F458529

General Info

Members Datasets Scaffolds Average Seq Length
520 353 1040 342

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001265|Ga0111539_1000126511
Length 395
Sequence MMPHILFLLSACCANCDHVRYRHSYVRKCEPFNIWPAQLSDINSNDIERGEYLMCCMCQIVPERVLKRLAADRKFSAEQRKNFADTIKIDTQLRRLRTQAARLTRVAGLMAEAPTVAPAPAITVYDCNHGQTLPGAQILNPATSTDPTARHVFSETKSVEAFYAQVFGRNSIDNAGMTMISSIHYGVRYNNAFWNGSQMTYGDGDGSIFLDFSNANDVIGHELTHGVTQYSLQLNYTNDAGGLNESLSDCFGSMFRQWEANQTVKQADWLIGKDIMGPSAIESGYSCLRDMADPDAKHCLAPQPTKYSQVRPGMDPHLSSGPPNLAFCTIAKAVGGNSWDEVGQIWYRSMTGFGPAPNLKMSAFADRTRAVAAELYPNNTALARAVDAGWKKVGL

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
17 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
229 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
230 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
233 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
234 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
235 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
238 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
322 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
323 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
324 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
325 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
329 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
330 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
333 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
334 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
335 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
336 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
337 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
338 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
339 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
340 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
341 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
342 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
343 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
344 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
345 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
346 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
347 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
348 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
349 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
350 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
351 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
352 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
353 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 1.35
Rhizoplane 6.35
Rhizosphere 81.15
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10001265 3300009094 Bacteria 33733
2 SwRhRL2b_contig_3023270 2162886007 Bacteria 2118
3 2214739658 2209111006 Bacteria 3904
4 ARcpr5oldR_c000577 3300000041 Bacteria 4514
5 ARcpr5oldR_c000621 3300000041 Bacteria 4289
6 ARSoilYngRDRAFT_c00518 3300000042 Bacteria 4489
7 ARcpr5yngRDRAFT_c000019 3300000043 Bacteria 26827
8 ARSoilOldRDRAFT_c000185 3300000044 Bacteria 10180
9 ARCol0yngRDRAFT_1000196 3300000652 Bacteria 10174
10 JGI24739J22299_10003373 3300001989 Bacteria 6093
11 JGI24737J22298_10001973 3300001990 Bacteria 7331
12 JGI24750J21931_1001200 3300002070 Bacteria 3308
13 JGI24745J21846_1000037 3300002073 Bacteria 8975
14 JGI24738J21930_10000785 3300002075 Bacteria 9094
15 JGI24749J21850_1001233 3300002076 Bacteria 3639
16 JGI24744J21845_10001682 3300002077 Bacteria 4428
17 JGI24035J26624_1000442 3300002126 Bacteria 3923
18 JGI24033J26618_1004042 3300002155 Bacteria 1569
19 JGI24034J26672_10001345 3300002239 Bacteria 3249
20 JGI24742J22300_10000043 3300002244 Bacteria 18528
21 JGI25156J39149_1000922 3300002705 Bacteria 14294
22 JGI25157J39369_1000053 3300002741 Bacteria 110228
23 JGI25153J46596_10003314 3300003215 Bacteria 9053
24 rootH2_10123078 3300003320 Bacteria 2532
25 JGI25160J50197_1007526 3300003354 Bacteria 4251
26 JGI25405J52794_10006617 3300003911 Bacteria 2119
27 Ga0055543_1002478 3300004625 Bacteria 6089
28 Ga0065165_1001304 3300005262 Bacteria 27869
29 Ga0065165_1002635 3300005262 Bacteria 14588
30 Ga0065165_1040664 3300005262 Bacteria 1385
31 Ga0065716_1001570 3300005277 Bacteria 6287
32 Ga0065704_10092692 3300005289 Bacteria 2639
33 Ga0065712_10069066 3300005290 Bacteria 8108
34 Ga0065715_10010906 3300005293 Bacteria 2326
35 Ga0065715_10097062 3300005293 Bacteria 3771
36 Ga0065707_10103728 3300005295 Bacteria 2732
37 Ga0070683_100000656 3300005329 Bacteria 25014
38 Ga0070683_100154655 3300005329 Bacteria 2175
39 Ga0070690_100006625 3300005330 Bacteria 6579
40 Ga0070677_10000076 3300005333 Bacteria 31338
41 Ga0068869_100001086 3300005334 Bacteria 15861
42 Ga0070666_10021987 3300005335 Bacteria 4138
43 Ga0070666_10165966 3300005335 Bacteria 1545
44 Ga0070680_100008723 3300005336 Bacteria 7773
45 Ga0070682_100000285 3300005337 Bacteria 36134
46 Ga0068868_100001772 3300005338 Bacteria 14781
47 Ga0070660_100000874 3300005339 Bacteria 20123
48 Ga0070660_100025003 3300005339 Bacteria 4435
49 Ga0070689_100004587 3300005340 Bacteria 9352
50 Ga0070691_10001213 3300005341 Bacteria 10837
51 Ga0070687_100000185 3300005343 Bacteria 21632
52 Ga0070687_100179351 3300005343 Bacteria 1267
53 Ga0070661_100004546 3300005344 Bacteria 9545
54 Ga0070692_10003343 3300005345 Bacteria 6489
55 Ga0070668_100005755 3300005347 Bacteria 9194
56 Ga0070669_100291516 3300005353 Bacteria 1310
57 Ga0070675_100000622 3300005354 Bacteria 24525
58 Ga0070671_100169891 3300005355 Bacteria 1844
59 Ga0070674_100006042 3300005356 Bacteria 7040
60 Ga0070673_100000640 3300005364 Bacteria 19217
61 Ga0070659_100000720 3300005366 Bacteria 24009
