300025315	Ga0207697_10011641	Ga0207697_100116413	267
94	3300025893	Ga0207682_10036200	Ga0207682_100362002	267
95	3300025899	Ga0207642_10082072	Ga0207642_100820722	267
96	3300025901	Ga0207688_10003691	Ga0207688_100036917	267
97	3300025903	Ga0207680_10071164	Ga0207680_100711642	267
98	3300025907	Ga0207645_10230628	Ga0207645_102306282	267
99	3300025915	Ga0207693_10394230	Ga0207693_103942301	267
100	3300025923	Ga0207681_10024067	Ga0207681_100240673	267
101	3300025923	Ga0207681_10506057	Ga0207681_105060571	267
102	3300025925	Ga0207650_10105416	Ga0207650_101054162	267
103	3300025926	Ga0207659_10125675	Ga0207659_101256752	267
104	3300025926	Ga0207659_10145509	Ga0207659_101455092	267
105	3300025928	Ga0207700_10137832	Ga0207700_101378322	267
106	3300025931	Ga0207644_10021116	Ga0207644_100211162	267
107	3300025931	Ga0207644_10112877	Ga0207644_101128772	267
108	3300025931	Ga0207644_10133823	Ga0207644_101338232	267
109	3300025933	Ga0207706_10075167	Ga0207706_100751673	267
110	3300025936	Ga0207670_10038569	Ga0207670_100385692	267
111	3300025937	Ga0207669_10030578	Ga0207669_100305783	267
112	3300025937	Ga0207669_10072268	Ga0207669_100722682	267
113	3300025940	Ga0207691_10002283	Ga0207691_100022833	267
114	3300025940	Ga0207691_10012683	Ga0207691_100126833	267
115	3300025945	Ga0207679_10254232	Ga0207679_102542322	267
116	3300025960	Ga0207651_10003656	Ga0207651_100036567	267
117	3300025960	Ga0207651_10006112	Ga0207651_100061124	267
118	3300025960	Ga0207651_10095081	Ga0207651_100950812	267
119	3300025986	Ga0207658_10010884	Ga0207658_100108843	267
120	3300025986	Ga0207658_10098842	Ga0207658_100988422	267
121	3300025986	Ga0207658_10102454	Ga0207658_101024542	267
122	3300026023	Ga0207677_10352843	Ga0207677_103528431	267
123	3300026035	Ga0207703_10112041	Ga0207703_101120412	267
124	3300026089	Ga0207648_10229849	Ga0207648_102298492	267
125	3300026095	Ga0207676_10171951	Ga0207676_101719512	267
126	3300026121	Ga0207683_10015360	Ga0207683_100153603	267
127	3300026121	Ga0207683_10111185	Ga0207683_101111853	267
128	3300028379	Ga0268266_10016468	Ga0268266_100164686	267
129	3300028379	Ga0268266_10064412	Ga0268266_100644121	267
130	3300028380	Ga0268265_10093360	Ga0268265_100933603	267
131	3300028381	Ga0268264_10578817	Ga0268264_105788171	267
132	3300035691	Ga0373931_0091597	Ga0373931_0091597_680_1486	267
133	3300036401	Ga0373937_0373219	Ga0373937_0373219_423_1229	267
134	3300045051	Ga0451576_0507658	Ga0451576_0507658_371_1177	267
135	3300046462	Ga0495651_0272146	Ga0495651_0272146_66_935	267
136	3300046517	Ga0495630_0140410	Ga0495630_0140410_593_1399	267
137	3300046529	Ga0495652_0077079	Ga0495652_0077079_897_1703	267
138	3300046536	Ga0495587_0073323	Ga0495587_0073323_741_1547	267
139	3300046543	Ga0495645_0170602	Ga0495645_0170602_393_1199	267
140	3300046683	Ga0495658_0013423	Ga0495658_0013423_857_1663	267
141	3300047319	Ga0495674_0376771	Ga0495674_0376771_301_1107	267
142	3300048903	Ga0496100_0105732	Ga0496100_0105732_877_1683	267
143	3300048907	Ga0496104_0234103	Ga0496104_0234103_922_1728	267
144	3300048911	Ga0496108_0133259	Ga0496108_0133259_951_1757	267
145	3300048912	Ga0496109_0308522	Ga0496109_0308522_290_1096	267
146	3300048912	Ga0496109_0357789	Ga0496109_0357789_211_1017	267
147	3300048915	Ga0496112_0049274	Ga0496112_0049274_1735_2541	267
148	3300048918	Ga0496115_0003467	Ga0496115_0003467_7263_8069	267
149	3300009094	Ga0111539_10448962	Ga0111539_104489622	268
150	3300013296	Ga0157374_10275658	Ga0157374_102756581	268
151	3300035695	Ga0373927_0342463	Ga0373927_0342463_34_843	268
152	3300005536	Ga0070697_100183997	Ga0070697_1001839972	269
153	3300035170	Ga0373943_0153251	Ga0373943_0153251_22_834	269
154	3300035692	Ga0373935_0188621	Ga0373935_0188621_417_1271	269
