F458546

General Info

Members Datasets Scaffolds Average Seq Length
520 377 412 456

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10145427|Ga0207691_101454272
Length 550
Sequence MLYGYRRQAKRLLVITRDISGMAVIASEAIGAEIPQRYPRRAAVISWIFFDWAAQPYFTLITTFVFAPYFASFVAPNPATGQALWGFATAAAGLTIALLSPVLGAIADASGRRKPWIAGFGALLVIGSSLMWIGKPGDPSIIPPLLLAYAIASVGVEFATVFNNAMMPTLVPPDKIGRLSGTGWATGYIGGIFSLILVLGFLAANPETGRTLFGFAPLFGLDPVTHQGDRITGPLTGIWFIIFALPMFLLTPDYPAKHPVRAALREGLTELKQTLGELPKQKSMATFLLANMIYTDGLVSLFAFGGIYAAGTFGWHTIQFIEQHERRGDAGRRDRGVGXXXVLALHLERADVDDAGEFADAVEEQREVVIRPFELQRDRPLGVQLFGDRRRRLEALDGHVRLRGHRLHAVQQVGGVLLFGQDRLEVGKAPFEVGHLRAELRQFLRRAQALVDVVAQRHELRLPRDHVGLHRHLVVVVENSAASDRQADKGPDLGVPRQLGERQFHVRFAIRAYRDDARRPLNTVDIGVSSPLSLREPPALPFRRAPETRP

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
14 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
18 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
19 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
20 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
21 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
22 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
23 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
24 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
25 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
26 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
27 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
28 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
29 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
30 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
31 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
32 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
33 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
34 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
35 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
36 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
37 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
38 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
39 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
40 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
41 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
42 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
43 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
44 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
45 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
46 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
47 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
48 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
49 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
50 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
51 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
52 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
53 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
54 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
55 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
56 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
57 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
58 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
59 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
60 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
61 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
62 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
63 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
64 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
65 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
66 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
67 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
68 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
69 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
70 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
71 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
72 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
73 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
74 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
75 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
76 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
77 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
78 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
79 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
80 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
81 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
82 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
83 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
84 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
85 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
86 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
87 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
88 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
89 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
90 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
91 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
92 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
101 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
104 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
105 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
106 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
121 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
128 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
219 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
358 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
359 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
365 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
366 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
367 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
368 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
369 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
370 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
371 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
372 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
373 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
374 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
375 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
376 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
377 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 0
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.5
Nodule 16.92
Rhizoplane 6.92
Rhizosphere 60.19
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000570 3300001979 Bacteria 15869
2 JGI24739J22299_10030723 3300001989 Bacteria 1861
3 JGI25406J46586_10000463 3300003203 Bacteria 18957
4 JGI25160J50197_1001638 3300003354 Bacteria 10988
5 JGI25160J50197_1002980 3300003354 Bacteria 7727
6 JGI25160J50197_1011101 3300003354 Bacteria 3213
7 Ga0055543_1004294 3300004625 Bacteria 3921
8 Ga0065165_1002933 3300005262 Bacteria 13012
9 Ga0065165_1022823 3300005262 Bacteria 2135
10 Ga0070676_10071214 3300005328 Bacteria 2088
11 Ga0070682_100111510 3300005337 Bacteria 1824
12 Ga0070668_100047884 3300005347 Bacteria 3287
13 Ga0070669_100141110 3300005353 Bacteria 1858
14 Ga0070659_100094014 3300005366 Bacteria 2407
15 Ga0070709_10113366 3300005434 Bacteria 1826