62 Ga0070667_100050340 3300005367 Bacteria 3511
63 Ga0070703_10003623 3300005406 Bacteria 4389
64 Ga0070705_100003031 3300005440 Bacteria 8292
65 Ga0070700_100001785 3300005441 Bacteria 10844
66 Ga0070694_100002993 3300005444 Bacteria 10042
67 Ga0070708_100188028 3300005445 Bacteria 1931
68 Ga0070708_100224748 3300005445 Unclassified 1761
69 Ga0070663_100003686 3300005455 Bacteria 8885
70 Ga0070678_100003113 3300005456 Bacteria 9194
71 Ga0070662_100003674 3300005457 Bacteria 9589
72 Ga0070662_100036251 3300005457 Bacteria 3488
73 Ga0070662_100340072 3300005457 Bacteria 1228
74 Ga0070681_10000446 3300005458 Bacteria 33708
75 Ga0068867_100003601 3300005459 Bacteria 10900
76 Ga0070685_10000645 3300005466 Bacteria 19015
77 Ga0070698_100005598 3300005471 Bacteria 13739
78 Ga0070698_100532573 3300005471 Bacteria 1113
79 Ga0070679_100004065 3300005530 Bacteria 13481
80 Ga0070679_100265048 3300005530 Bacteria 1673
81 Ga0070684_100002245 3300005535 Bacteria 14207
82 Ga0070684_100181445 3300005535 Bacteria 1914
83 Ga0070697_100079305 3300005536 Bacteria 2703
84 Ga0068853_100001843 3300005539 Bacteria 15591
85 Ga0068853_100090475 3300005539 Bacteria 2690
86 Ga0070672_100000604 3300005543 Bacteria 21079
87 Ga0070672_100266364 3300005543 Bacteria 1446
88 Ga0070686_100019386 3300005544 Bacteria 4007
89 Ga0070695_100001160 3300005545 Bacteria 14452
90 Ga0070696_100136365 3300005546 Bacteria 1789
91 Ga0070693_100003447 3300005547 Bacteria 7376
92 Ga0070693_100127546 3300005547 Bacteria 1586
93 Ga0070665_100036744 3300005548 Bacteria 4925
94 Ga0070665_100218438 3300005548 Bacteria 1907
95 Ga0070704_100013871 3300005549 Bacteria 5018
96 Ga0068855_100032533 3300005563 Bacteria 6226
97 Ga0068855_100283002 3300005563 Bacteria 1841
98 Ga0070664_100000973 3300005564 Bacteria 22427
99 Ga0070664_100134277 3300005564 Bacteria 2175
100 Ga0070664_100206729 3300005564 Bacteria 1753
101 Ga0068857_100000249 3300005577 Bacteria 36056
102 Ga0068857_100456100 3300005577 Bacteria 1196
103 Ga0068854_100000146 3300005578 Bacteria 49106
104 Ga0068854_100202140 3300005578 Bacteria 1562
105 Ga0068856_100001251 3300005614 Bacteria 26705
106 Ga0068856_100435868 3300005614 Bacteria 1331
107 Ga0070702_100002788 3300005615 Bacteria 7652
108 Ga0068852_100062458 3300005616 Bacteria 3240
109 Ga0068852_100412510 3300005616 Bacteria 1331
110 Ga0068859_100004348 3300005617 Bacteria 14455
111 Ga0068864_100000674 3300005618 Bacteria 28538
112 Ga0068866_10000294 3300005718 Bacteria 23748
113 Ga0068861_100010419 3300005719 Bacteria 6453
114 Ga0068870_10000048 3300005840 Bacteria 37476
115 Ga0068863_100000150 3300005841 Bacteria 72968
116 Ga0068858_100056787 3300005842 Bacteria 3618
117 Ga0068860_100000933 3300005843 Bacteria 32339
118 Ga0068860_100008156 3300005843 Bacteria 10426
119 Ga0068862_100003266 3300005844 Bacteria 14031
120 Ga0081455_10000091 3300005937 Bacteria 97617
121 Ga0081540_1046303 3300005983 Bacteria 2197
122 Ga0081539_10000688 3300005985 Bacteria 67723
123 Ga0075364_10020138 3300006051 Bacteria 4195
124 Ga0070715_10030348 3300006163 Bacteria 2184
125 Ga0075367_10051195 3300006178 Bacteria 2440
126 Ga0075369_10014526 3300006186 Bacteria 3147
127 Ga0075366_10041532 3300006195 Bacteria 2723
128 Ga0097621_100000833 3300006237 Bacteria 21751
129 Ga0075370_10020611 3300006353 Bacteria 3607
130 Ga0075370_10180542 3300006353 Bacteria 1242
131 Ga0068871_100004168 3300006358 Bacteria 10008
132 Ga0068871_100058075 3300006358 Bacteria 3149
133 Ga0075433_10056901 3300006852 Bacteria 3418
134 Ga0075434_100004032 3300006871 Bacteria 13167
135 Ga0075434_100241030 3300006871 Unclassified 1828
136 Ga0075434_100248577 3300006871 Bacteria 1798
137 Ga0068865_100172657 3300006881 Bacteria 1659
138 Ga0097620_100004348 3300006931 Bacteria 14455
139 Ga0075435_100113818 3300007076 Bacteria 2252
140 Ga0099794_10022927 3300007265 Bacteria 2850
141 Ga0105250_10037783 3300009092 Bacteria 1937
142 Ga0105240_10008257 3300009093 Bacteria 14906
143 Ga0105240_10024382 3300009093 Bacteria 7974
144 Ga0105240_10064245 3300009093 Bacteria 4561
145 Ga0105240_10097862 3300009093 Bacteria 3575
146 Ga0105240_10112852 3300009093 Bacteria 3285
147 Ga0105240_10481148 3300009093 Bacteria 1384
148 Ga0111539_10014004 3300009094 Bacteria 10021
149 Ga0105245_10006527 3300009098 Bacteria 10246
150 Ga0105247_10000941 3300009101 Bacteria 21940
151 Ga0105247_10044366 3300009101 Bacteria 2726
152 Ga0105247_10065834 3300009101 Bacteria 2255
153 Ga0114129_10673883 3300009147 Unclassified 1332
154 Ga0105243_10001256 3300009148 Bacteria 22778
155 Ga0105243_10132053 3300009148 Bacteria 2119
156 Ga0105241_10000934 3300009174 Bacteria 22126
157 Ga0105241_10007712 3300009174 Bacteria 7913
158 Ga0105242_10007338 3300009176 Bacteria 8485
159 Ga0105248_10001324 3300009177 Bacteria 27565
160 Ga0105248_10493114 3300009177 Bacteria 1381
161 Ga0105237_10049340 3300009545 Bacteria 4232
162 Ga0105237_10109950 3300009545 Bacteria 2748
163 Ga0105238_10006398 3300009551 Bacteria 11719
164 Ga0105238_10090586 3300009551 Bacteria 3045
165 Ga0105238_10181286 3300009551 Bacteria 2083
166 Ga0105238_10592523 3300009551 Unclassified 1116
167 Ga0105249_10046159 3300009553 Bacteria 3965
168 Ga0105249_10091420 3300009553 Bacteria 2847
169 Ga0105249_10098874 3300009553 Bacteria 2741
170 Ga0105249_10133404 3300009553 Bacteria 2373
171 Ga0099796_10063399 3300010159 Bacteria 1316
172 Ga0105239_10009156 3300010375 Bacteria 11200
173 Ga0105239_10016269 3300010375 Bacteria 8225
174 Ga0105239_10044981 3300010375 Bacteria 4839
175 Ga0105246_10015960 3300011119 Bacteria 4750
176 Ga0105246_10021163 3300011119 Bacteria 4181
177 Ga0157373_10038819 3300013100 Bacteria 3411