155	3300037068	Ga0373925_0105469	Ga0373925_0105469_861_1673	269
156	3300046472	Ga0495580_0210503	Ga0495580_0210503_493_1305	269
157	3300046473	Ga0495582_0231902	Ga0495582_0231902_106_918	269
158	3300005937	Ga0081455_10024366	Ga0081455_100243663	270
159	3300013296	Ga0157374_10285377	Ga0157374_102853771	270
160	3300005355	Ga0070671_100115666	Ga0070671_1001156662	271
161	3300005843	Ga0068860_100002169	Ga0068860_10000216913	271
162	3300013297	Ga0157378_10045474	Ga0157378_100454743	271
163	3300025910	Ga0207684_10153928	Ga0207684_101539282	271
164	3300025931	Ga0207644_10115976	Ga0207644_101159762	271
165	3300028381	Ga0268264_10001609	Ga0268264_1000160914	271
166	3300048915	Ga0496112_0158997	Ga0496112_0158997_257_1075	271
167	3300005328	Ga0070676_10204616	Ga0070676_102046162	272
168	3300005468	Ga0070707_100312668	Ga0070707_1003126682	272
169	3300005536	Ga0070697_100417512	Ga0070697_1004175122	272
170	3300005545	Ga0070695_100184367	Ga0070695_1001843672	272
171	3300005616	Ga0068852_100113197	Ga0068852_1001131972	272
172	3300025922	Ga0207646_10121273	Ga0207646_101212733	272
173	3300039437	Ga0436365_1153529	Ga0436365_1153529_3668_4501	272
174	3300025910	Ga0207684_10465094	Ga0207684_104650941	273
175	3300035172	Ga0373955_0161269	Ga0373955_0161269_252_1106	273
176	3300039437	Ga0436365_0511548	Ga0436365_0511548_77_940	273
177	3300005293	Ga0065715_10104106	Ga0065715_101041063	274
178	3300005467	Ga0070706_100090542	Ga0070706_1000905423	274
179	3300021384	Ga0213876_10036263	Ga0213876_100362632	274
180	3300025910	Ga0207684_10105672	Ga0207684_101056722	274
181	3300039437	Ga0436365_0774305	Ga0436365_0774305_14300_15169	274
182	3300005293	Ga0065715_10089033	Ga0065715_100890332	275
183	3300005841	Ga0068863_100007852	Ga0068863_1000078527	275
184	3300021361	Ga0213872_10038979	Ga0213872_100389792	275
185	3300021361	Ga0213872_10106244	Ga0213872_101062441	275
186	3300021361	Ga0213872_10107496	Ga0213872_101074961	275
187	3300021441	Ga0213871_10038566	Ga0213871_100385661	275
188	3300037853	Ga0436364_0001908	Ga0436364_0001908_1904_2779	275
189	3300037853	Ga0436364_0784346	Ga0436364_0784346_222_1079	275
190	3300039437	Ga0436365_0292643	Ga0436365_0292643_111_968	275
191	3300039438	Ga0436360_0181157	Ga0436360_0181157_81_941	275
192	3300039438	Ga0436360_0890065	Ga0436360_0890065_496_1356	275
193	3300039447	Ga0436361_0219401	Ga0436361_0219401_405_1265	275
194	3300039447	Ga0436361_0536230	Ga0436361_0536230_790_1650	275
195	3300039447	Ga0436361_0809872	Ga0436361_0809872_677_1561	275
196	3300039447	Ga0436361_0971942	Ga0436361_0971942_328_1188	275
197	3300039450	Ga0436363_0329569	Ga0436363_0329569_5604_6443	275
198	3300039453	Ga0436362_0603905	Ga0436362_0603905_3530_4414	275
199	3300005445	Ga0070708_100298257	Ga0070708_1002982572	276
200	3300005468	Ga0070707_100296713	Ga0070707_1002967132	276
201	3300005471	Ga0070698_100000732	Ga0070698_10000073217	276
202	3300005518	Ga0070699_100057013	Ga0070699_1000570133	276
203	3300005536	Ga0070697_100022754	Ga0070697_1000227542	276
204	3300006028	Ga0070717_10285178	Ga0070717_102851782	276
205	3300006175	Ga0070712_100338327	Ga0070712_1003383272	276
206	3300010159	Ga0099796_10033131	Ga0099796_100331312	276
207	3300025910	Ga0207684_10086934	Ga0207684_100869343	276
208	3300025922	Ga0207646_10235484	Ga0207646_102354842	276
209	3300025928	Ga0207700_10094542	Ga0207700_100945423	276
210	3300025939	Ga0207665_10151278	Ga0207665_101512783	276
211	3300046523	Ga0495644_0049052	Ga0495644_0049052_218_1072	276
212	3300005445	Ga0070708_100030326	Ga0070708_1000303267	277
213	3300005467	Ga0070706_100102866	Ga0070706_1001028664	277
214	3300005468	Ga0070707_100007728	Ga0070707_10000772812	277
215	3300005471	Ga0070698_100049206	Ga0070698_1000492064	277
