F458546
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 377 | 412 | 456 |
Family's Representative Sequence
| Representative Sequence | 3300025940|Ga0207691_10145427|Ga0207691_101454272 |
| Length | 550 |
| Sequence | MLYGYRRQAKRLLVITRDISGMAVIASEAIGAEIPQRYPRRAAVISWIFFDWAAQPYFTLITTFVFAPYFASFVAPNPATGQALWGFATAAAGLTIALLSPVLGAIADASGRRKPWIAGFGALLVIGSSLMWIGKPGDPSIIPPLLLAYAIASVGVEFATVFNNAMMPTLVPPDKIGRLSGTGWATGYIGGIFSLILVLGFLAANPETGRTLFGFAPLFGLDPVTHQGDRITGPLTGIWFIIFALPMFLLTPDYPAKHPVRAALREGLTELKQTLGELPKQKSMATFLLANMIYTDGLVSLFAFGGIYAAGTFGWHTIQFIEQHERRGDAGRRDRGVGXXXVLALHLERADVDDAGEFADAVEEQREVVIRPFELQRDRPLGVQLFGDRRRRLEALDGHVRLRGHRLHAVQQVGGVLLFGQDRLEVGKAPFEVGHLRAELRQFLRRAQALVDVVAQRHELRLPRDHVGLHRHLVVVVENSAASDRQADKGPDLGVPRQLGERQFHVRFAIRAYRDDARRPLNTVDIGVSSPLSLREPPALPFRRAPETRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 9 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 14 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 15 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 18 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 19 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 20 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 21 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 22 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 23 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 24 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 25 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 26 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 27 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 28 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 29 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 30 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 31 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 32 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 33 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 34 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 35 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 36 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 37 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 38 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 39 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 40 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 41 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 42 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 43 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 44 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 45 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 46 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 47 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 48 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 49 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 50 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 51 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 52 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 53 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 54 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 55 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 56 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 57 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 58 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 59 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 60 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 61 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 62 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 63 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 64 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 65 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 66 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 67 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 68 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 69 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 70 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 71 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 72 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 73 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 74 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 75 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 76 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 77 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 78 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 79 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 80 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 81 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 82 