178 Ga0157370_10011680 3300013104 Bacteria 9168
179 Ga0157369_10003173 3300013105 Bacteria 19623
180 Ga0157369_10609022 3300013105 Bacteria 1127
181 Ga0157374_10005822 3300013296 Bacteria 10414
182 Ga0157374_10095164 3300013296 Bacteria 2847
183 Ga0157374_10320588 3300013296 Bacteria 1536
184 Ga0157378_10005464 3300013297 Bacteria 11135
185 Ga0157378_10144610 3300013297 Bacteria 2211
186 Ga0163162_10004345 3300013306 Bacteria 13643
187 Ga0163162_10028138 3300013306 Bacteria 5559
188 Ga0163162_10043443 3300013306 Bacteria 4500
189 Ga0163162_10050383 3300013306 Bacteria 4176
190 Ga0163162_10294948 3300013306 Bacteria 1753
191 Ga0157372_10108377 3300013307 Bacteria 3179
192 Ga0157372_10125281 3300013307 Bacteria 2953
193 Ga0157375_10000181 3300013308 Bacteria 59305
194 Ga0157375_10058733 3300013308 Bacteria 3807
195 Ga0163163_10036667 3300014325 Bacteria 4765
196 Ga0163163_10106705 3300014325 Bacteria 2827
197 Ga0163163_10113684 3300014325 Bacteria 2737
198 Ga0157380_10035343 3300014326 Bacteria 3859
199 Ga0157377_10000101 3300014745 Bacteria 60248
200 Ga0157379_10007707 3300014968 Bacteria 9323
201 Ga0157379_10151560 3300014968 Bacteria 2091
202 Ga0157379_10218676 3300014968 Bacteria 1726
203 Ga0157379_10406052 3300014968 Bacteria 1253
204 Ga0157376_10002670 3300014969 Bacteria 12111
205 Ga0157376_10023945 3300014969 Bacteria 4788
206 Ga0157376_10142104 3300014969 Bacteria 2155
207 Ga0163161_10000081 3300017792 Bacteria 97213
208 Ga0163161_10012264 3300017792 Bacteria 5947
209 Ga0163161_10139014 3300017792 Bacteria 1838
210 Ga0209026_1000002 3300025250 Bacteria 1136158
211 Ga0209759_1000179 3300025256 Bacteria 105045
212 Ga0209233_1015417 3300025261 Bacteria 2128
213 Ga0207666_1000044 3300025271 Bacteria 24638
214 Ga0207673_1000003 3300025290 Bacteria 18000
215 Ga0209564_1005880 3300025295 Bacteria 6807
216 Ga0209758_1004207 3300025297 Bacteria 12193
217 Ga0209758_1034176 3300025297 Bacteria 2028
218 Ga0209256_1018266 3300025299 Bacteria 2289
219 Ga0207426_1000585 3300025302 Bacteria 48529
220 Ga0207426_1000940 3300025302 Bacteria 28937
221 Ga0209257_1010255 3300025304 Bacteria 4789
222 Ga0207697_10000051 3300025315 Bacteria 47188
223 Ga0207697_10012113 3300025315 Bacteria 3629
224 Ga0207656_10156751 3300025321 Bacteria 1081
225 Ga0207696_1027191 3300025711 Bacteria 1764
226 Ga0207682_10000635 3300025893 Bacteria 16359
227 Ga0207682_10129887 3300025893 Bacteria 1124
228 Ga0207642_10001582 3300025899 Bacteria 7021
229 Ga0207642_10095251 3300025899 Bacteria 1481
230 Ga0207710_10010489 3300025900 Bacteria 3903
231 Ga0207688_10000044 3300025901 Bacteria 43600
232 Ga0207688_10045405 3300025901 Bacteria 2451
233 Ga0207680_10021188 3300025903 Bacteria 3513
234 Ga0207647_10009182 3300025904 Bacteria 7035
235 Ga0207647_10029104 3300025904 Bacteria 3579
236 Ga0207647_10079947 3300025904 Bacteria 1961
237 Ga0207645_10000218 3300025907 Bacteria 47372
238 Ga0207645_10201099 3300025907 Bacteria 1311
239 Ga0207643_10000025 3300025908 Bacteria 101583
240 Ga0207705_10051099 3300025909 Bacteria 2976
241 Ga0207654_10002253 3300025911 Bacteria 9891
242 Ga0207654_10030537 3300025911 Bacteria 2959
243 Ga0207654_10065104 3300025911 Bacteria 2145
244 Ga0207707_10013970 3300025912 Bacteria 7001
245 Ga0207695_10001910 3300025913 Bacteria 32431
246 Ga0207695_10073614 3300025913 Bacteria 3480
247 Ga0207671_10017371 3300025914 Bacteria 5550
248 Ga0207671_10018089 3300025914 Bacteria 5416
249 Ga0207671_10067782 3300025914 Bacteria 2658
250 Ga0207671_10090858 3300025914 Bacteria 2300
251 Ga0207663_10141243 3300025916 Bacteria 1678
252 Ga0207660_10000571 3300025917 Bacteria 24778
253 Ga0207660_10105428 3300025917 Bacteria 2112
254 Ga0207662_10000100 3300025918 Bacteria 40845
255 Ga0207662_10011276 3300025918 Bacteria 4949
256 Ga0207657_10000699 3300025919 Bacteria 35613
257 Ga0207657_10020703 3300025919 Bacteria 6210
258 Ga0207657_10067687 3300025919 Bacteria 3036
259 Ga0207657_10117712 3300025919 Bacteria 2188
260 Ga0207649_10000310 3300025920 Bacteria 37179
261 Ga0207649_10012111 3300025920 Bacteria 4773
262 Ga0207649_10091141 3300025920 Bacteria 1996
263 Ga0207652_10007174 3300025921 Bacteria 8989
264 Ga0207652_10132387 3300025921 Bacteria 2225
265 Ga0207681_10000803 3300025923 Bacteria 20696
266 Ga0207681_10062275 3300025923 Bacteria 2568
267 Ga0207694_10004988 3300025924 Bacteria 10270
268 Ga0207694_10068654 3300025924 Bacteria 2768
269 Ga0207650_10003666 3300025925 Bacteria 10506
270 Ga0207659_10000040 3300025926 Bacteria 91375
271 Ga0207687_10001077 3300025927 Bacteria 18525
272 Ga0207687_10150747 3300025927 Bacteria 1774
273 Ga0207644_10010213 3300025931 Bacteria 6187
274 Ga0207690_10000277 3300025932 Bacteria 36311
275 Ga0207706_10019964 3300025933 Bacteria 6023
276 Ga0207706_10071818 3300025933 Bacteria 3045
277 Ga0207706_10072378 3300025933 Bacteria 3032
278 Ga0207706_10188470 3300025933 Bacteria 1811
279 Ga0207686_10001074 3300025934 Bacteria 16034
280 Ga0207709_10000322 3300025935 Bacteria 51855
281 Ga0207709_10058104 3300025935 Bacteria 2402
282 Ga0207670_10000240 3300025936 Bacteria 34666
283 Ga0207670_10067040 3300025936 Bacteria 2468
284 Ga0207669_10000347 3300025937 Bacteria 21120
285 Ga0207704_10000071 3300025938 Bacteria 64527
286 Ga0207704_10034733 3300025938 Bacteria 2880
287 Ga0207665_10076213 3300025939 Bacteria 2299
288 Ga0207691_10020341 3300025940 Bacteria 6274
289 Ga0207691_10055610 3300025940 Bacteria 3605
290 Ga0207691_10057750 3300025940 Bacteria 3530
291 Ga0207711_10008494 3300025941 Bacteria 8592
292 Ga0207689_10000134 3300025942 Bacteria 62937
293 Ga0207661_10000191 3300025944 Bacteria 39865
294 Ga0207679_10000099 3300025945 Bacteria 74047
295 Ga0207667_10035144 3300025949 Bacteria 5377