216	3300005518	Ga0070699_100052031	Ga0070699_1000520317	277
217	3300006048	Ga0075363_100084075	Ga0075363_1000840752	277
218	3300006177	Ga0075362_10004823	Ga0075362_100048234	277
219	3300006195	Ga0075366_10086151	Ga0075366_100861511	277
220	3300013297	Ga0157378_10084520	Ga0157378_100845204	277
221	3300021377	Ga0213874_10038824	Ga0213874_100388242	277
222	3300021441	Ga0213871_10025265	Ga0213871_100252652	277
223	3300025922	Ga0207646_10041019	Ga0207646_100410194	277
224	3300025922	Ga0207646_10184180	Ga0207646_101841802	277
225	3300025939	Ga0207665_10074216	Ga0207665_100742163	277
226	3300037853	Ga0436364_1317185	Ga0436364_1317185_547_1434	277
227	3300039438	Ga0436360_0064177	Ga0436360_0064177_88_933	277
228	3300039447	Ga0436361_0444714	Ga0436361_0444714_3038_3889	277
229	3300039447	Ga0436361_0654100	Ga0436361_0654100_1208_2059	277
230	3300039450	Ga0436363_0064540	Ga0436363_0064540_5376_6263	277
231	3300005468	Ga0070707_100049512	Ga0070707_1000495125	278
232	3300005468	Ga0070707_100402026	Ga0070707_1004020261	278
233	3300006028	Ga0070717_10118280	Ga0070717_101182803	278
234	3300021384	Ga0213876_10024479	Ga0213876_100244794	278
235	3300025922	Ga0207646_10110803	Ga0207646_101108032	278
236	3300037471	Ga0395905_0540875	Ga0395905_0540875_157_996	278
237	3300039437	Ga0436365_0274631	Ga0436365_0274631_5062_5913	278
238	3300039438	Ga0436360_0999617	Ga0436360_0999617_2757_3608	278
239	3300039447	Ga0436361_0874588	Ga0436361_0874588_452_1303	278
240	3300013307	Ga0157372_10039614	Ga0157372_100396146	279
241	3300013297	Ga0157378_10095219	Ga0157378_100952191	281
242	3300005445	Ga0070708_100021566	Ga0070708_1000215663	282
243	3300005467	Ga0070706_100000035	Ga0070706_10000003560	282
244	3300005467	Ga0070706_100032094	Ga0070706_1000320945	282
245	3300005467	Ga0070706_100055603	Ga0070706_1000556033	282
246	3300005468	Ga0070707_100001740	Ga0070707_1000017406	282
247	3300005468	Ga0070707_100078309	Ga0070707_1000783093	282
248	3300005468	Ga0070707_100169356	Ga0070707_1001693562	282
249	3300005468	Ga0070707_100221608	Ga0070707_1002216082	282
250	3300005471	Ga0070698_100010668	Ga0070698_1000106687	282
251	3300005518	Ga0070699_100158858	Ga0070699_1001588583	282
252	3300005518	Ga0070699_100239810	Ga0070699_1002398102	282
253	3300005536	Ga0070697_100012378	Ga0070697_1000123785	282
254	3300005536	Ga0070697_100568435	Ga0070697_1005684351	282
255	3300006028	Ga0070717_10015256	Ga0070717_100152562	282
256	3300006028	Ga0070717_10017681	Ga0070717_100176813	282
257	3300006028	Ga0070717_10214465	Ga0070717_102144652	282
258	3300006914	Ga0075436_100011369	Ga0075436_1000113696	282
259	3300006914	Ga0075436_100303866	Ga0075436_1003038662	282
260	3300013297	Ga0157378_10896050	Ga0157378_108960501	282
261	3300025885	Ga0207653_10013151	Ga0207653_100131513	282
262	3300025904	Ga0207647_10140147	Ga0207647_101401472	282
263	3300025910	Ga0207684_10000043	Ga0207684_1000004363	282
264	3300025910	Ga0207684_10032316	Ga0207684_100323162	282
265	3300025910	Ga0207684_10084218	Ga0207684_100842182	282
266	3300025922	Ga0207646_10001979	Ga0207646_1000197923	282
267	3300025922	Ga0207646_10002145	Ga0207646_100021457	282
268	3300025922	Ga0207646_10177735	Ga0207646_101777351	282
269	3300035171	Ga0373946_0088892	Ga0373946_0088892_66_917	282
270	3300050514	nmdc:mga08x19_10573_c1	nmdc:mga08x19_10573_c1_2267_3118	282
271	3300050514	nmdc:mga08x19_221388_c1	nmdc:mga08x19_221388_c1_221_1072	282
272	2162886006	SwRhRL3b_contig_4380819	SwRhRL3b_0435.00002210	283
273	2162886007	SwRhRL2b_contig_2151885	SwRhRL2b_0922.00006570	283
274	3300002126	JGI24035J26624_1003117	JGI24035J26624_10031171	283
275	3300002126	JGI24035J26624_1003841	JGI24035J26624_10038413	283
276	3300005290	Ga0065712_10068408	Ga0065712_100684082	283