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 83 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 84 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 85 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 86 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 87 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 88 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 89 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 90 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 91 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 92 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 116 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 117 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 118 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 120 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 121 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 128 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 130 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 131 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 136 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 137 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 219 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 239 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 299 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 300 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 309 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 310 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 311 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 312 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 358 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 359 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 360 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 361 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 363 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 365 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 366 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 367 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 368 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 369 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 370 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 371 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 372 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 373 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 374 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 375 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 376 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 377 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80 |
| Metatranscriptomes | 0 |
| Isolates | 20 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.5 |
| Nodule | 16.92 |
| Rhizoplane | 6.92 |
| Rhizosphere | 60.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000570 | 3300001979 | Bacteria | 15869 |
| 2 | JGI24739J22299_10030723 | 3300001989 | Bacteria | 1861 |
| 3 | JGI25406J46586_10000463 | 3300003203 | Bacteria | 18957 |
| 4 | JGI25160J50197_1001638 | 3300003354 | Bacteria | 10988 |
| 5 | JGI25160J50197_1002980 | 3300003354 | Bacteria | 7727 |
| 6 | JGI25160J50197_1011101 | 3300003354 | Bacteria | 3213 |
| 7 | Ga0055543_1004294 | 3300004625 | Bacteria | 3921 |
| 8 | Ga0065165_1002933 | 3300005262 | Bacteria | 13012 |
| 9 | Ga0065165_1022823 | 3300005262 | Bacteria | 2135 |
| 10 | Ga0070676_10071214 | 3300005328 | Bacteria | 2088 |
| 11 | Ga0070682_100111510 | 3300005337 | Bacteria | 1824 |
| 12 | Ga0070668_100047884 | 3300005347 | Bacteria | 3287 |
| 13 | Ga0070669_100141110 | 3300005353 | Bacteria | 1858 |
| 14 | Ga0070659_100094014 | 3300005366 | Bacteria | 2407 |
| 15 | Ga0070709_10113366 | 3300005434 | Bacteria | 1826 |
| 16 | Ga0070714_100014255 | 3300005435 | Bacteria | 6383 |
| 17 | Ga0070714_100065114 | 3300005435 | Bacteria | 3138 |
| 18 | Ga0070714_100073645 | 3300005435 | Bacteria | 2959 |
| 19 | Ga0070713_100002398 | 3300005436 | Bacteria | 12220 |
| 20 | Ga0070713_100226423 | 3300005436 | Bacteria | 1698 |
| 21 | Ga0070710_10000880 | 3300005437 | Bacteria | 14380 |
| 22 | Ga0070711_100007845 | 3300005439 | Bacteria | 6506 |
| 23 | Ga0070711_100011167 | 3300005439 | Bacteria | 5570 |
| 24 | Ga0070711_100110667 | 3300005439 | Bacteria | 2016 |
| 25 | Ga0070700_100029325 | 3300005441 | Bacteria | 3279 |
| 26 | Ga0070663_100023849 | 3300005455 | Bacteria | 4107 |
| 27 | Ga0070663_100035190 | 3300005455 | Bacteria | 3473 |
| 28 | Ga0070663_100061577 | 3300005455 | Bacteria | 2703 |
| 29 | Ga0070663_100071998 | 3300005455 | Bacteria | 2517 |