296 Ga0207651_10000202 3300025960 Bacteria 26070
297 Ga0207712_10008376 3300025961 Bacteria 6534
298 Ga0207712_10045723 3300025961 Bacteria 3033
299 Ga0207712_10095181 3300025961 Bacteria 2202
300 Ga0207712_10153441 3300025961 Bacteria 1781
301 Ga0207668_10001518 3300025972 Bacteria 13565
302 Ga0207640_10000425 3300025981 Bacteria 26102
303 Ga0207658_10011015 3300025986 Bacteria 6156
304 Ga0207658_10245415 3300025986 Bacteria 1519
305 Ga0207677_10001828 3300026023 Bacteria 11238
306 Ga0207703_10002520 3300026035 Bacteria 15828
307 Ga0207639_10001207 3300026041 Bacteria 17550
308 Ga0207639_10043948 3300026041 Bacteria 3357
309 Ga0207678_10000131 3300026067 Bacteria 62864
310 Ga0207678_10035421 3300026067 Bacteria 4346
311 Ga0207708_10000636 3300026075 Bacteria 26970
312 Ga0207708_10013891 3300026075 Bacteria 6019
313 Ga0207702_10005475 3300026078 Bacteria 11103
314 Ga0207641_10000246 3300026088 Bacteria 70235
315 Ga0207648_10001831 3300026089 Bacteria 23254
316 Ga0207648_10048491 3300026089 Bacteria 3718
317 Ga0207676_10003753 3300026095 Bacteria 10733
318 Ga0207674_10000355 3300026116 Bacteria 59230
319 Ga0207674_10065399 3300026116 Bacteria 3665
320 Ga0207674_10229786 3300026116 Bacteria 1803
321 Ga0207675_100050507 3300026118 Bacteria 3880
322 Ga0207675_100275818 3300026118 Bacteria 1633
323 Ga0207683_10000924 3300026121 Bacteria 26999
324 Ga0207698_10007113 3300026142 Bacteria 7009
325 Ga0207698_10147732 3300026142 Bacteria 2035
326 Ga0209967_1003457 3300027364 Bacteria 2081
327 Ga0210002_1007590 3300027617 Bacteria 1646
328 Ga0209966_1003991 3300027695 Bacteria 2489
329 Ga0209998_10000617 3300027717 Bacteria 9565
330 Ga0209998_10003620 3300027717 Bacteria 3355
331 Ga0209974_10006665 3300027876 Bacteria 4016
332 Ga0207428_10000619 3300027907 Bacteria 41940
333 Ga0207428_10000736 3300027907 Bacteria 37641
334 Ga0268266_10042528 3300028379 Bacteria 3881
335 Ga0268266_10356906 3300028379 Bacteria 1375
336 Ga0268265_10001326 3300028380 Bacteria 21194
337 Ga0268265_10038808 3300028380 Bacteria 3505
338 Ga0268264_10001756 3300028381 Bacteria 19870
339 Ga0268264_10004840 3300028381 Bacteria 11410
340 Ga0268264_10140117 3300028381 Bacteria 2156
341 Ga0268264_10260301 3300028381 Bacteria 1616
342 Ga0265328_10005420 3300031239 Bacteria 5465
343 Ga0265328_10038717 3300031239 Bacteria 1759
344 Ga0265340_10001400 3300031247 Bacteria 13835
345 Ga0265339_10000750 3300031249 Bacteria 25047
346 Ga0265331_10010819 3300031250 Bacteria 5019
347 Ga0265331_10039335 3300031250 Bacteria 2307
348 Ga0265327_10000042 3300031251 Bacteria 287487
349 Ga0265327_10059536 3300031251 Bacteria 1955
350 Ga0265316_10027426 3300031344 Bacteria 4716
351 Ga0307412_10031766 3300031911 Bacteria 3338
352 Ga0307510_10007534 3300033180 Bacteria 12965
353 Ga0373930_0000078 3300034816 Bacteria 9693
354 Ga0373948_0004854 3300034817 Bacteria 2148
355 Ga0373950_0000147 3300034818 Bacteria 11031
356 Ga0373958_0000448 3300034819 Bacteria 5041
357 Ga0373938_0000088 3300034957 Bacteria 12397
358 Ga0373938_0002327 3300034957 Bacteria 3059
359 Ga0373928_0000155 3300035084 Bacteria 13147
360 Ga0373928_0010761 3300035084 Bacteria 1801
361 Ga0373929_0000305 3300035085 Bacteria 9120
362 Ga0373940_0027875 3300035088 Bacteria 1487
363 Ga0373949_0003674 3300035090 Bacteria 3600
364 Ga0373949_0005296 3300035090 Bacteria 2884
365 Ga0373951_0001680 3300035091 Bacteria 5784
366 Ga0373952_0000083 3300035092 Bacteria 12572
367 Ga0373952_0002787 3300035092 Bacteria 3158
368 Ga0373932_0000178 3300035112 Bacteria 18612
369 Ga0373932_0007376 3300035112 Bacteria 2617
370 Ga0373939_0000267 3300035114 Bacteria 13972
371 Ga0373941_0000025 3300035115 Bacteria 22499
372 Ga0373941_0001747 3300035115 Bacteria 4668
373 Ga0373960_0000224 3300035121 Bacteria 10478
374 Ga0373942_0005537 3300035207 Bacteria 2926
375 Ga0373961_0002443 3300035241 Bacteria 4817
376 Ga0373961_0065541 3300035241 Bacteria 1112
377 Ga0373962_0000704 3300035242 Bacteria 7552
378 Ga0373931_0000485 3300035691 Bacteria 16212
379 Ga0373947_0059697 3300035725 Bacteria 2313
380 Ga0373937_0779361 3300036401 Bacteria 904
381 Ga0373925_0004262 3300037068 Bacteria 10835
382 Ga0436364_1133108 3300037853 Bacteria 16676
383 Ga0436361_0276372 3300039447 Bacteria 2678
384 Ga0439464_0017284 3300042439 Bacteria 1955
385 Ga0451577_0383248 3300042876 Bacteria 1276
386 Ga0466963_0024092 3300044694 Bacteria 3872
387 Ga0453684_0019534 3300044712 Bacteria 10304
388 Ga0453684_0055626 3300044712 Bacteria 5143
389 Ga0451576_0023167 3300045051 Bacteria 6728
390 Ga0466967_0385963 3300045976 Bacteria 1360
391 Ga0495592_0019746 3300046454 Bacteria 5126
392 Ga0495638_0011951 3300046460 Bacteria 5968
393 Ga0495651_0035852 3300046462 Bacteria 3861
394 Ga0495662_0160951 3300046476 Bacteria 1106
395 Ga0495664_0006730 3300046477 Bacteria 6354
396 Ga0495608_0046353 3300046511 Bacteria 2892
397 Ga0495610_0044074 3300046512 Bacteria 2218
398 Ga0495628_0038332 3300046516 Bacteria 3836
399 Ga0495643_0067996 3300046522 Bacteria 1875
400 Ga0495648_0001461 3300046524 Bacteria 23127
401 Ga0495648_0035081 3300046524 Bacteria 3255
402 Ga0495652_0027659 3300046529 Bacteria 4995
403 Ga0495652_0150516 3300046529 Bacteria 1819
404 Ga0495640_0025774 3300046533 Bacteria 4259
405 Ga0495587_0046627 3300046536 Bacteria 2571
406 Ga0495645_0002931 3300046543 Bacteria 11571
407 Ga0495645_0028256 3300046543 Bacteria 4076
408 Ga0495667_0004975 3300046559 Bacteria 8988
409 Ga0495668_0047963 3300046616 Bacteria 2371
410 Ga0495634_0181090 3300046642 Bacteria 1319
411 Ga0495625_0069301 3300046660 Bacteria 2478
412 Ga0495625_0080757 3300046660 Bacteria 2264
413 Ga0495635_0184251 3300046663 Bacteria 1419
414 Ga0495657_0017945 3300046675 Bacteria 5131