277	3300005293	Ga0065715_10012001	Ga0065715_100120012	283
278	3300005293	Ga0065715_10090541	Ga0065715_100905411	283
279	3300005328	Ga0070676_10090780	Ga0070676_100907801	283
280	3300005329	Ga0070683_100013177	Ga0070683_1000131776	283
281	3300005329	Ga0070683_100069616	Ga0070683_1000696163	283
282	3300005329	Ga0070683_100319148	Ga0070683_1003191481	283
283	3300005337	Ga0070682_100109433	Ga0070682_1001094332	283
284	3300005339	Ga0070660_100340563	Ga0070660_1003405631	283
285	3300005340	Ga0070689_100123988	Ga0070689_1001239882	283
286	3300005340	Ga0070689_100360973	Ga0070689_1003609732	283
287	3300005343	Ga0070687_100053932	Ga0070687_1000539322	283
288	3300005344	Ga0070661_100375641	Ga0070661_1003756411	283
289	3300005347	Ga0070668_100354465	Ga0070668_1003544652	283
290	3300005353	Ga0070669_100301077	Ga0070669_1003010771	283
291	3300005354	Ga0070675_100020188	Ga0070675_1000201883	283
292	3300005354	Ga0070675_100139759	Ga0070675_1001397592	283
293	3300005355	Ga0070671_100039549	Ga0070671_1000395492	283
294	3300005355	Ga0070671_100041937	Ga0070671_1000419372	283
295	3300005355	Ga0070671_100196415	Ga0070671_1001964152	283
296	3300005356	Ga0070674_100021814	Ga0070674_1000218145	283
297	3300005356	Ga0070674_100068365	Ga0070674_1000683652	283
298	3300005356	Ga0070674_100083832	Ga0070674_1000838323	283
299	3300005365	Ga0070688_100011468	Ga0070688_1000114683	283
300	3300005366	Ga0070659_100020105	Ga0070659_1000201052	283
301	3300005367	Ga0070667_100044438	Ga0070667_1000444383	283
302	3300005434	Ga0070709_10010076	Ga0070709_100100761	283
303	3300005435	Ga0070714_100038493	Ga0070714_1000384932	283
304	3300005439	Ga0070711_100008424	Ga0070711_1000084242	283
305	3300005439	Ga0070711_100053720	Ga0070711_1000537203	283
306	3300005439	Ga0070711_100069022	Ga0070711_1000690222	283
307	3300005440	Ga0070705_100003907	Ga0070705_1000039072	283
308	3300005441	Ga0070700_100072626	Ga0070700_1000726262	283
309	3300005444	Ga0070694_100193699	Ga0070694_1001936992	283
310	3300005445	Ga0070708_100166940	Ga0070708_1001669403	283
311	3300005455	Ga0070663_100032562	Ga0070663_1000325624	283
312	3300005455	Ga0070663_100086055	Ga0070663_1000860553	283
313	3300005456	Ga0070678_100172131	Ga0070678_1001721312	283
314	3300005456	Ga0070678_100237335	Ga0070678_1002373352	283
315	3300005457	Ga0070662_100085547	Ga0070662_1000855472	283
316	3300005458	Ga0070681_10231693	Ga0070681_102316932	283
317	3300005459	Ga0068867_100488592	Ga0068867_1004885921	283
318	3300005466	Ga0070685_10088439	Ga0070685_100884392	283
319	3300005467	Ga0070706_100002580	Ga0070706_10000258011	283
320	3300005468	Ga0070707_100015818	Ga0070707_1000158186	283
321	3300005471	Ga0070698_100070521	Ga0070698_1000705214	283
322	3300005530	Ga0070679_100069537	Ga0070679_1000695374	283
323	3300005535	Ga0070684_100026781	Ga0070684_1000267812	283
324	3300005536	Ga0070697_100057036	Ga0070697_1000570364	283
325	3300005543	Ga0070672_100019475	Ga0070672_1000194756	283
326	3300005544	Ga0070686_100069155	Ga0070686_1000691552	283
327	3300005545	Ga0070695_100290075	Ga0070695_1002900752	283
328	3300005547	Ga0070693_100406627	Ga0070693_1004066271	283
329	3300005549	Ga0070704_100007443	Ga0070704_1000074436	283
330	3300005564	Ga0070664_100060943	Ga0070664_1000609434	283
331	3300005564	Ga0070664_100348881	Ga0070664_1003488812	283
332	3300005614	Ga0068856_100077503	Ga0068856_1000775032	283
333	3300005615	Ga0070702_100045738	Ga0070702_1000457382	283
334	3300005719	Ga0068861_100377991	Ga0068861_1003779911	283
335	3300005841	Ga0068863_100344513	Ga0068863_1003445131	283
336	3300005842	Ga0068858_100035942	Ga0068858_1000359422	283
337	3300005843	Ga0068860_100052268	Ga0068860_1000522684	283
338	3300005843	Ga0068860_100089425	Ga0068860_1000894252	283