16 Ga0070714_100014255 3300005435 Bacteria 6383
17 Ga0070714_100065114 3300005435 Bacteria 3138
18 Ga0070714_100073645 3300005435 Bacteria 2959
19 Ga0070713_100002398 3300005436 Bacteria 12220
20 Ga0070713_100226423 3300005436 Bacteria 1698
21 Ga0070710_10000880 3300005437 Bacteria 14380
22 Ga0070711_100007845 3300005439 Bacteria 6506
23 Ga0070711_100011167 3300005439 Bacteria 5570
24 Ga0070711_100110667 3300005439 Bacteria 2016
25 Ga0070700_100029325 3300005441 Bacteria 3279
26 Ga0070663_100023849 3300005455 Bacteria 4107
27 Ga0070663_100035190 3300005455 Bacteria 3473
28 Ga0070663_100061577 3300005455 Bacteria 2703
29 Ga0070663_100071998 3300005455 Bacteria 2517
30 Ga0070678_100186806 3300005456 Bacteria 1701
31 Ga0070662_100041752 3300005457 Bacteria 3274
32 Ga0068853_100021754 3300005539 Bacteria 5350
33 Ga0068853_100028465 3300005539 Bacteria 4700
34 Ga0068853_100105212 3300005539 Bacteria 2500
35 Ga0070665_100039229 3300005548 Bacteria 4763
36 Ga0070665_100109966 3300005548 Bacteria 2758
37 Ga0070665_100171531 3300005548 Bacteria 2170
38 Ga0070704_100105694 3300005549 Bacteria 2132
39 Ga0068855_100009982 3300005563 Bacteria 11442
40 Ga0068855_100101281 3300005563 Bacteria 3316
41 Ga0070664_100070956 3300005564 Bacteria 2984
42 Ga0068857_100008515 3300005577 Bacteria 8868
43 Ga0068854_100003786 3300005578 Bacteria 9459
44 Ga0068854_100139813 3300005578 Bacteria 1857
45 Ga0068854_100161047 3300005578 Bacteria 1738
46 Ga0068856_100002838 3300005614 Bacteria 17741
47 Ga0068856_100026353 3300005614 Bacteria 5669
48 Ga0068856_100038677 3300005614 Bacteria 4683
49 Ga0068856_100134990 3300005614 Bacteria 2473
50 Ga0070702_100145263 3300005615 Bacteria 1516
51 Ga0068859_100087949 3300005617 Bacteria 3155
52 Ga0068861_100011567 3300005719 Bacteria 6141
53 Ga0068861_100095412 3300005719 Bacteria 2355
54 Ga0068851_10000402 3300005834 Bacteria 19592
55 Ga0068858_100059862 3300005842 Bacteria 3520
56 Ga0068858_100189859 3300005842 Bacteria 1941
57 Ga0068860_100000433 3300005843 Bacteria 53218
58 Ga0068860_100125812 3300005843 Bacteria 2457
59 Ga0068862_100075845 3300005844 Bacteria 2909
60 Ga0068862_100161814 3300005844 Bacteria 1998
61 Ga0081455_10005195 3300005937 Bacteria 14318
62 Ga0081455_10160677 3300005937 Bacteria 1722
63 Ga0081540_1002478 3300005983 Bacteria 15036
64 Ga0081540_1005988 3300005983 Bacteria 8956
65 Ga0081540_1014897 3300005983 Bacteria 4946
66 Ga0081539_10003530 3300005985 Bacteria 19031
67 Ga0070717_10005195 3300006028 Bacteria 9483
68 Ga0070717_10072932 3300006028 Bacteria 2868
69 Ga0075365_10026794 3300006038 Bacteria 3663
70 Ga0075368_10035512 3300006042 Bacteria 1945
71 Ga0075363_100003251 3300006048 Bacteria 6874
72 Ga0070712_100003780 3300006175 Bacteria 9321
73 Ga0075367_10016644 3300006178 Bacteria 4018
74 Ga0068871_100142224 3300006358 Bacteria 2041
75 Ga0075428_100053195 3300006844 Bacteria 4436
76 Ga0075434_100332896 3300006871 Bacteria 1539
77 Ga0075436_100060692 3300006914 Bacteria 2612
78 Ga0097620_100087951 3300006931 Bacteria 3155
79 Ga0099794_10011134 3300007265 Bacteria 3844
80 Ga0105240_10004430 3300009093 Bacteria 21410
81 Ga0105240_10037459 3300009093 Bacteria 6233
82 Ga0105240_10130297 3300009093 Bacteria 3018
83 Ga0111539_10043992 3300009094 Bacteria 5352
84 Ga0105245_10192146 3300009098 Bacteria 1956
85 Ga0105247_10101419 3300009101 Bacteria 1840
86 Ga0114129_10023896 3300009147 Bacteria 8662
87 Ga0105243_10167515 3300009148 Bacteria 1900
88 Ga0105241_10043573 3300009174 Bacteria 3399
89 Ga0105237_10045715 3300009545 Bacteria 4405
90 Ga0105237_10202540 3300009545 Bacteria 1985
91 Ga0105238_10007309 3300009551 Bacteria 11059
92 Ga0105238_10083597 3300009551 Bacteria 3181
93 Ga0105238_10087810 3300009551 Bacteria 3096
94 Ga0105239_10007523 3300010375 Bacteria 12489
95 Ga0105239_10047342 3300010375 Bacteria 4713
96 Ga0105239_10049388 3300010375 Bacteria 4614
97 Ga0105239_10080394 3300010375 Bacteria 3586
98 Ga0105239_10100673 3300010375 Bacteria 3196
99 Ga0105239_10221994 3300010375 Bacteria 2119
100 Ga0105246_10036214 3300011119 Bacteria 3304
101 Ga0157374_10078526 3300013296 Bacteria 3126
102 Ga0157378_10075530 3300013297 Bacteria 3034
103 Ga0157378_10194580 3300013297 Bacteria 1915
104 Ga0163162_10102070 3300013306 Bacteria 2961
105 Ga0163162_10314283 3300013306 Bacteria 1699
106 Ga0157372_10080044 3300013307 Bacteria 3696
107 Ga0157380_10101275 3300014326 Bacteria 2400
108 Ga0157379_10093325 3300014968 Bacteria 2700
109 Ga0157376_10002020 3300014969 Bacteria 13604
110 Ga0209677_101634 3300025253 Bacteria 9449
111 Ga0209677_102008 3300025253 Bacteria 8092
112 Ga0209233_1002848 3300025261 Bacteria 6200
113 Ga0209233_1008434 3300025261 Bacteria 3193
114 Ga0209455_1004485 3300025272 Bacteria 4550
115 Ga0209758_1003514 3300025297 Bacteria 14143
116 Ga0209758_1004217 3300025297 Bacteria 12175
117 Ga0207426_1000420 3300025302 Bacteria 69895
118 Ga0207426_1020116 3300025302 Bacteria 2324
119 Ga0207692_10003479 3300025898 Bacteria 6154
120 Ga0207688_10045394 3300025901 Bacteria 2451
121 Ga0207647_10004518 3300025904 Bacteria 10306
122 Ga0207699_10013790 3300025906 Bacteria 4147
123 Ga0207645_10020873 3300025907 Bacteria 4279
124 Ga0207654_10000058 3300025911 Bacteria 75628
125 Ga0207695_10000453 3300025913 Bacteria 89314
126 Ga0207695_10030300 3300025913 Bacteria 5958
127 Ga0207671_10034794 3300025914 Bacteria 3742
128 Ga0207671_10041863 3300025914 Bacteria 3391
129 Ga0207693_10001606 3300025915 Bacteria 20003
130 Ga0207693_10003386 3300025915 Bacteria 13620
131 Ga0207693_10053413 3300025915 Bacteria 3170
132 Ga0207663_10000390 3300025916 Bacteria 19024
133 Ga0207663_10005653 3300025916 Bacteria 6319
134 Ga0207657_10169132 3300025919 Bacteria 1772
135 Ga0207694_10000564 3300025924 Bacteria 33580
136 Ga0207694_10079452 3300025924 Bacteria 2572
137 Ga0207664_10025264 3300025929 Bacteria 4472
138 Ga0207664_10056988 3300025929 Bacteria 3105
139 Ga0207706_10062207 3300025933 Bacteria 3287
140 Ga0207709_10019916 3300025935 Bacteria 3779
141 Ga0207665_10000444 3300025939 Bacteria 28370
142 Ga0207691_10033936 3300025940 Bacteria 4750
143 Ga0207691_10139354 3300025940 Bacteria 2138
144 Ga0207691_10145427 3300025940 Bacteria 2087
145 Ga0207689_10035377 3300025942 Bacteria 4150
146 Ga0207689_10111356 3300025942 Bacteria 2250
147 Ga0207679_10062491 3300025945 Bacteria 2775
148 Ga0207667_10009339 3300025949 Bacteria 11566
149 Ga0207667_10144053 3300025949 Bacteria 2453
150 Ga0207668_10088648 3300025972 Bacteria 2266
151 Ga0207640_10035826 3300025981 Bacteria 3109
152 Ga0207658_10085560 3300025986 Bacteria 2429
153 Ga0207677_10020870 3300026023 Bacteria 3991
154 Ga0207703_10123765 3300026035 Bacteria 2223
155 Ga0207639_10001424 3300026041 Bacteria 16178
156 Ga0207639_10064311 3300026041 Bacteria 2844
157 Ga0207678_10015000 3300026067 Bacteria 6817
158 Ga0207678_10027531 3300026067 Bacteria 4960
159 Ga0207678_10043553 3300026067 Bacteria 3884
160 Ga0207678_10053426 3300026067 Bacteria 3481
161 Ga0207678_10131745 3300026067 Bacteria 2133
162 Ga0207708_10120651 3300026075 Bacteria 2042
163 Ga0207702_10000004 3300026078 Bacteria 422182
164 Ga0207702_10028205 3300026078 Bacteria 4665
165 Ga0207702_10067275 3300026078 Bacteria 3074
166 Ga0207648_10036345 3300026089 Bacteria 4339
167 Ga0207676_10157760 3300026095 Bacteria 1962