415 Ga0495599_0011075 3300046678 Bacteria 5533
416 Ga0495623_0003022 3300046679 Bacteria 11071
417 Ga0495646_0038861 3300046680 Bacteria 2936
418 Ga0495600_0022124 3300046809 Bacteria 4080
419 Ga0495604_0002686 3300047317 Bacteria 14260
420 Ga0495604_0064495 3300047317 Bacteria 2791
421 Ga0495674_0039141 3300047319 Bacteria 4251
422 Ga0495680_0011780 3300047322 Bacteria 7724
423 Ga0495680_0176621 3300047322 Bacteria 1544
424 Ga0495687_009490 3300047443 Bacteria 5432
425 Ga0495675_0022594 3300047444 Bacteria 4010
426 Ga0495675_0163511 3300047444 Unclassified 1370
427 Ga0495684_0020423 3300047471 Bacteria 5104
428 Ga0495602_0160536 3300048088 Bacteria 1755
429 Ga0496100_0000599 3300048903 Bacteria 17022
430 Ga0496100_0102446 3300048903 Bacteria 1975
431 Ga0496101_0000494 3300048904 Bacteria 24861
432 Ga0496101_0068295 3300048904 Bacteria 2598
433 Ga0496102_0002665 3300048905 Bacteria 15185
434 Ga0496102_0022505 3300048905 Bacteria 5585
435 Ga0496102_0025384 3300048905 Bacteria 5275
436 Ga0496103_0001970 3300048906 Bacteria 13275
437 Ga0496103_0005633 3300048906 Bacteria 7487
438 Ga0496104_0101799 3300048907 Bacteria 2751
439 Ga0496104_0143970 3300048907 Bacteria 2289
440 Ga0496105_0161382 3300048908 Bacteria 1840
441 Ga0496106_0001843 3300048909 Bacteria 15866
442 Ga0496106_0056838 3300048909 Bacteria 2958
443 Ga0496107_0001078 3300048910 Bacteria 16394
444 Ga0496107_0021905 3300048910 Bacteria 4515
445 Ga0496108_0018052 3300048911 Bacteria 5771
446 Ga0496108_0039319 3300048911 Bacteria 3943
447 Ga0496108_0085932 3300048911 Bacteria 2671
448 Ga0496109_0000150 3300048912 Bacteria 68777
449 Ga0496109_0009007 3300048912 Bacteria 8500
450 Ga0496109_0098172 3300048912 Bacteria 2715
451 Ga0496110_0002801 3300048913 Bacteria 13162
452 Ga0496110_0041508 3300048913 Bacteria 4015
453 Ga0496110_0091438 3300048913 Bacteria 2722
454 Ga0496110_0128954 3300048913 Bacteria 2283
455 Ga0496110_0335247 3300048913 Bacteria 1378
456 Ga0496111_0297244 3300048914 Bacteria 1197
457 Ga0496112_0088574 3300048915 Bacteria 3063
458 Ga0496114_0003461 3300048917 Bacteria 12111
459 Ga0496114_0112499 3300048917 Bacteria 2334
460 Ga0496115_0029316 3300048918 Bacteria 4321
461 Ga0496115_0139849 3300048918 Bacteria 1997
462 Ga0496117_0025016 3300048920 Bacteria 4703
463 Ga0496118_0033674 3300048921 Bacteria 4198
464 Ga0496121_0105683 3300048924 Bacteria 2160
465 Ga0496125_0085991 3300048928 Bacteria 2380
466 Ga0495682_0014510 3300049460 Bacteria 2987
467 Ga0501033_0095139 3300049570 Bacteria 2177
468 Ga0501034_0048722 3300049571 Bacteria 4276
469 Ga0501043_0142997 3300049579 Bacteria 1873
470 Ga0501047_0036295 3300049581 Bacteria 4764
471 Ga0501035_0000121 3300049822 Bacteria 94497
472 Ga0501044_0001588 3300049823 Bacteria 26614
473 nmdc:mga0yw44_213129_c1 3300050492 Bacteria 1278
474 nmdc:mga08y16_1035_c1 3300050511 Bacteria 27236
475 nmdc:mga08y16_239618_c1 3300050511 Unclassified 1875
476 nmdc:mga08y16_550_c1 3300050511 Bacteria 34754
477 nmdc:mga0n895_18776_c1 3300050512 Bacteria 6407
478 nmdc:mga0n895_242763_c1 3300050512 Unclassified 1828
479 nmdc:mga0n895_247001_c1 3300050512 Bacteria 1811
480 nmdc:mga0n895_483865_c1 3300050512 Unclassified 1248
481 nmdc:mga0n895_559823_c1 3300050512 Bacteria 1148
482 nmdc:mga0rr50_140408_c1 3300050513 Bacteria 1943
483 nmdc:mga0a205_41319_c1 3300050515 Bacteria 4440
484 Ga0495601_0002367 3300053077 Bacteria 10681
485 Ga0495619_0001486 3300053085 Bacteria 15437
486 Ga0495619_0112820 3300053085 Bacteria 1859
487 Ga0500643_000091 3300053087 Bacteria 93825
488 Ga0500566_0000199 3300053094 Bacteria 31473
489 Ga0500562_005656 3300053108 Bacteria 3145
490 Ga0500572_006203 3300053111 Bacteria 2731
491 Ga0500592_004342 3300053116 Bacteria 2260
492 Ga0500614_019139 3300053123 Bacteria 1565
493 Ga0500658_0003734 3300053134 Bacteria 5735
494 Ga0500564_036399 3300053138 Bacteria 2270
495 Ga0500590_051976 3300053148 Bacteria 2080
496 Ga0500604_0015661 3300053151 Bacteria 2080
497 Ga0500616_0006124 3300053153 Bacteria 7958
498 Ga0500619_012133 3300053154 Bacteria 2241
499 Ga0500633_0019485 3300053160 Bacteria 2029
500 Ga0500638_071849 3300053162 Bacteria 1653
501 Ga0500636_0000291 3300053177 Bacteria 27724
502 Ga0500637_0002013 3300053178 Bacteria 8861
503 Ga0500637_0127860 3300053178 Bacteria 1474
504 Ga0500609_002103 3300053731 Bacteria 2854
505 Ga0500601_001037 3300053737 Bacteria 3177
506 2511400231 2511231028 Bacteria 8046582
507 2513647985 2513237095 Bacteria 8976980
508 2513715687 2513237104 Bacteria 10034502
509 2818237257 2816332527 Bacteria 8933356
510 2824708487 2824704595 Bacteria 9667483
511 2824757137 2824753945 Bacteria 9787441
512 2824772076 2824763712 Bacteria 9792355
513 2841964636 2841957949 Bacteria 8652217
514 2874125743 2874123672 Bacteria 7238285
515 2874636684 2874628541 Bacteria 8630250
516 2888379989 2888378607 Bacteria 9652610
517 2904716160 2904711408 Bacteria 9771557
518 3003932676 3003930520 Bacteria 5667563
519 3005724939 3005718088 Bacteria 8283608
520 8056970892 8056967851 Bacteria 9038162
521 Ga0111539_10001265
522 SwRhRL2b_contig_3023270
523 2214739658
524 ARcpr5oldR_c000577
525 ARcpr5oldR_c000621
526 ARSoilYngRDRAFT_c00518
527 ARcpr5yngRDRAFT_c000019
528 ARSoilOldRDRAFT_c000185
529 ARCol0yngRDRAFT_1000196
530 JGI24739J22299_10003373
531 JGI24737J22298_10001973
532 JGI24750J21931_1001200
533 JGI24745J21846_1000037
534 JGI24738J21930_10000785
535 JGI24749J21850_1001233
536 JGI24744J21845_10001682
537 JGI24035J26624_1000442
538 JGI24033J26618_1004042
539 JGI24034J26672_10001345
540 JGI24742J22300_10000043
541 JGI25156J39149_1000922
542 JGI25157J39369_1000053
543 JGI25153J46596_10003314
544 rootH2_10123078
545 JGI25160J50197_1007526