339	3300005937	Ga0081455_10004605	Ga0081455_100046056	283
340	3300005937	Ga0081455_10023501	Ga0081455_100235016	283
341	3300005937	Ga0081455_10055884	Ga0081455_100558845	283
342	3300005937	Ga0081455_10088244	Ga0081455_100882442	283
343	3300005983	Ga0081540_1000018	Ga0081540_100001841	283
344	3300005985	Ga0081539_10000052	Ga0081539_1000005238	283
345	3300005985	Ga0081539_10075450	Ga0081539_100754502	283
346	3300006028	Ga0070717_10024883	Ga0070717_100248835	283
347	3300006028	Ga0070717_10030036	Ga0070717_100300362	283
348	3300006163	Ga0070715_10046629	Ga0070715_100466291	283
349	3300006173	Ga0070716_100076952	Ga0070716_1000769522	283
350	3300006175	Ga0070712_100110243	Ga0070712_1001102432	283
351	3300006175	Ga0070712_100279235	Ga0070712_1002792352	283
352	3300006852	Ga0075433_10642319	Ga0075433_106423191	283
353	3300006871	Ga0075434_100273078	Ga0075434_1002730782	283
354	3300007076	Ga0075435_100145178	Ga0075435_1001451782	283
355	3300009094	Ga0111539_10537689	Ga0111539_105376891	283
356	3300009098	Ga0105245_10043951	Ga0105245_100439511	283
357	3300009101	Ga0105247_10166882	Ga0105247_101668822	283
358	3300009147	Ga0114129_10010037	Ga0114129_100100375	283
359	3300010159	Ga0099796_10011641	Ga0099796_100116412	283
360	3300010159	Ga0099796_10015935	Ga0099796_100159352	283
361	3300010375	Ga0105239_10169758	Ga0105239_101697583	283
362	3300010375	Ga0105239_10217306	Ga0105239_102173061	283
363	3300010375	Ga0105239_10513195	Ga0105239_105131951	283
364	3300013102	Ga0157371_10037492	Ga0157371_100374924	283
365	3300013102	Ga0157371_10077218	Ga0157371_100772182	283
366	3300013105	Ga0157369_10022226	Ga0157369_100222266	283
367	3300013296	Ga0157374_10079502	Ga0157374_100795022	283
368	3300013296	Ga0157374_10080215	Ga0157374_100802153	283
369	3300013296	Ga0157374_10220913	Ga0157374_102209132	283
370	3300013296	Ga0157374_10271104	Ga0157374_102711042	283
371	3300013297	Ga0157378_10079190	Ga0157378_100791903	283
372	3300013297	Ga0157378_10219401	Ga0157378_102194012	283
373	3300013306	Ga0163162_10009133	Ga0163162_100091333	283
374	3300013306	Ga0163162_10020371	Ga0163162_100203712	283
375	3300013307	Ga0157372_10566100	Ga0157372_105661002	283
376	3300013308	Ga0157375_10022497	Ga0157375_100224973	283
377	3300013308	Ga0157375_10141809	Ga0157375_101418091	283
378	3300013308	Ga0157375_10249996	Ga0157375_102499962	283
379	3300014325	Ga0163163_10068453	Ga0163163_100684533	283
380	3300014325	Ga0163163_10088694	Ga0163163_100886942	283
381	3300014325	Ga0163163_10136167	Ga0163163_101361673	283
382	3300014325	Ga0163163_10382053	Ga0163163_103820532	283
383	3300014968	Ga0157379_10073005	Ga0157379_100730053	283
384	3300014969	Ga0157376_10052631	Ga0157376_100526312	283
385	3300014969	Ga0157376_10089775	Ga0157376_100897752	283
386	3300014969	Ga0157376_10194858	Ga0157376_101948583	283
387	3300025271	Ga0207666_1001009	Ga0207666_10010094	283
388	3300025290	Ga0207673_1000545	Ga0207673_10005452	283
389	3300025290	Ga0207673_1000692	Ga0207673_10006922	283
390	3300025315	Ga0207697_10000337	Ga0207697_100003375	283
391	3300025315	Ga0207697_10003976	Ga0207697_100039766	283
392	3300025315	Ga0207697_10017738	Ga0207697_100177383	283
393	3300025315	Ga0207697_10021911	Ga0207697_100219112	283
394	3300025315	Ga0207697_10028587	Ga0207697_100285873	283
395	3300025885	Ga0207653_10021869	Ga0207653_100218692	283
396	3300025898	Ga0207692_10023160	Ga0207692_100231602	283
397	3300025904	Ga0207647_10022346	Ga0207647_100223462	283
398	3300025906	Ga0207699_10044441	Ga0207699_100444413	283
399	3300025907	Ga0207645_10013361	Ga0207645_100133615	283
400	3300025907	Ga0207645_10089461	Ga0207645_100894612	283
401	3300025909	Ga0207705_10080818	Ga0207705_100808181	283