168 Ga0207674_10005590 3300026116 Bacteria 14903
169 Ga0207683_10145147 3300026121 Bacteria 2140
170 Ga0207698_10062289 3300026142 Bacteria 2912
171 Ga0207698_10070609 3300026142 Bacteria 2768
172 Ga0207698_10164287 3300026142 Bacteria 1946
173 Ga0207698_10186115 3300026142 Bacteria 1845
174 Ga0209589_1000021 3300027357 Bacteria 186431
175 Ga0209489_100028 3300027361 Bacteria 186431
176 Ga0209700_100037 3300027363 Bacteria 186431
177 Ga0207428_10054066 3300027907 Bacteria 3199
178 Ga0268266_10000680 3300028379 Bacteria 45937
179 Ga0268266_10012906 3300028379 Bacteria 7208
180 Ga0268266_10057719 3300028379 Bacteria 3341
181 Ga0268264_10000062 3300028381 Bacteria 302110
182 Ga0265318_10007399 3300028577 Bacteria 4968
183 Ga0265323_10008033 3300028653 Bacteria 4363
184 Ga0265336_10011786 3300028666 Bacteria 2959
185 Ga0307517_10000942 3300028786 Bacteria 49547
186 Ga0307515_10068562 3300028794 Bacteria 4870
187 Ga0265338_10009376 3300028800 Bacteria 11688
188 Ga0265324_10015196 3300029957 Bacteria 2834
189 Ga0265330_10013047 3300031235 Bacteria 3877
190 Ga0265332_10011856 3300031238 Bacteria 3872
191 Ga0265340_10002209 3300031247 Bacteria 11138
192 Ga0307508_10000108 3300031616 Bacteria 97443
193 Ga0265314_10002048 3300031711 Bacteria 21322
194 Ga0265314_10038049 3300031711 Bacteria 3480
195 Ga0265342_10015551 3300031712 Bacteria 5002
196 Ga0307516_10061413 3300031730 Bacteria 3646
197 Ga0307510_10003483 3300033180 Bacteria 18332
198 Ga0315911_1000008 3300033442 Bacteria 381285
199 Ga0316214_1003581 3300033545 Bacteria 1965
200 Ga0373936_0012325 3300035113 Bacteria 3251
201 Ga0373945_0013871 3300035116 Bacteria 2695
202 Ga0373954_0000242 3300035118 Bacteria 20003
203 Ga0373954_0013828 3300035118 Bacteria 3597
204 Ga0373957_0000417 3300035120 Bacteria 10760
205 Ga0373943_0002237 3300035170 Bacteria 8797
206 Ga0373946_0018418 3300035171 Bacteria 2682
207 Ga0373955_0001044 3300035172 Bacteria 11768
208 Ga0373935_0000500 3300035692 Bacteria 20245
209 Ga0373927_0000337 3300035695 Bacteria 36861
210 Ga0373927_0047665 3300035695 Bacteria 2772
211 Ga0373933_0007539 3300035724 Bacteria 5945
212 Ga0373947_0002043 3300035725 Bacteria 12316
213 Ga0373947_0028453 3300035725 Bacteria 3277
214 Ga0373937_0067455 3300036401 Bacteria 3296
215 Ga0373925_0003157 3300037068 Bacteria 12909
216 Ga0373925_0076785 3300037068 Bacteria 2534
217 Ga0395898_0010389 3300037466 Bacteria 9734
218 Ga0436365_1721875 3300039437 Bacteria 3982
219 Ga0436360_0974944 3300039438 Bacteria 2922
220 Ga0436361_0053567 3300039447 Bacteria 1845
221 Ga0466969_0006896 3300044656 Bacteria 6046
222 Ga0466966_0000359 3300044684 Bacteria 29538
223 Ga0466961_0000074 3300044693 Bacteria 61968
224 Ga0466959_0008397 3300045049 Bacteria 7300
225 Ga0466967_0069108 3300045976 Bacteria 3156
226 Ga0495603_0002436 3300046455 Bacteria 10943
227 Ga0495603_0011272 3300046455 Bacteria 5417
228 Ga0495629_0000727 3300046459 Bacteria 26728
229 Ga0495638_0089919 3300046460 Bacteria 1851
230 Ga0495641_0007117 3300046461 Bacteria 7073
231 Ga0495651_0032462 3300046462 Bacteria 4072
232 Ga0495651_0035673 3300046462 Bacteria 3872
233 Ga0495653_0000465 3300046463 Bacteria 31535
234 Ga0495580_0002297 3300046472 Bacteria 16691
235 Ga0495582_0000494 3300046473 Bacteria 21572
236 Ga0495605_0050823 3300046474 Bacteria 2021
237 Ga0495639_0000119 3300046475 Bacteria 39930
238 Ga0495662_0001142 3300046476 Bacteria 13095
239 Ga0495664_0030058 3300046477 Bacteria 3181
240 Ga0495594_0008592 3300046499 Bacteria 5264
241 Ga0495594_0058680 3300046499 Bacteria 2127
242 Ga0495606_0076918 3300046507 Bacteria 2085
243 Ga0495608_0001489 3300046511 Bacteria 16666
244 Ga0495608_0098998 3300046511 Bacteria 1881
245 Ga0495608_0123468 3300046511 Bacteria 1659
246 Ga0495628_0136539 3300046516 Bacteria 1874
247 Ga0495630_0003675 3300046517 Bacteria 10698
248 Ga0495648_0099499 3300046524 Bacteria 1608
249 Ga0495663_0008257 3300046525 Bacteria 2883
250 Ga0495666_0006549 3300046526 Bacteria 5859
251 Ga0495666_0046855 3300046526 Bacteria 2083
252 Ga0495652_0022017 3300046529 Bacteria 5662
253 Ga0495665_0000251 3300046531 Bacteria 26959
254 Ga0495640_0002679 3300046533 Bacteria 14309
255 Ga0495587_0004444 3300046536 Bacteria 9241
256 Ga0495587_0008499 3300046536 Bacteria 6599
257 Ga0495645_0017210 3300046543 Bacteria 5177
258 Ga0495622_0004931 3300046557 Bacteria 6179
259 Ga0495667_0001146 3300046559 Bacteria 17281
260 Ga0495667_0013097 3300046559 Bacteria 5617
261 Ga0495656_0021325 3300046615 Bacteria 2521
262 Ga0495656_0044683 3300046615 Bacteria 1867
263 Ga0495634_0000886 3300046642 Bacteria 28754
264 Ga0495634_0004544 3300046642 Bacteria 10857
265 Ga0495634_0018287 3300046642 Bacteria 4991
266 Ga0495635_0001208 3300046663 Bacteria 17261
267 Ga0495635_0005740 3300046663 Bacteria 8646
268 Ga0495635_0010109 3300046663 Bacteria 6599
269 Ga0495659_0013259 3300046664 Bacteria 2682
270 Ga0495588_0041941 3300046674 Bacteria 2338
271 Ga0495657_0001030 3300046675 Bacteria 24459
272 Ga0495657_0001337 3300046675 Bacteria 21445
273 Ga0495657_0040622 3300046675 Bacteria 3189
274 Ga0495599_0000873 3300046678 Bacteria 16867
275 Ga0495599_0017403 3300046678 Bacteria 4469
276 Ga0495623_0004412 3300046679 Bacteria 9246
277 Ga0495646_0001852 3300046680 Bacteria 12711
278 Ga0495646_0023800 3300046680 Bacteria 3856
279 Ga0495647_0000085 3300046681 Bacteria 22908
280 Ga0495658_0000135 3300046683 Bacteria 40991
281 Ga0495669_0000707 3300046684 Bacteria 14557
282 Ga0495613_0001617 3300046689 Bacteria 17148
283 Ga0495624_0000144 3300046690 Bacteria 51509
284 Ga0495624_0016618 3300046690 Bacteria 4952
285 Ga0495649_0013892 3300046694 Bacteria 4631
286 Ga0495600_0000768 3300046809 Bacteria 16897
287 Ga0495600_0002466 3300046809 Bacteria 10617
288 Ga0495581_0000421 3300047315 Bacteria 21445
289 Ga0495604_0003032 3300047317 Bacteria 13430
290 Ga0495604_0009371 3300047317 Bacteria 7744
291 Ga0495604_0130453 3300047317 Bacteria 1807
292 Ga0495674_0001274 3300047319 Bacteria 24483
293 Ga0495674_0026496 3300047319 Bacteria 5304
294 Ga0495676_0006058 3300047321 Bacteria 11115
295 Ga0495676_0007487 3300047321 Bacteria 10015
296 Ga0495680_0000791 3300047322 Bacteria 35389
297 Ga0495683_0043674 3300047323 Bacteria 2256
298 Ga0495675_0003063 3300047444 Bacteria 10046
299 Ga0495675_0003289 3300047444 Bacteria 9716
300 Ga0495684_0000169 3300047471 Bacteria 49164
301 Ga0495593_0000007 3300047673 Bacteria 87657
302 Ga0495602_0051410 3300048088 Bacteria 3670
303 Ga0496100_0027040 3300048903 Bacteria 3523
304 Ga0496101_0016754 3300048904 Bacteria 4960
305 Ga0496101_0154224 3300048904 Bacteria 1758
306 Ga0496102_0003496 3300048905 Bacteria 13323
307 Ga0496102_0009172 3300048905 Bacteria 8488
308 Ga0496104_0070977 3300048907 Bacteria 3311
309 Ga0496105_0033599 3300048908 Bacteria 4214
310 Ga0496106_0020145 3300048909 Bacteria 4948
311 Ga0496106_0021442 3300048909 Bacteria 4797
312 Ga0496107_0005303 3300048910 Bacteria 8810
313 Ga0496107_0036264 3300048910 Bacteria 3537
314 Ga0496107_0064227 3300048910 Bacteria 2661
315 Ga0496108_0007489 3300048911 Bacteria 8847
316 Ga0496108_0013286 3300048911 Bacteria 6713
317 Ga0496109_0003252 3300048912 Bacteria 13541
318 Ga0496109_0035144 3300048912 Bacteria 4519
319 Ga0496109_0051350 3300048912 Bacteria 3756
320 Ga0496110_0012904 3300048913 Bacteria 6888