546 JGI25405J52794_10006617
547 Ga0055543_1002478
548 Ga0065165_1001304
549 Ga0065165_1002635
550 Ga0065165_1040664
551 Ga0065716_1001570
552 Ga0065704_10092692
553 Ga0065712_10069066
554 Ga0065715_10010906
555 Ga0065715_10097062
556 Ga0065707_10103728
557 Ga0070683_100000656
558 Ga0070683_100154655
559 Ga0070690_100006625
560 Ga0070677_10000076
561 Ga0068869_100001086
562 Ga0070666_10021987
563 Ga0070666_10165966
564 Ga0070680_100008723
565 Ga0070682_100000285
566 Ga0068868_100001772
567 Ga0070660_100000874
568 Ga0070660_100025003
569 Ga0070689_100004587
570 Ga0070691_10001213
571 Ga0070687_100000185
572 Ga0070687_100179351
573 Ga0070661_100004546
574 Ga0070692_10003343
575 Ga0070668_100005755
576 Ga0070669_100291516
577 Ga0070675_100000622
578 Ga0070671_100169891
579 Ga0070674_100006042
580 Ga0070673_100000640
581 Ga0070659_100000720
582 Ga0070667_100050340
583 Ga0070703_10003623
584 Ga0070705_100003031
585 Ga0070700_100001785
586 Ga0070694_100002993
587 Ga0070708_100188028
588 Ga0070708_100224748
589 Ga0070663_100003686
590 Ga0070678_100003113
591 Ga0070662_100003674
592 Ga0070662_100036251
593 Ga0070662_100340072
594 Ga0070681_10000446
595 Ga0068867_100003601
596 Ga0070685_10000645
597 Ga0070698_100005598
598 Ga0070698_100532573
599 Ga0070679_100004065
600 Ga0070679_100265048
601 Ga0070684_100002245
602 Ga0070684_100181445
603 Ga0070697_100079305
604 Ga0068853_100001843
605 Ga0068853_100090475
606 Ga0070672_100000604
607 Ga0070672_100266364
608 Ga0070686_100019386
609 Ga0070695_100001160
610 Ga0070696_100136365
611 Ga0070693_100003447
612 Ga0070693_100127546
613 Ga0070665_100036744
614 Ga0070665_100218438
615 Ga0070704_100013871
616 Ga0068855_100032533
617 Ga0068855_100283002
618 Ga0070664_100000973
619 Ga0070664_100134277
620 Ga0070664_100206729
621 Ga0068857_100000249
622 Ga0068857_100456100
623 Ga0068854_100000146
624 Ga0068854_100202140
625 Ga0068856_100001251
626 Ga0068856_100435868
627 Ga0070702_100002788
628 Ga0068852_100062458
629 Ga0068852_100412510
630 Ga0068859_100004348
631 Ga0068864_100000674
632 Ga0068866_10000294
633 Ga0068861_100010419
634 Ga0068870_10000048
635 Ga0068863_100000150
636 Ga0068858_100056787
637 Ga0068860_100000933
638 Ga0068860_100008156
639 Ga0068862_100003266
640 Ga0081455_10000091
641 Ga0081540_1046303
642 Ga0081539_10000688
643 Ga0075364_10020138
644 Ga0070715_10030348
645 Ga0075367_10051195
646 Ga0075369_10014526
647 Ga0075366_10041532
648 Ga0097621_100000833
649 Ga0075370_10020611
650 Ga0075370_10180542
651 Ga0068871_100004168
652 Ga0068871_100058075
653 Ga0075433_10056901
654 Ga0075434_100004032
655 Ga0075434_100241030
656 Ga0075434_100248577
657 Ga0068865_100172657
658 Ga0097620_100004348
659 Ga0075435_100113818
660 Ga0099794_10022927
661 Ga0105250_10037783
662 Ga0105240_10008257
663 Ga0105240_10024382
664 Ga0105240_10064245
665 Ga0105240_10097862
666 Ga0105240_10112852
667 Ga0105240_10481148
668 Ga0111539_10014004
669 Ga0105245_10006527
670 Ga0105247_10000941
671 Ga0105247_10044366
672 Ga0105247_10065834
673 Ga0114129_10673883
674 Ga0105243_10001256
675 Ga0105243_10132053
676 Ga0105241_10000934
677 Ga0105241_10007712
678 Ga0105242_10007338
679 Ga0105248_10001324
680 Ga0105248_10493114
681 Ga0105237_10049340
682 Ga0105237_10109950
683 Ga0105238_10006398
684 Ga0105238_10090586
685 Ga0105238_10181286
686 Ga0105238_10592523
687 Ga0105249_10046159
688 Ga0105249_10091420
689 Ga0105249_10098874
690 Ga0105249_10133404
691 Ga0099796_10063399
692 Ga0105239_10009156
693 Ga0105239_10016269
694 Ga0105239_10044981
695 Ga0105246_10015960
696 Ga0105246_10021163
697 Ga0157373_10038819
698 Ga0157370_10011680
699 Ga0157369_10003173
700 Ga0157369_10609022
701 Ga0157374_10005822
702 Ga0157374_10095164
703 Ga0157374_10320588
704 Ga0157378_10005464
705 Ga0157378_10144610
706 Ga0163162_10004345
707 Ga0163162_10028138
708 Ga0163162_10043443
709 Ga0163162_10050383
710 Ga0163162_10294948
711 Ga0157372_10108377
712 Ga0157372_10125281
713 Ga0157375_10000181
714 Ga0157375_10058733
715 Ga0163163_10036667
716 Ga0163163_10106705
717 Ga0163163_10113684
718 Ga0157380_10035343
719 Ga0157377_10000101
720 Ga0157379_10007707
721 Ga0157379_10151560
722 Ga0157379_10218676
723 Ga0157379_10406052
724 Ga0157376_10002670
725 Ga0157376_10023945
726 Ga0157376_10142104
727 Ga0163161_10000081
728 Ga0163161_10012264
729 Ga0163161_10139014
730 Ga0209026_1000002
731 Ga0209759_1000179
732 Ga0209233_1015417
733 Ga0207666_1000044
734 Ga0207673_1000003
735 Ga0209564_1005880
736 Ga0209758_1004207
737 Ga0209758_1034176
738 Ga0209256_1018266
739 Ga0207426_1000585
740 Ga0207426_1000940
741 Ga0209257_1010255
742 Ga0207697_10000051
743 Ga0207697_10012113
744 Ga0207656_10156751
745 Ga0207696_1027191
746 Ga0207682_10000635
747 Ga0207682_10129887
748 Ga0207642_10001582
749 Ga0207642_10095251
750 Ga0207710_10010489
751 Ga0207688_10000044
752 Ga0207688_10045405
753 Ga0207680_10021188
754 Ga0207647_10009182
755 Ga0207647_10029104
756 Ga0207647_10079947
757 Ga0207645_10000218
758 Ga0207645_10201099
759 Ga0207643_10000025
760 Ga0207705_10051099
761 Ga0207654_10002253
762 Ga0207654_10030537
763 Ga0207654_10065104
764 Ga0207707_10013970
765 Ga0207695_10001910
766 Ga0207695_10073614
767 Ga0207671_10017371
768 Ga0207671_10018089
769 Ga0207671_10067782
770 Ga0207671_10090858
771 Ga0207663_10141243
772 Ga0207660_10000571
773 Ga0207660_10105428
774 Ga0207662_10000100
775 Ga0207662_10011276
776 Ga0207657_10000699
777 Ga0207657_10020703
778 Ga0207657_10067687
779 Ga0207657_10117712
780 Ga0207649_10000310
781 Ga0207649_10012111
782 Ga0207649_10091141
783 Ga0207652_10007174
784 Ga0207652_10132387
785 Ga0207681_10000803
786 Ga0207681_10062275
787 Ga0207694_10004988
788 Ga0207694_10068654