402	3300025910	Ga0207684_10027326	Ga0207684_100273266	283
403	3300025910	Ga0207684_10027522	Ga0207684_100275223	283
404	3300025910	Ga0207684_10057695	Ga0207684_100576952	283
405	3300025910	Ga0207684_10132505	Ga0207684_101325052	283
406	3300025915	Ga0207693_10002399	Ga0207693_100023996	283
407	3300025915	Ga0207693_10007118	Ga0207693_100071187	283
408	3300025915	Ga0207693_10062793	Ga0207693_100627933	283
409	3300025915	Ga0207693_10099152	Ga0207693_100991521	283
410	3300025916	Ga0207663_10090453	Ga0207663_100904532	283
411	3300025918	Ga0207662_10080305	Ga0207662_100803052	283
412	3300025920	Ga0207649_10137512	Ga0207649_101375122	283
413	3300025922	Ga0207646_10027642	Ga0207646_100276422	283
414	3300025922	Ga0207646_10050265	Ga0207646_100502654	283
415	3300025922	Ga0207646_10107610	Ga0207646_101076102	283
416	3300025922	Ga0207646_10149476	Ga0207646_101494762	283
417	3300025926	Ga0207659_10061951	Ga0207659_100619512	283
418	3300025928	Ga0207700_10166638	Ga0207700_101666382	283
419	3300025931	Ga0207644_10201534	Ga0207644_102015342	283
420	3300025932	Ga0207690_10033086	Ga0207690_100330863	283
421	3300025933	Ga0207706_10026724	Ga0207706_100267245	283
422	3300025933	Ga0207706_10098803	Ga0207706_100988033	283
423	3300025936	Ga0207670_10012113	Ga0207670_100121136	283
424	3300025936	Ga0207670_10080154	Ga0207670_100801542	283
425	3300025938	Ga0207704_10192023	Ga0207704_101920232	283
426	3300025938	Ga0207704_10234403	Ga0207704_102344032	283
427	3300025939	Ga0207665_10008481	Ga0207665_100084812	283
428	3300025939	Ga0207665_10028236	Ga0207665_100282364	283
429	3300025940	Ga0207691_10007180	Ga0207691_100071808	283
430	3300025940	Ga0207691_10059318	Ga0207691_100593184	283
431	3300025944	Ga0207661_10031734	Ga0207661_100317345	283
432	3300025944	Ga0207661_10046233	Ga0207661_100462333	283
433	3300025945	Ga0207679_10318347	Ga0207679_103183472	283
434	3300025960	Ga0207651_10214791	Ga0207651_102147912	283
435	3300025961	Ga0207712_10027858	Ga0207712_100278583	283
436	3300025972	Ga0207668_10119343	Ga0207668_101193432	283
437	3300025981	Ga0207640_10158611	Ga0207640_101586112	283
438	3300025986	Ga0207658_10193009	Ga0207658_101930091	283
439	3300026023	Ga0207677_10376060	Ga0207677_103760601	283
440	3300026035	Ga0207703_10051997	Ga0207703_100519972	283
441	3300026067	Ga0207678_10018450	Ga0207678_100184506	283
442	3300026075	Ga0207708_10003672	Ga0207708_100036729	283
443	3300026088	Ga0207641_10024418	Ga0207641_100244182	283
444	3300026088	Ga0207641_10093197	Ga0207641_100931971	283
445	3300026118	Ga0207675_100430796	Ga0207675_1004307962	283
446	3300026121	Ga0207683_10017265	Ga0207683_100172654	283
447	3300026121	Ga0207683_10026147	Ga0207683_100261471	283
448	3300026121	Ga0207683_10039292	Ga0207683_100392922	283
449	3300026121	Ga0207683_10049808	Ga0207683_100498082	283
450	3300028379	Ga0268266_10016163	Ga0268266_100161633	283
451	3300028379	Ga0268266_10018759	Ga0268266_100187592	283
452	3300028379	Ga0268266_10079067	Ga0268266_100790672	283
453	3300028379	Ga0268266_10210714	Ga0268266_102107141	283
454	3300035170	Ga0373943_0032552	Ga0373943_0032552_757_1608	283
455	3300035170	Ga0373943_0067536	Ga0373943_0067536_528_1382	283
456	3300035172	Ga0373955_0273616	Ga0373955_0273616_22_876	283
457	3300035691	Ga0373931_0093386	Ga0373931_0093386_525_1376	283
458	3300035691	Ga0373931_0167891	Ga0373931_0167891_235_1089	283
459	3300035695	Ga0373927_0107215	Ga0373927_0107215_385_1239	283
460	3300035725	Ga0373947_0114711	Ga0373947_0114711_11_862	283
461	3300036401	Ga0373937_0287381	Ga0373937_0287381_672_1526	283
462	3300037068	Ga0373925_0185087	Ga0373925_0185087_240_1094	283
463	3300037418	Ga0395900_0110389	Ga0395900_0110389_1192_2046	283
464	3300037466	Ga0395898_0006727	Ga0395898_0006727_1150_2004	283