321 Ga0496110_0016515 3300048913 Bacteria 6164
322 Ga0496110_0050682 3300048913 Bacteria 3646
323 Ga0496111_0024507 3300048914 Bacteria 4250
324 Ga0496112_0000035 3300048915 Bacteria 106983
325 Ga0496112_0003481 3300048915 Bacteria 13031
326 Ga0496112_0142116 3300048915 Bacteria 2369
327 Ga0496113_0048497 3300048916 Bacteria 3160
328 Ga0496113_0061661 3300048916 Bacteria 2830
329 Ga0496113_0083612 3300048916 Bacteria 2449
330 Ga0496113_0114707 3300048916 Bacteria 2101
331 Ga0496114_0031719 3300048917 Bacteria 4347
332 Ga0496115_0002653 3300048918 Bacteria 12842
333 Ga0496115_0012788 3300048918 Bacteria 6328
334 Ga0496115_0014031 3300048918 Bacteria 6065
335 Ga0496115_0031184 3300048918 Bacteria 4198
336 Ga0496115_0065946 3300048918 Bacteria 2925
337 Ga0496115_0141090 3300048918 Bacteria 1988
338 Ga0496117_0010324 3300048920 Bacteria 8535
339 Ga0496117_0062325 3300048920 Bacteria 2556
340 Ga0496118_0010548 3300048921 Bacteria 9136
341 Ga0496118_0020937 3300048921 Bacteria 5782
342 Ga0496121_0000203 3300048924 Bacteria 130984
343 Ga0496121_0000893 3300048924 Bacteria 53847
344 Ga0496121_0082204 3300048924 Bacteria 2547
345 Ga0496124_0022134 3300048927 Bacteria 5834
346 Ga0496125_0050627 3300048928 Bacteria 3437
347 Ga0496126_0017429 3300048929 Bacteria 7156
348 Ga0496126_0022033 3300048929 Bacteria 6208
349 Ga0496126_0027307 3300048929 Bacteria 5454
350 Ga0496126_0060915 3300048929 Bacteria 3392
351 Ga0496126_0073482 3300048929 Bacteria 3040
352 Ga0495682_0008725 3300049460 Bacteria 3989
353 Ga0501032_0000303 3300049569 Bacteria 41504
354 Ga0501033_0000881 3300049570 Bacteria 27428
355 Ga0501034_0000250 3300049571 Bacteria 99407
356 Ga0501036_0000047 3300049572 Bacteria 75675
357 Ga0501036_0172453 3300049572 Bacteria 1822
358 Ga0501037_0000092 3300049573 Bacteria 83924
359 Ga0501037_0053739 3300049573 Bacteria 2946
360 Ga0501037_0078631 3300049573 Bacteria 2393
361 Ga0501038_0004865 3300049574 Bacteria 12475
362 Ga0501039_0000085 3300049575 Bacteria 70306
363 Ga0501042_0016184 3300049578 Bacteria 5116
364 Ga0501043_0005729 3300049579 Bacteria 10008
365 Ga0501043_0020072 3300049579 Bacteria 5244
366 Ga0501046_0000624 3300049580 Bacteria 34712
367 Ga0501047_0000022 3300049581 Bacteria 249062
368 Ga0501048_0007360 3300049582 Bacteria 8340
369 Ga0501067_0002068 3300049583 Bacteria 11051
370 Ga0501068_0001544 3300049584 Bacteria 12237
371 Ga0501069_0000513 3300049585 Bacteria 17707
372 Ga0501071_0030454 3300049587 Bacteria 3817
373 Ga0501072_0002213 3300049588 Bacteria 14529
374 Ga0501073_0000109 3300049589 Bacteria 53094
375 Ga0501074_0000250 3300049590 Bacteria 30239
376 Ga0501076_0044203 3300049592 Bacteria 3513
377 Ga0501079_0005328 3300049741 Bacteria 9573
378 Ga0501079_0122200 3300049741 Bacteria 2025
379 Ga0501083_0001496 3300049744 Bacteria 15948
380 Ga0501035_0006867 3300049822 Bacteria 10631
381 Ga0501035_0191630 3300049822 Bacteria 1757
382 Ga0501044_0000072 3300049823 Bacteria 124143
383 Ga0501044_0016861 3300049823 Bacteria 7837
384 Ga0501044_0196885 3300049823 Bacteria 1974
385 nmdc:mga03n38_100_c1 3300050490 Bacteria 19063
386 nmdc:mga0yw44_15340_c1 3300050492 Bacteria 4100
387 nmdc:mga0k408_67651_c1 3300050493 Bacteria 2082
388 nmdc:mga07m45_45723_c1 3300050496 Bacteria 2458
389 nmdc:mga05p37_82927_c1 3300050507 Bacteria 3950
390 nmdc:mga0sz30_14357_c1 3300050516 Bacteria 3116
391 nmdc:mga0sz30_49283_c1 3300050516 Bacteria 1784
392 Ga0495601_0011752 3300053077 Bacteria 5249
393 Ga0495595_0000668 3300053084 Bacteria 13098
394 Ga0495595_0018362 3300053084 Bacteria 3022
395 Ga0495619_0000719 3300053085 Bacteria 21645
396 Ga0495619_0081978 3300053085 Bacteria 2173
397 Ga0500566_0000150 3300053094 Bacteria 35703
398 Ga0500641_0007715 3300053096 Bacteria 3835
399 Ga0500572_000234 3300053111 Bacteria 19736
400 Ga0500595_000258 3300053119 Bacteria 35116
401 Ga0500595_002380 3300053119 Bacteria 9400
402 Ga0500642_0046354 3300053130 Bacteria 1901
403 Ga0500559_0000244 3300053136 Bacteria 42994
404 Ga0500568_0012485 3300053139 Bacteria 3905
405 Ga0500639_057596 3300053163 Bacteria 2009
406 Ga0500637_0000147 3300053178 Bacteria 25930
407 Ga0500637_0023478 3300053178 Bacteria 3373
408 Ga0500576_055274 3300053725 Bacteria 1750
409 Ga0500645_016945 3300053730 Bacteria 2289
410 Ga0501084_0006091 3300054114 Bacteria 9917
411 Ga0500661_000057 3300055283 Bacteria 17586
412 Ga0501082_0002413 3300060353 Bacteria 16404

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10145427 Ga0207691_101454272 407
2 3300005435 Ga0070714_100073645 Ga0070714_1000736452 419
3 3300025929 Ga0207664_10056988 Ga0207664_100569882 419
4 3300039437 Ga0436365_1721875 Ga0436365_1721875_730_2055 419
5 3300048920 Ga0496117_0062325 Ga0496117_0062325_893_2257 419
6 3300048921 Ga0496118_0010548 Ga0496118_0010548_2122_3486 419
7 3300005548 Ga0070665_100171531 Ga0070665_1001715312 421
8 3300025302 Ga0207426_1020116 Ga0207426_10201162 421
9 3300003354 JGI25160J50197_1001638 JGI25160J50197_10016388 422
10 3300003354 JGI25160J50197_1002980 JGI25160J50197_10029803 422
11 3300004625 Ga0055543_1004294 Ga0055543_10042941 422
12 3300005262 Ga0065165_1002933 Ga0065165_10029332 422
13 3300009174 Ga0105241_10043573 Ga0105241_100435731 422
14 3300025297 Ga0209758_1003514 Ga0209758_100351411 422
15 3300025302 Ga0207426_1000420 Ga0207426_100042038 422
16 3300027357 Ga0209589_1000021 Ga0209589_100002162 422
17 3300027361 Ga0209489_100028 Ga0209489_10002862 422
18 3300027363 Ga0209700_100037 Ga0209700_10003762 422
19 3300046462 Ga0495651_0035673 Ga0495651_0035673_1616_3004 422
20 3300050496 nmdc:mga07m45_45723_c1 nmdc:mga07m45_45723_c1_154_1542 422
21 3300005435 Ga0070714_100014255 Ga0070714_1000142554 423
22 3300005436 Ga0070713_100002398 Ga0070713_1000023982 423
23 3300005437 Ga0070710_10000880 Ga0070710_100008808 423
24 3300005439 Ga0070711_100007845 Ga0070711_1000078452 423
25 3300005983 Ga0081540_1005988 Ga0081540_10059884 423
26 3300025898 Ga0207692_10003479 Ga0207692_100034793 423
27 3300025906 Ga0207699_10013790 Ga0207699_100137902 423
28 3300025915 Ga0207693_10001606 Ga0207693_100016068 423
29 3300025916 Ga0207663_10000390 Ga0207663_100003909 423
30 3300025939 Ga0207665_10000444 Ga0207665_1000044416 423
31 3300025986 Ga0207658_10085560 Ga0207658_100855602 423
32 3300048905 Ga0496102_0009172 Ga0496102_0009172_2097_3482 423
33 3300048910 Ga0496107_0064227 Ga0496107_0064227_668_2053 423
34 3300048912 Ga0496109_0035144 Ga0496109_0035144_2246_3631 423
35 3300048916 Ga0496113_0061661 Ga0496113_0061661_1028_2413 423
36 3300048918 Ga0496115_0065946 Ga0496115_0065946_240_1649 423
37 3300005937 Ga0081455_10005195 Ga0081455_1000519512 424
38 3300025942 Ga0207689_10035377 Ga0207689_100353772 424
39 3300025972 Ga0207668_10088648 Ga0207668_100886482 424
40 3300026089 Ga0207648_10036345 Ga0207648_100363453 424
41 3300031238 Ga0265332_10011856 Ga0265332_100118564 424
42 3300031616 Ga0307508_10000108 Ga0307508_100001087 424
43 3300031711 Ga0265314_10038049 Ga0265314_100380492 424
44 3300031712 Ga0265342_10015551 Ga0265342_100155512 424
45 3300033545 Ga0316214_1003581 Ga0316214_10035811 424
46 3300035118 Ga0373954_0000242 Ga0373954_0000242_15086_16501 424
47 3300035120 Ga0373957_0000417 Ga0373957_0000417_2526_3941 424
48 3300035172 Ga0373955_0001044 Ga0373955_0001044_6993_8408 424