789 Ga0207650_10003666
790 Ga0207659_10000040
791 Ga0207687_10001077
792 Ga0207687_10150747
793 Ga0207644_10010213
794 Ga0207690_10000277
795 Ga0207706_10019964
796 Ga0207706_10071818
797 Ga0207706_10072378
798 Ga0207706_10188470
799 Ga0207686_10001074
800 Ga0207709_10000322
801 Ga0207709_10058104
802 Ga0207670_10000240
803 Ga0207670_10067040
804 Ga0207669_10000347
805 Ga0207704_10000071
806 Ga0207704_10034733
807 Ga0207665_10076213
808 Ga0207691_10020341
809 Ga0207691_10055610
810 Ga0207691_10057750
811 Ga0207711_10008494
812 Ga0207689_10000134
813 Ga0207661_10000191
814 Ga0207679_10000099
815 Ga0207667_10035144
816 Ga0207651_10000202
817 Ga0207712_10008376
818 Ga0207712_10045723
819 Ga0207712_10095181
820 Ga0207712_10153441
821 Ga0207668_10001518
822 Ga0207640_10000425
823 Ga0207658_10011015
824 Ga0207658_10245415
825 Ga0207677_10001828
826 Ga0207703_10002520
827 Ga0207639_10001207
828 Ga0207639_10043948
829 Ga0207678_10000131
830 Ga0207678_10035421
831 Ga0207708_10000636
832 Ga0207708_10013891
833 Ga0207702_10005475
834 Ga0207641_10000246
835 Ga0207648_10001831
836 Ga0207648_10048491
837 Ga0207676_10003753
838 Ga0207674_10000355
839 Ga0207674_10065399
840 Ga0207674_10229786
841 Ga0207675_100050507
842 Ga0207675_100275818
843 Ga0207683_10000924
844 Ga0207698_10007113
845 Ga0207698_10147732
846 Ga0209967_1003457
847 Ga0210002_1007590
848 Ga0209966_1003991
849 Ga0209998_10000617
850 Ga0209998_10003620
851 Ga0209974_10006665
852 Ga0207428_10000619
853 Ga0207428_10000736
854 Ga0268266_10042528
855 Ga0268266_10356906
856 Ga0268265_10001326
857 Ga0268265_10038808
858 Ga0268264_10001756
859 Ga0268264_10004840
860 Ga0268264_10140117
861 Ga0268264_10260301
862 Ga0265328_10005420
863 Ga0265328_10038717
864 Ga0265340_10001400
865 Ga0265339_10000750
866 Ga0265331_10010819
867 Ga0265331_10039335
868 Ga0265327_10000042
869 Ga0265327_10059536
870 Ga0265316_10027426
871 Ga0307412_10031766
872 Ga0307510_10007534
873 Ga0373930_0000078
874 Ga0373948_0004854
875 Ga0373950_0000147
876 Ga0373958_0000448
877 Ga0373938_0000088
878 Ga0373938_0002327
879 Ga0373928_0000155
880 Ga0373928_0010761
881 Ga0373929_0000305
882 Ga0373940_0027875
883 Ga0373949_0003674
884 Ga0373949_0005296
885 Ga0373951_0001680
886 Ga0373952_0000083
887 Ga0373952_0002787
888 Ga0373932_0000178
889 Ga0373932_0007376
890 Ga0373939_0000267
891 Ga0373941_0000025
892 Ga0373941_0001747
893 Ga0373960_0000224
894 Ga0373942_0005537
895 Ga0373961_0002443
896 Ga0373961_0065541
897 Ga0373962_0000704
898 Ga0373931_0000485
899 Ga0373947_0059697
900 Ga0373937_0779361
901 Ga0373925_0004262
902 Ga0436364_1133108
903 Ga0436361_0276372
904 Ga0439464_0017284
905 Ga0451577_0383248
906 Ga0466963_0024092
907 Ga0453684_0019534
908 Ga0453684_0055626
909 Ga0451576_0023167
910 Ga0466967_0385963
911 Ga0495592_0019746
912 Ga0495638_0011951
913 Ga0495651_0035852
914 Ga0495662_0160951
915 Ga0495664_0006730
916 Ga0495608_0046353
917 Ga0495610_0044074
918 Ga0495628_0038332
919 Ga0495643_0067996
920 Ga0495648_0001461
921 Ga0495648_0035081
922 Ga0495652_0027659
923 Ga0495652_0150516
924 Ga0495640_0025774
925 Ga0495587_0046627
926 Ga0495645_0002931
927 Ga0495645_0028256
928 Ga0495667_0004975
929 Ga0495668_0047963
930 Ga0495634_0181090
931 Ga0495625_0069301
932 Ga0495625_0080757
933 Ga0495635_0184251
934 Ga0495657_0017945
935 Ga0495599_0011075
936 Ga0495623_0003022
937 Ga0495646_0038861
938 Ga0495600_0022124
939 Ga0495604_0002686
940 Ga0495604_0064495
941 Ga0495674_0039141
942 Ga0495680_0011780
943 Ga0495680_0176621
944 Ga0495687_009490
945 Ga0495675_0022594
946 Ga0495675_0163511
947 Ga0495684_0020423
948 Ga0495602_0160536
949 Ga0496100_0000599
950 Ga0496100_0102446
951 Ga0496101_0000494
952 Ga0496101_0068295
953 Ga0496102_0002665
954 Ga0496102_0022505
955 Ga0496102_0025384
956 Ga0496103_0001970
957 Ga0496103_0005633
958 Ga0496104_0101799
959 Ga0496104_0143970
960 Ga0496105_0161382
961 Ga0496106_0001843
962 Ga0496106_0056838
963 Ga0496107_0001078
964 Ga0496107_0021905
965 Ga0496108_0018052
966 Ga0496108_0039319
967 Ga0496108_0085932
968 Ga0496109_0000150
969 Ga0496109_0009007
970 Ga0496109_0098172
971 Ga0496110_0002801
972 Ga0496110_0041508
973 Ga0496110_0091438
974 Ga0496110_0128954
975 Ga0496110_0335247
976 Ga0496111_0297244
977 Ga0496112_0088574
978 Ga0496114_0003461
979 Ga0496114_0112499
980 Ga0496115_0029316
981 Ga0496115_0139849
982 Ga0496117_0025016
983 Ga0496118_0033674
984 Ga0496121_0105683
985 Ga0496125_0085991
986 Ga0495682_0014510
987 Ga0501033_0095139
988 Ga0501034_0048722
989 Ga0501043_0142997
990 Ga0501047_0036295
991 Ga0501035_0000121
992 Ga0501044_0001588
993 nmdc:mga0yw44_213129_c1
994 nmdc:mga08y16_1035_c1
995 nmdc:mga08y16_239618_c1
996 nmdc:mga08y16_550_c1
997 nmdc:mga0n895_18776_c1
998 nmdc:mga0n895_242763_c1
999 nmdc:mga0n895_247001_c1
1000 nmdc:mga0n895_483865_c1
1001 nmdc:mga0n895_559823_c1
1002 nmdc:mga0rr50_140408_c1
1003 nmdc:mga0a205_41319_c1
1004 Ga0495601_0002367
1005 Ga0495619_0001486
1006 Ga0495619_0112820
1007 Ga0500643_000091
1008 Ga0500566_0000199
1009 Ga0500562_005656
1010 Ga0500572_006203
1011 Ga0500592_004342
1012 Ga0500614_019139
1013 Ga0500658_0003734
1014 Ga0500564_036399
1015 Ga0500590_051976
1016 Ga0500604_0015661
1017 Ga0500616_0006124
1018 Ga0500619_012133
1019 Ga0500633_0019485
1020 Ga0500638_071849
1021 Ga0500636_0000291
1022 Ga0500637_0002013
1023 Ga0500637_0127860
1024 Ga0500609_002103
1025 Ga0500601_001037
1026 2511400231
1027 2513647985
1028 2513715687
1029 2818237257
1030 2824708487
1031 2824757137
1032 2824772076
1033 2841964636
1034 2874125743
1035 2874636684
1036 2888379989
1037 2904716160
1038 3003932676
1039 3005724939
1040 8056970892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02868