465	3300037466	Ga0395898_0097481	Ga0395898_0097481_1078_1932	283
466	3300037471	Ga0395905_0236071	Ga0395905_0236071_446_1300	283
467	3300038443	Ga0395901_0009988	Ga0395901_0009988_7041_7895	283
468	3300038443	Ga0395901_0179629	Ga0395901_0179629_1009_1863	283
469	3300038443	Ga0395901_0243737	Ga0395901_0243737_961_1815	283
470	3300042012	Ga0439455_0015001	Ga0439455_0015001_226_1080	283
471	3300046459	Ga0495629_0096243	Ga0495629_0096243_1189_2043	283
472	3300046477	Ga0495664_0257143	Ga0495664_0257143_157_1011	283
473	3300046516	Ga0495628_0227629	Ga0495628_0227629_157_1011	283
474	3300046517	Ga0495630_0182057	Ga0495630_0182057_97_951	283
475	3300046528	Ga0495642_0032015	Ga0495642_0032015_700_1551	283
476	3300046529	Ga0495652_0214261	Ga0495652_0214261_399_1253	283
477	3300046533	Ga0495640_0262508	Ga0495640_0262508_119_973	283
478	3300046535	Ga0495586_0113849	Ga0495586_0113849_336_1190	283
479	3300046536	Ga0495587_0211389	Ga0495587_0211389_105_959	283
480	3300046642	Ga0495634_0034465	Ga0495634_0034465_495_1349	283
481	3300046664	Ga0495659_0007145	Ga0495659_0007145_2307_3158	283
482	3300046665	Ga0495661_0089556	Ga0495661_0089556_565_1416	283
483	3300046679	Ga0495623_0011180	Ga0495623_0011180_4902_5756	283
484	3300046683	Ga0495658_0154816	Ga0495658_0154816_340_1194	283
485	3300046684	Ga0495669_0004171	Ga0495669_0004171_2905_3756	283
486	3300046684	Ga0495669_0095637	Ga0495669_0095637_455_1309	283
487	3300046689	Ga0495613_0068710	Ga0495613_0068710_454_1308	283
488	3300047321	Ga0495676_0033751	Ga0495676_0033751_2837_3691	283
489	3300047322	Ga0495680_0349844	Ga0495680_0349844_64_918	283
490	3300047444	Ga0495675_0073979	Ga0495675_0073979_785_1639	283
491	3300048088	Ga0495602_0214849	Ga0495602_0214849_513_1367	283
492	3300048903	Ga0496100_0270407	Ga0496100_0270407_335_1189	283
493	3300048903	Ga0496100_0428128	Ga0496100_0428128_109_963	283
494	3300048903	Ga0496100_0458561	Ga0496100_0458561_81_935	283
495	3300048904	Ga0496101_0017167	Ga0496101_0017167_1023_1877	283
496	3300048905	Ga0496102_0099378	Ga0496102_0099378_1545_2396	283
497	3300048905	Ga0496102_0208232	Ga0496102_0208232_642_1496	283
498	3300048905	Ga0496102_0428965	Ga0496102_0428965_162_1016	283
499	3300048905	Ga0496102_0626484	Ga0496102_0626484_57_911	283
500	3300048908	Ga0496105_0077918	Ga0496105_0077918_1586_2440	283
501	3300048909	Ga0496106_0088840	Ga0496106_0088840_460_1314	283
502	3300048910	Ga0496107_0067905	Ga0496107_0067905_928_1782	283
503	3300048911	Ga0496108_0358870	Ga0496108_0358870_54_908	283
504	3300048912	Ga0496109_0286023	Ga0496109_0286023_245_1099	283
505	3300048912	Ga0496109_0335444	Ga0496109_0335444_19_873	283
506	3300048913	Ga0496110_0063577	Ga0496110_0063577_2217_3071	283
507	3300048913	Ga0496110_0232728	Ga0496110_0232728_292_1146	283
508	3300048914	Ga0496111_0092571	Ga0496111_0092571_1251_2105	283
509	3300048914	Ga0496111_0199750	Ga0496111_0199750_512_1366	283
510	3300048915	Ga0496112_0044863	Ga0496112_0044863_121_975	283
511	3300048915	Ga0496112_0307877	Ga0496112_0307877_375_1229	283
512	3300048916	Ga0496113_0284786	Ga0496113_0284786_292_1146	283
513	3300048917	Ga0496114_0035734	Ga0496114_0035734_2280_3134	283
514	3300048917	Ga0496114_0233145	Ga0496114_0233145_66_920	283
515	3300050507	nmdc:mga05p37_185653_c1	nmdc:mga05p37_185653_c1_1203_2057	283
516	3300050507	nmdc:mga05p37_27974_c1	nmdc:mga05p37_27974_c1_972_1826	283
517	3300050512	nmdc:mga0n895_83349_c1	nmdc:mga0n895_83349_c1_438_1289	283
518	3300050513	nmdc:mga0rr50_150778_c1	nmdc:mga0rr50_150778_c1_846_1697	283
519	3300050515	nmdc:mga0a205_259270_c1	nmdc:mga0a205_259270_c1_18_869	283
520	3300053078	Ga0495612_0025091	Ga0495612_0025091_135_989	283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