49 3300035724 Ga0373933_0007539 Ga0373933_0007539_4392_5801 424
50 3300037068 Ga0373925_0076785 Ga0373925_0076785_824_2227 424
51 3300046462 Ga0495651_0032462 Ga0495651_0032462_961_2376 424
52 3300046463 Ga0495653_0000465 Ga0495653_0000465_891_2306 424
53 3300046474 Ga0495605_0050823 Ga0495605_0050823_608_1993 424
54 3300046511 Ga0495608_0001489 Ga0495608_0001489_8386_9801 424
55 3300046533 Ga0495640_0002679 Ga0495640_0002679_2823_4238 424
56 3300046536 Ga0495587_0004444 Ga0495587_0004444_961_2376 424
57 3300046543 Ga0495645_0017210 Ga0495645_0017210_360_1775 424
58 3300046559 Ga0495667_0001146 Ga0495667_0001146_3344_4759 424
59 3300046642 Ga0495634_0004544 Ga0495634_0004544_7662_9077 424
60 3300046663 Ga0495635_0005740 Ga0495635_0005740_1089_2504 424
61 3300046675 Ga0495657_0001030 Ga0495657_0001030_3381_4796 424
62 3300046678 Ga0495599_0000873 Ga0495599_0000873_199_1614 424
63 3300046680 Ga0495646_0001852 Ga0495646_0001852_1076_2491 424
64 3300046694 Ga0495649_0013892 Ga0495649_0013892_634_2019 424
65 3300046809 Ga0495600_0000768 Ga0495600_0000768_12011_13426 424
66 3300047317 Ga0495604_0009371 Ga0495604_0009371_4633_6048 424
67 3300047323 Ga0495683_0043674 Ga0495683_0043674_840_2225 424
68 3300047444 Ga0495675_0003063 Ga0495675_0003063_3253_4668 424
69 3300047471 Ga0495684_0000169 Ga0495684_0000169_24010_25425 424
70 3300049460 Ga0495682_0008725 Ga0495682_0008725_1241_2626 424
71 3300050493 nmdc:mga0k408_67651_c1 nmdc:mga0k408_67651_c1_317_1702 424
72 3300050516 nmdc:mga0sz30_49283_c1 nmdc:mga0sz30_49283_c1_78_1463 424
73 3300053077 Ga0495601_0011752 Ga0495601_0011752_2873_4288 424
74 3300053084 Ga0495595_0000668 Ga0495595_0000668_10222_11637 424
75 3300053085 Ga0495619_0000719 Ga0495619_0000719_1089_2504 424
76 3300005328 Ga0070676_10071214 Ga0070676_100712142 425
77 3300005347 Ga0070668_100047884 Ga0070668_1000478841 425
78 3300005439 Ga0070711_100011167 Ga0070711_1000111672 425
79 3300005441 Ga0070700_100029325 Ga0070700_1000293252 425
80 3300005455 Ga0070663_100035190 Ga0070663_1000351902 425
81 3300005455 Ga0070663_100061577 Ga0070663_1000615772 425
82 3300005456 Ga0070678_100186806 Ga0070678_1001868062 425
83 3300005457 Ga0070662_100041752 Ga0070662_1000417521 425
84 3300005548 Ga0070665_100039229 Ga0070665_1000392292 425
85 3300005549 Ga0070704_100105694 Ga0070704_1001056941 425
86 3300005563 Ga0068855_100009982 Ga0068855_1000099829 425
87 3300005564 Ga0070664_100070956 Ga0070664_1000709562 425
88 3300005614 Ga0068856_100134990 Ga0068856_1001349902 425
89 3300005615 Ga0070702_100145263 Ga0070702_1001452631 425
90 3300005719 Ga0068861_100011567 Ga0068861_1000115674 425
91 3300006358 Ga0068871_100142224 Ga0068871_1001422242 425
92 3300009093 Ga0105240_10037459 Ga0105240_100374593 425
93 3300009094 Ga0111539_10043992 Ga0111539_100439923 425
94 3300009148 Ga0105243_10167515 Ga0105243_101675151 425
95 3300010375 Ga0105239_10100673 Ga0105239_101006732 425
96 3300010375 Ga0105239_10221994 Ga0105239_102219942 425
97 3300013297 Ga0157378_10075530 Ga0157378_100755302 425
98 3300014326 Ga0157380_10101275 Ga0157380_101012751 425
99 3300014969 Ga0157376_10002020 Ga0157376_1000202010 425
100 3300025261 Ga0209233_1008434 Ga0209233_10084342 425
101 3300025272 Ga0209455_1004485 Ga0209455_10044853 425
102 3300025901 Ga0207688_10045394 Ga0207688_100453942 425
103 3300025907 Ga0207645_10020873 Ga0207645_100208733 425
104 3300025915 Ga0207693_10053413 Ga0207693_100534132 425
105 3300025916 Ga0207663_10005653 Ga0207663_100056533 425
106 3300025940 Ga0207691_10033936 Ga0207691_100339361 425
107 3300025945 Ga0207679_10062491 Ga0207679_100624912 425
108 3300026067 Ga0207678_10043553 Ga0207678_100435532 425
109 3300026067 Ga0207678_10131745 Ga0207678_101317452 425
110 3300026075 Ga0207708_10120651 Ga0207708_101206511 425
111 3300026142 Ga0207698_10070609 Ga0207698_100706092 425
112 3300027907 Ga0207428_10054066 Ga0207428_100540662 425
113 3300028379 Ga0268266_10057719 Ga0268266_100577192 425
114 3300044656 Ga0466969_0006896 Ga0466969_0006896_188_1573 425
115 3300044684 Ga0466966_0000359 Ga0466966_0000359_20732_22117 425
116 3300044693 Ga0466961_0000074 Ga0466961_0000074_37915_39300 425
117 3300045049 Ga0466959_0008397 Ga0466959_0008397_1866_3251 425
118 3300046499 Ga0495594_0058680 Ga0495594_0058680_386_1774 425
119 3300046507 Ga0495606_0076918 Ga0495606_0076918_539_1927 425
120 3300046511 Ga0495608_0123468 Ga0495608_0123468_101_1489 425
121 3300046526 Ga0495666_0046855 Ga0495666_0046855_594_1979 425
122 3300046642 Ga0495634_0018287 Ga0495634_0018287_109_1497 425
123 3300046664 Ga0495659_0013259 Ga0495659_0013259_1236_2627 425
124 3300046675 Ga0495657_0040622 Ga0495657_0040622_527_1915 425
125 3300046690 Ga0495624_0016618 Ga0495624_0016618_2175_3563 425
126 3300047317 Ga0495604_0130453 Ga0495604_0130453_342_1730 425
127 3300047321 Ga0495676_0006058 Ga0495676_0006058_6313_7701 425
128 3300048903 Ga0496100_0027040 Ga0496100_0027040_337_1725 425
129 3300048904 Ga0496101_0016754 Ga0496101_0016754_1493_2881 425
130 3300048904 Ga0496101_0154224 Ga0496101_0154224_95_1480 425
131 3300048905 Ga0496102_0003496 Ga0496102_0003496_9923_11311 425
132 3300048907 Ga0496104_0070977 Ga0496104_0070977_1668_3056 425
133 3300048912 Ga0496109_0051350 Ga0496109_0051350_2007_3395 425
134 3300048913 Ga0496110_0012904 Ga0496110_0012904_75_1463 425
135 3300048915 Ga0496112_0142116 Ga0496112_0142116_198_1586 425
136 3300048918 Ga0496115_0002653 Ga0496115_0002653_6882_8270 425
137 3300048918 Ga0496115_0031184 Ga0496115_0031184_137_1522 425
138 3300053119 Ga0500595_000258 Ga0500595_000258_20855_22306 425
139 3300053178 Ga0500637_0000147 Ga0500637_0000147_3030_4481 425
140 3300055283 Ga0500661_000057 Ga0500661_000057_8649_10100 425
141 3300006914 Ga0075436_100060692 Ga0075436_1000606923 426
142 3300009551 Ga0105238_10007309 Ga0105238_100073092 426
143 3300009551 Ga0105238_10087810 Ga0105238_100878102 426
144 3300010375 Ga0105239_10047342 Ga0105239_100473422 426
145 3300025261 Ga0209233_1002848 Ga0209233_10028482 426
146 3300025297 Ga0209758_1004217 Ga0209758_100421710 426
147 3300025924 Ga0207694_10079452 Ga0207694_100794522 426
148 3300033442 Ga0315911_1000008 Ga0315911_1000008252 426
149 3300039438 Ga0436360_0974944 Ga0436360_0974944_1272_2696 426
150 3300039447 Ga0436361_0053567 Ga0436361_0053567_240_1637 426
151 3300045976 Ga0466967_0069108 Ga0466967_0069108_1151_2536 426
152 3300048910 Ga0496107_0005303 Ga0496107_0005303_1835_3220 426
153 3300048911 Ga0496108_0007489 Ga0496108_0007489_3891_5276 426
154 3300048912 Ga0496109_0003252 Ga0496109_0003252_3277_4662 426
155 3300048913 Ga0496110_0016515 Ga0496110_0016515_2728_4113 426
156 3300048914 Ga0496111_0024507 Ga0496111_0024507_154_1539 426
157 3300048915 Ga0496112_0003481 Ga0496112_0003481_9129_10514 426
158 3300048916 Ga0496113_0048497 Ga0496113_0048497_1406_2791 426
159 3300048918 Ga0496115_0141090 Ga0496115_0141090_80_1465 426
160 3300037466 Ga0395898_0010389 Ga0395898_0010389_7948_9333 428
161 3300048929 Ga0496126_0073482 Ga0496126_0073482_870_2279 429
162 3300006028 Ga0070717_10072932 Ga0070717_100729321 431
163 3300048088 Ga0495602_0051410 Ga0495602_0051410_21_1382 431
164 3300049572 Ga0501036_0172453 Ga0501036_0172453_351_1766 432
165 3300049573 Ga0501037_0053739 Ga0501037_0053739_481_1890 432
166 3300049823 Ga0501044_0196885 Ga0501044_0196885_283_1692 432