Peptidase_M4_C

Thermolysin metallopeptidase, alpha-helical domain

232

395

0.93

PF01447

Peptidase_M4

Thermolysin metallopeptidase, catalytic domain

110

229

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fhp-assembly1.cif.gz_C daip in complex with a c-terminal fragment of thermolysin 0.8971 342 395
3nqz-assembly1.cif.gz_B crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation 0.8912 121 395
2vqx-assembly1.cif.gz_A precursor of protealysin, metalloproteinase from serratia proteamaculans. 0.8877 59 394
4ger-assembly2.cif.gz_B crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa 0.8812 122 394
4k89-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa strain k solvent tolerant elastase 0.8803 122 394
ID Description Score Start End Superfamily
1ezmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.9009 234 395 1.10.390.10
6fhpC00 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8972 342 395 1.10.390.10
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.889 234 394 1.10.390.10
1ezmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8784 234 395 1.10.390.10
2vqxA01 Alpha Beta;Roll;Elastase; domain 1; 0.8751 59 230 3.10.170.10
ID Description Score Start End GO Terms
AF-A0A839UV62-F1-model_v4 Neutral metalloproteinase (EC 3.4.24.-) 0.9903 119 395 GO:0004222
GO:0005576
GO:0006508
GO:0046872
AF-A0A379SLS3-F1-model_v4 Neutral metalloproteinase (EC 3.4.24.-) 0.9883 201 295 GO:0004222
GO:0005576
GO:0006508
GO:0046872
AF-A0A839UV62-F1-model_v4 Neutral metalloproteinase (EC 3.4.24.-) 0.9832 119 395 GO:0004222
GO:0005576
GO:0006508
GO:0046872
AF-A0A6N0YCW0-F1-model_v4 deleted 0.9823 145 279
AF-A0A4Q3IEM5-F1-model_v4 deleted 0.9782 55 353

Map