5

256

0.99 PF00149

Metallophos

Calcineurin-like phosphoesterase

2

181

0.76 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4b2o-assembly1.cif.gz_D	crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses.	0.9535	2	259
1t70-assembly3.cif.gz_E	crystal structure of a novel phosphatase from deinococcus radiodurans	0.9364	2	259
2cv9-assembly1.cif.gz_A	crystal structure of a hypothetical protein from thermus thermophilus hb8	0.9347	2	259
1t70-assembly3.cif.gz_E	crystal structure of a novel phosphatase from deinococcus radiodurans	0.9258	2	259
4b2o-assembly1.cif.gz_D	crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses.	0.9255	2	259

ID	Description	Score	Start	End	Superfamily
4b2oD00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9535	2	259	3.60.21.10
2z06B00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9328	2	259	3.60.21.10
4b2oD00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9255	2	259	3.60.21.10
2z06B00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9222	2	259	3.60.21.10
1t71A00	Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases	0.9134	2	259	3.60.21.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2V5KJ99-F1-model_v4	TIGR00282 family metallophosphoesterase	0.9651	1	249	GO:0004113 GO:0046872
AF-A0A2V6DJC4-F1-model_v4	TIGR00282 family metallophosphoesterase	0.9642	1	220	GO:0004113 GO:0046872
AF-A0A2V6URC7-F1-model_v4	TIGR00282 family metallophosphoesterase	0.964	2	259	GO:0004113 GO:0046872
AF-A0A2V6UC29-F1-model_v4	Metallophosphoesterase	0.9632	134	259	GO:0004113
AF-A0A4Y8PHY8-F1-model_v4	Metallophosphoesterase	0.9631	2	259	GO:0004113 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
87.78	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F458522

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13277

YmdB

YmdB-like protein

5

256

0.99

PF00149

Metallophos

Calcineurin-like phosphoesterase

2

181

0.76

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map