167 3300053084 Ga0495595_0018362 Ga0495595_0018362_235_1623 432
168 3300005439 Ga0070711_100110667 Ga0070711_1001106671 433
169 3300006175 Ga0070712_100003780 Ga0070712_1000037802 433
170 3300025915 Ga0207693_10003386 Ga0207693_100033862 433
171 3300025929 Ga0207664_10025264 Ga0207664_100252642 433
172 3300035113 Ga0373936_0012325 Ga0373936_0012325_1360_2745 434
173 3300053094 Ga0500566_0000150 Ga0500566_0000150_19936_21321 434
174 3300053163 Ga0500639_057596 Ga0500639_057596_275_1660 434
175 3300053178 Ga0500637_0023478 Ga0500637_0023478_1237_2622 434
176 iso_pu_bacteria 8006926726 8006933249 434
177 iso_pu_bacteria 2885374607 2885377502 435
178 iso_pu_bacteria 2885409591 2885411617 435
179 iso_pu_bacteria 2906610324 2906613926 435
180 iso_pu_bacteria 2906635258 2906642274 435
181 iso_pu_bacteria 2906660503 2906667302 435
182 iso_pu_bacteria 2908739725 2908747501 435
183 iso_pu_bacteria 2922425934 2922434166 435
184 iso_pu_bacteria 2935630451 2935637083 435
185 iso_pu_bacteria 2941507105 2941513650 435
186 iso_pu_bacteria 2941515067 2941521613 435
187 iso_pu_bacteria 2941523033 2941529438 435
188 iso_pu_bacteria 3005474847 3005475124 435
189 3300049573 Ga0501037_0078631 Ga0501037_0078631_261_1649 436
190 iso_pu_bacteria 2513237094 2513644635 436
191 iso_pu_bacteria 2513237101 2513695150 436
192 iso_pu_bacteria 2513237139 2513873486 436
193 iso_pu_bacteria 2513237141 2513888815 436
194 iso_pu_bacteria 2513237161 2514012529 436
195 iso_pu_bacteria 2517093001 2517107154 436
196 iso_pu_bacteria 2528768022 2528854061 436
197 iso_pu_bacteria 2617270735 2617352441 436
198 iso_pu_bacteria 2721755755 2723841680 436
199 iso_pu_bacteria 2728368998 2728755044 436
200 iso_pu_bacteria 2744054633 2745081736 436
201 iso_pu_bacteria 2791355199 2793083617 436
202 iso_pu_bacteria 2802429603 2805915570 436
203 iso_pu_bacteria 2824661429 2824670263 436
204 iso_pu_bacteria 2824687955 2824691105 436
205 iso_pu_bacteria 2824696289 2824703942 436
206 iso_pu_bacteria 2824773399 2824781221 436
207 iso_pu_bacteria 2838122688 2838124559 436
208 iso_pu_bacteria 2841941048 2841945246 436
209 iso_pu_bacteria 2841949485 2841952027 436
210 iso_pu_bacteria 2841957949 2841965576 436
211 iso_pu_bacteria 2841966195 2841970579 436
212 iso_pu_bacteria 2841974524 2841981828 436
213 iso_pu_bacteria 2841983080 2841985106 436
214 iso_pu_bacteria 2847939898 2847942198 436
215 iso_pu_bacteria 2849076700 2849083078 436
216 iso_pu_bacteria 2874604998 2874608025 436
217 iso_pu_bacteria 2876761206 2876770948 436
218 iso_pu_bacteria 2876808645 2876809852 436
219 iso_pu_bacteria 2879110137 2879112215 436
220 iso_pu_bacteria 2881364244 2881365275 436
221 iso_pu_bacteria 2888388044 2888390635 436
222 iso_pu_bacteria 2889033259 2889035446 436
223 iso_pu_bacteria 2906626472 2906628487 436
224 iso_pu_bacteria 2922368715 2922369529 436
225 iso_pu_bacteria 2922386360 2922392604 436
226 iso_pu_bacteria 2929615660 2929618649 436
227 iso_pu_bacteria 2929624759 2929628666 436
228 iso_pu_bacteria 2932784394 2932790828 436
229 iso_pu_bacteria 2932794094 2932794267 436
230 iso_pu_bacteria 2932801729 2932808139 436
231 iso_pu_bacteria 2932818245 2932823109 436
232 iso_pu_bacteria 2932828146 2932833515 436
233 iso_pu_bacteria 2933577622 2933580639 436
234 iso_pu_bacteria 2935616580 2935623071 436
235 iso_pu_bacteria 2935638405 2935644146 436
236 iso_pu_bacteria 2935665750 2935672272 436
237 iso_pu_bacteria 2935675223 2935679203 436
238 iso_pu_bacteria 2935684952 2935686449 436
239 iso_pu_bacteria 2935694250 2935700229 436
240 iso_pu_bacteria 2935703347 2935710178 436
241 iso_pu_bacteria 2935713505 2935716137 436
242 iso_pu_bacteria 2935722832 2935723739 436
243 iso_pu_bacteria 2935732158 2935735294 436
244 iso_pu_bacteria 2935741537 2935743915 436
245 iso_pu_bacteria 2935750917 2935752415 436
246 iso_pu_bacteria 2935801545 2935808170 436
247 iso_pu_bacteria 2935810662 2935816217 436
248 iso_pu_bacteria 2935827899 2935833610 436
249 iso_pu_bacteria 2935837841 2935844563 436
250 iso_pu_bacteria 2935855204 2935861319 436
251 iso_pu_bacteria 2935864058 2935869438 436
252 iso_pu_bacteria 2935873716 2935879767 436
253 iso_pu_bacteria 2935883170 2935890044 436
254 iso_pu_bacteria 2935992306 2935998010 436
255 iso_pu_bacteria 2936002035 2936008724 436
256 iso_pu_bacteria 2936037263 2936041222 436
257 iso_pu_bacteria 2940556831 2940558328 436
258 iso_pu_bacteria 2941531003 2941535466 436
259 iso_pu_bacteria 2941538514 2941543252 436
260 iso_pu_bacteria 3005594810 3005595100 436
261 iso_pu_bacteria 3005710791 3005711043 436
262 iso_pu_bacteria 3005718088 3005718351 436
263 iso_pu_bacteria 8006964411 8006967497 436
264 iso_pu_bacteria 8006994254 8006996470 436
265 iso_pu_bacteria 8016511872 8016518136 436
266 iso_pu_bacteria 8016583857 8016586318 436
267 iso_pu_bacteria 8017057580 8017058510 436
268 iso_pu_bacteria 8019576017 8019577183 436
269 iso_pu_bacteria 8019597564 8019606492 436
270 iso_pu_bacteria 8055742211 8055742499 436
271 iso_pu_bacteria 8056673599 8056675776 436
272 3300025253 Ga0209677_101634 Ga0209677_1016348 437
273 iso_pu_bacteria 2935959822 2935962685 437
274 3300005937 Ga0081455_10160677 Ga0081455_101606772 438
275 3300005337 Ga0070682_100111510 Ga0070682_1001115102 439
276 3300005539 Ga0068853_100105212 Ga0068853_1001052121 439
277 3300026041 Ga0207639_10064311 Ga0207639_100643112 439
278 3300031711 Ga0265314_10002048 Ga0265314_1000204818 439
279 3300048924 Ga0496121_0000893 Ga0496121_0000893_41448_42830 439
280 3300053119 Ga0500595_002380 Ga0500595_002380_7944_9329 439
281 3300053139 Ga0500568_0012485 Ga0500568_0012485_2398_3783 439
282 3300053730 Ga0500645_016945 Ga0500645_016945_583_1968 439
283 iso_pu_bacteria 2513237096 2513658870 439
284 iso_pu_bacteria 2513237137 2513860876 439
285 iso_pu_bacteria 2513237145 2513921134 439
286 iso_pu_bacteria 2517572143 2517888898 439
287 iso_pu_bacteria 2667528175 2671122504 439
288 iso_pu_bacteria 2791355197 2793072988 439
289 iso_pu_bacteria 2903748898 2903752082 439
290 iso_pu_bacteria 2904699407 2904708624 439
291 iso_pu_bacteria 8006933436 8006936167 439
292 iso_pu_bacteria 8006973647 8006976113 439
293 iso_pu_bacteria 8019555841 8019562492 439
294 iso_pu_bacteria 8019565922 8019572566 439
295 3300001979 JGI24740J21852_10000570 JGI24740J21852_100005707 440
296 3300001989 JGI24739J22299_10030723 JGI24739J22299_100307232 440
297 3300003203 JGI25406J46586_10000463 JGI25406J46586_100004632 440
298 3300003354 JGI25160J50197_1011101 JGI25160J50197_10111012 440
299 3300005262 Ga0065165_1022823 Ga0065165_10228232 440
300 3300005353 Ga0070669_100141110 Ga0070669_1001411102 440
301 3300005366 Ga0070659_100094014 Ga0070659_1000940142 440
302 3300005434 Ga0070709_10113366 Ga0070709_101133661 440
303 3300005435 Ga0070714_100065114 Ga0070714_1000651142 440
304 3300005436 Ga0070713_100226423 Ga0070713_1002264232 440
305 3300005455 Ga0070663_100023849 Ga0070663_1000238492 440
306 3300005455 Ga0070663_100071998 Ga0070663_1000719982 440
307 3300005539 Ga0068853_100021754 Ga0068853_1000217541 440
308 3300005539 Ga0068853_100028465 Ga0068853_1000284651 440
309 3300005548 Ga0070665_100109966 Ga0070665_1001099662 440
310 3300005563 Ga0068855_100101281 Ga0068855_1001012812 440
311 3300005577 Ga0068857_100008515 Ga0068857_1000085152 440
312 3300005578 Ga0068854_100003786 Ga0068854_1000037861 440
313 3300005578 Ga0068854_100139813 Ga0068854_1001398132 440
314 3300005578 Ga0068854_100161047 Ga0068854_1001610472 440
315 3300005614 Ga0068856_100002838 Ga0068856_1000028384 440
316 3300005614 Ga0068856_100026353 Ga0068856_1000263535 440
317 3300005614 Ga0068856_100038677 Ga0068856_1000386773 440
318 3300005617 Ga0068859_100087949 Ga0068859_1000879492 440
319 3300005719 Ga0068861_100095412 Ga0068861_1000954122 440
320 3300005834 Ga0068851_10000402 Ga0068851_100004029 440
321 3300005842 Ga0068858_100059862 Ga0068858_1000598621 440
322 3300005842 Ga0068858_100189859 Ga0068858_1001898592 440
323 3300005843 Ga0068860_100000433 Ga0068860_10000043314 440
324 3300005843 Ga0068860_100125812 Ga0068860_1001258122 440
325 3300005844 Ga0068862_100075845 Ga0068862_1000758451 440
326 3300005844 Ga0068862_100161814 Ga0068862_1001618142 440
327 3300005983 Ga0081540_1002478 Ga0081540_10024784 440
328 3300005983 Ga0081540_1014897 Ga0081540_10148973 440
329 3300005985 Ga0081539_10003530 Ga0081539_100035302 440
330 3300006028 Ga0070717_10005195 Ga0070717_100051952 440
331 3300006038 Ga0075365_10026794 Ga0075365_100267942 440
332 3300006042 Ga0075368_10035512 Ga0075368_100355122 440
333 3300006048 Ga0075363_100003251 Ga0075363_1000032513 440
334 3300006178 Ga0075367_10016644 Ga0075367_100166441 440
335 3300006844 Ga0075428_100053195 Ga0075428_1000531952 440
336 3300006871 Ga0075434_100332896 Ga0075434_1003328961 440
337 3300006931 Ga0097620_100087951 Ga0097620_1000879512 440
338 3300007265 Ga0099794_10011134 Ga0099794_100111342 440
339 3300009093 Ga0105240_10004430 Ga0105240_1000443012 440
340 3300009093 Ga0105240_10130297 Ga0105240_101302972 440
341 3300009098 Ga0105245_10192146 Ga0105245_101921462 440
342 3300009101 Ga0105247_10101419 Ga0105247_101014192 440
343 3300009147 Ga0114129_10023896 Ga0114129_100238962 440
344 3300009545 Ga0105237_10045715 Ga0105237_100457152 440
345 3300009545 Ga0105237_10202540 Ga0105237_102025401 440
346 3300009551 Ga0105238_10083597 Ga0105238_100835972 440
347 3300010375 Ga0105239_10007523 Ga0105239_100075239 440
348 3300010375 Ga0105239_10049388 Ga0105239_100493883 440
349 3300010375 Ga0105239_10080394 Ga0105239_100803942 440
350 3300011119 Ga0105246_10036214 Ga0105246_100362142 440
351 3300013296 Ga0157374_10078526 Ga0157374_100785262 440
352 3300013297 Ga0157378_10194580 Ga0157378_101945801 440
353 3300013306 Ga0163162_10102070 Ga0163162_101020702 440
354 3300013306 Ga0163162_10314283 Ga0163162_103142831 440
355 3300013307 Ga0157372_10080044 Ga0157372_100800442 440
356 3300014968 Ga0157379_10093325 Ga0157379_100933252 440
357 3300025253 Ga0209677_102008 Ga0209677_1020081 440
358 3300025904 Ga0207647_10004518 Ga0207647_100045184 440
359 3300025911 Ga0207654_10000058 Ga0207654_1000005820 440
360 3300025913 Ga0207695_10000453 Ga0207695_100004536 440
361 3300025913 Ga0207695_10030300 Ga0207695_100303002 440
362 3300025914 Ga0207671_10034794 Ga0207671_100347943 440
363 3300025914 Ga0207671_10041863 Ga0207671_100418632 440
364 3300025919 Ga0207657_10169132 Ga0207657_101691321 440
365 3300025924 Ga0207694_10000564 Ga0207694_1000056417 440
366 3300025933 Ga0207706_10062207 Ga0207706_100622072 440
367 3300025935 Ga0207709_10019916 Ga0207709_100199162 440
368 3300025940 Ga0207691_10139354 Ga0207691_101393542 440
369 3300025942 Ga0207689_10111356 Ga0207689_101113562 440
370 3300025949 Ga0207667_10009339 Ga0207667_100093396 440
371 3300025949 Ga0207667_10144053 Ga0207667_101440532 440
372 3300025981 Ga0207640_10035826 Ga0207640_100358262 440
373 3300026023 Ga0207677_10020870 Ga0207677_100208702 440
374 3300026035 Ga0207703_10123765 Ga0207703_101237652 440
375 3300026041 Ga0207639_10001424 Ga0207639_100014249 440
376 3300026067 Ga0207678_10015000 Ga0207678_100150004 440
377 3300026067 Ga0207678_10027531 Ga0207678_100275314 440
378 3300026067 Ga0207678_10053426 Ga0207678_100534262 440
379 3300026078 Ga0207702_10000004 Ga0207702_10000004203 440
380 3300026078 Ga0207702_10028205 Ga0207702_100282051 440
381 3300026078 Ga0207702_10067275 Ga0207702_100672752 440
382 3300026095 Ga0207676_10157760 Ga0207676_101577601 440
383 3300026116 Ga0207674_10005590 Ga0207674_100055906 440
384 3300026121 Ga0207683_10145147 Ga0207683_101451472 440
385 3300026142 Ga0207698_10062289 Ga0207698_100622891 440
386 3300026142 Ga0207698_10164287 Ga0207698_101642871 440
387 3300026142 Ga0207698_10186115 Ga0207698_101861152 440
388 3300028379 Ga0268266_10000680 Ga0268266_1000068037 440
389 3300028379 Ga0268266_10012906 Ga0268266_100129062 440
390 3300028381 Ga0268264_10000062 Ga0268264_1000006273 440
391 3300028577 Ga0265318_10007399 Ga0265318_100073993 440
392 3300028653 Ga0265323_10008033 Ga0265323_100080331 440
393 3300028666 Ga0265336_10011786 Ga0265336_100117862 440
394 3300028786 Ga0307517_10000942 Ga0307517_100009423 440
395 3300028794 Ga0307515_10068562 Ga0307515_100685622 440
396 3300028800 Ga0265338_10009376 Ga0265338_100093765 440
397 3300029957 Ga0265324_10015196 Ga0265324_100151962 440
398 3300031235 Ga0265330_10013047 Ga0265330_100130474 440
399 3300031247 Ga0265340_10002209 Ga0265340_100022097 440
400 3300031730 Ga0307516_10061413 Ga0307516_100614133 440
401 3300033180 Ga0307510_10003483 Ga0307510_100034833 440
402 3300035116 Ga0373945_0013871 Ga0373945_0013871_131_1519 440
403 3300035118 Ga0373954_0013828 Ga0373954_0013828_900_2288 440
404 3300035170 Ga0373943_0002237 Ga0373943_0002237_3805_5193 440
405 3300035171 Ga0373946_0018418 Ga0373946_0018418_84_1472 440
406 3300035692 Ga0373935_0000500 Ga0373935_0000500_10227_11615 440
407 3300035695 Ga0373927_0000337 Ga0373927_0000337_14196_15584 440
408 3300035695 Ga0373927_0047665 Ga0373927_0047665_442_1833 440
409 3300035725 Ga0373947_0002043 Ga0373947_0002043_9633_11021 440
410 3300035725 Ga0373947_0028453 Ga0373947_0028453_1581_3020 440
411 3300036401 Ga0373937_0067455 Ga0373937_0067455_1013_2401 440
412 3300037068 Ga0373925_0003157 Ga0373925_0003157_8775_10163 440
413 3300046455 Ga0495603_0002436 Ga0495603_0002436_5195_6580 440
414 3300046455 Ga0495603_0011272 Ga0495603_0011272_1403_2842 440
415 3300046459 Ga0495629_0000727 Ga0495629_0000727_11877_13265 440
416 3300046460 Ga0495638_0089919 Ga0495638_0089919_204_1589 440
417 3300046461 Ga0495641_0007117 Ga0495641_0007117_1167_2555 440
418 3300046472 Ga0495580_0002297 Ga0495580_0002297_1765_3153 440
419 3300046473 Ga0495582_0000494 Ga0495582_0000494_5693_7081 440
420 3300046475 Ga0495639_0000119 Ga0495639_0000119_24849_26237 440
421 3300046476 Ga0495662_0001142 Ga0495662_0001142_8847_10235 440
422 3300046477 Ga0495664_0030058 Ga0495664_0030058_1706_3094 440
423 3300046499 Ga0495594_0008592 Ga0495594_0008592_1924_3312 440
424 3300046511 Ga0495608_0098998 Ga0495608_0098998_228_1616 440
425 3300046516 Ga0495628_0136539 Ga0495628_0136539_65_1453 440
426 3300046517 Ga0495630_0003675 Ga0495630_0003675_6872_8260 440
427 3300046524 Ga0495648_0099499 Ga0495648_0099499_188_1573 440
428 3300046525 Ga0495663_0008257 Ga0495663_0008257_619_2010 440
429 3300046526 Ga0495666_0006549 Ga0495666_0006549_281_1669 440
430 3300046529 Ga0495652_0022017 Ga0495652_0022017_2028_3416 440
431 3300046531 Ga0495665_0000251 Ga0495665_0000251_11879_13267 440
432 3300046536 Ga0495587_0008499 Ga0495587_0008499_165_1553 440
433 3300046557 Ga0495622_0004931 Ga0495622_0004931_2421_3809 440
434 3300046559 Ga0495667_0013097 Ga0495667_0013097_1793_3181 440
435 3300046615 Ga0495656_0021325 Ga0495656_0021325_1070_2461 440
436 3300046615 Ga0495656_0044683 Ga0495656_0044683_407_1795 440
437 3300046642 Ga0495634_0000886 Ga0495634_0000886_4545_5933 440
438 3300046663 Ga0495635_0001208 Ga0495635_0001208_4174_5562 440
439 3300046663 Ga0495635_0010109 Ga0495635_0010109_1993_3381 440
440 3300046674 Ga0495588_0041941 Ga0495588_0041941_825_2213 440
441 3300046675 Ga0495657_0001337 Ga0495657_0001337_8586_9974 440
442 3300046678 Ga0495599_0017403 Ga0495599_0017403_179_1567 440
443 3300046679 Ga0495623_0004412 Ga0495623_0004412_5853_7241 440
444 3300046680 Ga0495646_0023800 Ga0495646_0023800_1387_2775 440
445 3300046681 Ga0495647_0000085 Ga0495647_0000085_12771_14159 440
446 3300046683 Ga0495658_0000135 Ga0495658_0000135_26042_27430 440
447 3300046684 Ga0495669_0000707 Ga0495669_0000707_4651_6042 440
448 3300046689 Ga0495613_0001617 Ga0495613_0001617_8384_9772 440
449 3300046690 Ga0495624_0000144 Ga0495624_0000144_37735_39123 440
450 3300046809 Ga0495600_0002466 Ga0495600_0002466_5161_6549 440
451 3300047315 Ga0495581_0000421 Ga0495581_0000421_5566_6954 440
452 3300047317 Ga0495604_0003032 Ga0495604_0003032_8456_9844 440
453 3300047319 Ga0495674_0001274 Ga0495674_0001274_13539_14927 440
454 3300047319 Ga0495674_0026496 Ga0495674_0026496_444_1832 440
455 3300047321 Ga0495676_0007487 Ga0495676_0007487_8352_9740 440
456 3300047322 Ga0495680_0000791 Ga0495680_0000791_27911_29299 440
457 3300047444 Ga0495675_0003289 Ga0495675_0003289_7913_9301 440
458 3300047673 Ga0495593_0000007 Ga0495593_0000007_12683_14071 440
459 3300048908 Ga0496105_0033599 Ga0496105_0033599_777_2162 440
460 3300048909 Ga0496106_0020145 Ga0496106_0020145_335_1726 440
461 3300048909 Ga0496106_0021442 Ga0496106_0021442_1976_3361 440
462 3300048910 Ga0496107_0036264 Ga0496107_0036264_2058_3449 440
463 3300048911 Ga0496108_0013286 Ga0496108_0013286_718_2109 440
464 3300048913 Ga0496110_0050682 Ga0496110_0050682_2167_3552 440
465 3300048915 Ga0496112_0000035 Ga0496112_0000035_95483_96868 440
466 3300048916 Ga0496113_0083612 Ga0496113_0083612_158_1576 440
467 3300048916 Ga0496113_0114707 Ga0496113_0114707_696_2087 440
468 3300048917 Ga0496114_0031719 Ga0496114_0031719_2350_3741 440
469 3300048918 Ga0496115_0012788 Ga0496115_0012788_1680_3164 440
470 3300048918 Ga0496115_0014031 Ga0496115_0014031_4509_5897 440
471 3300048920 Ga0496117_0010324 Ga0496117_0010324_4891_6276 440
472 3300048921 Ga0496118_0020937 Ga0496118_0020937_2047_3432 440
473 3300048924 Ga0496121_0000203 Ga0496121_0000203_73659_75044 440
474 3300048924 Ga0496121_0082204 Ga0496121_0082204_961_2352 440
475 3300048927 Ga0496124_0022134 Ga0496124_0022134_2468_3853 440
476 3300048928 Ga0496125_0050627 Ga0496125_0050627_176_1561 440
477 3300048929 Ga0496126_0017429 Ga0496126_0017429_4722_6113 440
478 3300048929 Ga0496126_0022033 Ga0496126_0022033_2615_4000 440
479 3300048929 Ga0496126_0027307 Ga0496126_0027307_575_1960 440
480 3300048929 Ga0496126_0060915 Ga0496126_0060915_1118_2503 440
481 3300049569 Ga0501032_0000303 Ga0501032_0000303_6789_8201 440
482 3300049570 Ga0501033_0000881 Ga0501033_0000881_25796_27208 440
483 3300049571 Ga0501034_0000250 Ga0501034_0000250_92360_93772 440
484 3300049572 Ga0501036_0000047 Ga0501036_0000047_68749_70161 440
485 3300049573 Ga0501037_0000092 Ga0501037_0000092_1865_3277 440
486 3300049574 Ga0501038_0004865 Ga0501038_0004865_7378_8790 440
487 3300049575 Ga0501039_0000085 Ga0501039_0000085_3756_5168 440
488 3300049578 Ga0501042_0016184 Ga0501042_0016184_3594_5006 440
489 3300049579 Ga0501043_0005729 Ga0501043_0005729_8415_9827 440
490 3300049579 Ga0501043_0020072 Ga0501043_0020072_3450_4862 440
491 3300049580 Ga0501046_0000624 Ga0501046_0000624_25783_27195 440
492 3300049581 Ga0501047_0000022 Ga0501047_0000022_198393_199805 440
493 3300049582 Ga0501048_0007360 Ga0501048_0007360_6616_8028 440
494 3300049583 Ga0501067_0002068 Ga0501067_0002068_7775_9187 440
495 3300049584 Ga0501068_0001544 Ga0501068_0001544_6060_7472 440
496 3300049585 Ga0501069_0000513 Ga0501069_0000513_3278_4690 440
497 3300049587 Ga0501071_0030454 Ga0501071_0030454_187_1599 440
498 3300049588 Ga0501072_0002213 Ga0501072_0002213_6447_7859 440
499 3300049589 Ga0501073_0000109 Ga0501073_0000109_955_2367 440
500 3300049590 Ga0501074_0000250 Ga0501074_0000250_6666_8078 440
501 3300049592 Ga0501076_0044203 Ga0501076_0044203_1045_2457 440
502 3300049741 Ga0501079_0005328 Ga0501079_0005328_4578_5990 440
503 3300049741 Ga0501079_0122200 Ga0501079_0122200_538_1950 440
504 3300049744 Ga0501083_0001496 Ga0501083_0001496_6851_8263 440
505 3300049822 Ga0501035_0006867 Ga0501035_0006867_5636_7048 440
506 3300049822 Ga0501035_0191630 Ga0501035_0191630_280_1692 440
507 3300049823 Ga0501044_0000072 Ga0501044_0000072_84990_86402 440
508 3300049823 Ga0501044_0016861 Ga0501044_0016861_3909_5321 440
509 3300050490 nmdc:mga03n38_100_c1 nmdc:mga03n38_100_c1_1896_3281 440
510 3300050492 nmdc:mga0yw44_15340_c1 nmdc:mga0yw44_15340_c1_1043_2428 440
511 3300050507 nmdc:mga05p37_82927_c1 nmdc:mga05p37_82927_c1_2205_3593 440
512 3300050516 nmdc:mga0sz30_14357_c1 nmdc:mga0sz30_14357_c1_104_1492 440
513 3300053085 Ga0495619_0081978 Ga0495619_0081978_133_1521 440
514 3300053096 Ga0500641_0007715 Ga0500641_0007715_1691_3145 440
515 3300053111 Ga0500572_000234 Ga0500572_000234_1623_3008 440
516 3300053130 Ga0500642_0046354 Ga0500642_0046354_52_1443 440
517 3300053136 Ga0500559_0000244 Ga0500559_0000244_24882_26267 440
518 3300053725 Ga0500576_055274 Ga0500576_055274_242_1627 440
519 3300054114 Ga0501084_0006091 Ga0501084_0006091_7830_9242 440
520 3300060353 Ga0501082_0002413 Ga0501082_0002413_6460_7872 440

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11700

ATG22

Vacuole effluxer Atg22 like

82

322

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.7027 19 435
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.6975 19 439
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.6878 19 439
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.6868 19 435
8d2s-assembly1.cif.gz_A zebrafish mfsd2a isoform b in inward open ligand bound conformation 0.6811 15 434
ID Description Score Start End Superfamily
af_O06171_14_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8873 21 227 1.20.1250.20
af_O06171_14_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8362 21 227 1.20.1250.20
af_Q54IX9_60_277_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.787 18 237 1.20.1250.20
af_O23203_10_235_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7784 21 231 1.20.1250.20
af_Q08268_95_284_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7768 20 238 1.20.1250.20
ID Description Score Start End GO Terms
AF-K0VTF6-F1-model_v4 Major facilitator superfamily protein 0.9304 38 319 GO:0012505
GO:0016020
AF-A0A431P721-F1-model_v4 deleted 0.9283 1 274
AF-K0VTF6-F1-model_v4 Major facilitator superfamily protein 0.9242 38 319 GO:0012505
GO:0016020
AF-A0A3D5U8F1-F1-model_v4 MFS transporter 0.9223 18 312 GO:0012505
GO:0016020
AF-A0A7X4EVL7-F1-model_v4 MFS transporter 0.922 3 296 GO:0012505
GO:0016020

Feature Viewer

pLDDT pTM Quality
77.45 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map