| 30 | Ga0070678_100186806 | 3300005456 | Bacteria | 1701 |
| 31 | Ga0070662_100041752 | 3300005457 | Bacteria | 3274 |
| 32 | Ga0068853_100021754 | 3300005539 | Bacteria | 5350 |
| 33 | Ga0068853_100028465 | 3300005539 | Bacteria | 4700 |
| 34 | Ga0068853_100105212 | 3300005539 | Bacteria | 2500 |
| 35 | Ga0070665_100039229 | 3300005548 | Bacteria | 4763 |
| 36 | Ga0070665_100109966 | 3300005548 | Bacteria | 2758 |
| 37 | Ga0070665_100171531 | 3300005548 | Bacteria | 2170 |
| 38 | Ga0070704_100105694 | 3300005549 | Bacteria | 2132 |
| 39 | Ga0068855_100009982 | 3300005563 | Bacteria | 11442 |
| 40 | Ga0068855_100101281 | 3300005563 | Bacteria | 3316 |
| 41 | Ga0070664_100070956 | 3300005564 | Bacteria | 2984 |
| 42 | Ga0068857_100008515 | 3300005577 | Bacteria | 8868 |
| 43 | Ga0068854_100003786 | 3300005578 | Bacteria | 9459 |
| 44 | Ga0068854_100139813 | 3300005578 | Bacteria | 1857 |
| 45 | Ga0068854_100161047 | 3300005578 | Bacteria | 1738 |
| 46 | Ga0068856_100002838 | 3300005614 | Bacteria | 17741 |
| 47 | Ga0068856_100026353 | 3300005614 | Bacteria | 5669 |
| 48 | Ga0068856_100038677 | 3300005614 | Bacteria | 4683 |
| 49 | Ga0068856_100134990 | 3300005614 | Bacteria | 2473 |
| 50 | Ga0070702_100145263 | 3300005615 | Bacteria | 1516 |
| 51 | Ga0068859_100087949 | 3300005617 | Bacteria | 3155 |
| 52 | Ga0068861_100011567 | 3300005719 | Bacteria | 6141 |
| 53 | Ga0068861_100095412 | 3300005719 | Bacteria | 2355 |
| 54 | Ga0068851_10000402 | 3300005834 | Bacteria | 19592 |
| 55 | Ga0068858_100059862 | 3300005842 | Bacteria | 3520 |
| 56 | Ga0068858_100189859 | 3300005842 | Bacteria | 1941 |
| 57 | Ga0068860_100000433 | 3300005843 | Bacteria | 53218 |
| 58 | Ga0068860_100125812 | 3300005843 | Bacteria | 2457 |
| 59 | Ga0068862_100075845 | 3300005844 | Bacteria | 2909 |
| 60 | Ga0068862_100161814 | 3300005844 | Bacteria | 1998 |
| 61 | Ga0081455_10005195 | 3300005937 | Bacteria | 14318 |
| 62 | Ga0081455_10160677 | 3300005937 | Bacteria | 1722 |
| 63 | Ga0081540_1002478 | 3300005983 | Bacteria | 15036 |
| 64 | Ga0081540_1005988 | 3300005983 | Bacteria | 8956 |
| 65 | Ga0081540_1014897 | 3300005983 | Bacteria | 4946 |
| 66 | Ga0081539_10003530 | 3300005985 | Bacteria | 19031 |
| 67 | Ga0070717_10005195 | 3300006028 | Bacteria | 9483 |
| 68 | Ga0070717_10072932 | 3300006028 | Bacteria | 2868 |
| 69 | Ga0075365_10026794 | 3300006038 | Bacteria | 3663 |
| 70 | Ga0075368_10035512 | 3300006042 | Bacteria | 1945 |
| 71 | Ga0075363_100003251 | 3300006048 | Bacteria | 6874 |
| 72 | Ga0070712_100003780 | 3300006175 | Bacteria | 9321 |
| 73 | Ga0075367_10016644 | 3300006178 | Bacteria | 4018 |
| 74 | Ga0068871_100142224 | 3300006358 | Bacteria | 2041 |
| 75 | Ga0075428_100053195 | 3300006844 | Bacteria | 4436 |
| 76 | Ga0075434_100332896 | 3300006871 | Bacteria | 1539 |
| 77 | Ga0075436_100060692 | 3300006914 | Bacteria | 2612 |
| 78 | Ga0097620_100087951 | 3300006931 | Bacteria | 3155 |
| 79 | Ga0099794_10011134 | 3300007265 | Bacteria | 3844 |
| 80 | Ga0105240_10004430 | 3300009093 | Bacteria | 21410 |
| 81 | Ga0105240_10037459 | 3300009093 | Bacteria | 6233 |
| 82 | Ga0105240_10130297 | 3300009093 | Bacteria | 3018 |
| 83 | Ga0111539_10043992 | 3300009094 | Bacteria | 5352 |
| 84 | Ga0105245_10192146 | 3300009098 | Bacteria | 1956 |
| 85 | Ga0105247_10101419 | 3300009101 | Bacteria | 1840 |
| 86 | Ga0114129_10023896 | 3300009147 | Bacteria | 8662 |
| 87 | Ga0105243_10167515 | 3300009148 | Bacteria | 1900 |
| 88 | Ga0105241_10043573 | 3300009174 | Bacteria | 3399 |
| 89 | Ga0105237_10045715 | 3300009545 | Bacteria | 4405 |
| 90 | Ga0105237_10202540 | 3300009545 | Bacteria | 1985 |
| 91 | Ga0105238_10007309 | 3300009551 | Bacteria | 11059 |
| 92 | Ga0105238_10083597 | 3300009551 | Bacteria | 3181 |
| 93 | Ga0105238_10087810 | 3300009551 | Bacteria | 3096 |
| 94 | Ga0105239_10007523 | 3300010375 | Bacteria | 12489 |
| 95 | Ga0105239_10047342 | 3300010375 | Bacteria | 4713 |
| 96 | Ga0105239_10049388 | 3300010375 | Bacteria | 4614 |
| 97 | Ga0105239_10080394 | 3300010375 | Bacteria | 3586 |
| 98 | Ga0105239_10100673 | 3300010375 | Bacteria | 3196 |
| 99 | Ga0105239_10221994 | 3300010375 | Bacteria | 2119 |
| 100 | Ga0105246_10036214 | 3300011119 | Bacteria | 3304 |
| 101 | Ga0157374_10078526 | 3300013296 | Bacteria | 3126 |
| 102 | Ga0157378_10075530 | 3300013297 | Bacteria | 3034 |
| 103 | Ga0157378_10194580 | 3300013297 | Bacteria | 1915 |
| 104 | Ga0163162_10102070 | 3300013306 | Bacteria | 2961 |
| 105 | Ga0163162_10314283 | 3300013306 | Bacteria | 1699 |
| 106 | Ga0157372_10080044 | 3300013307 | Bacteria | 3696 |
| 107 | Ga0157380_10101275 | 3300014326 | Bacteria | 2400 |
| 108 | Ga0157379_10093325 | 3300014968 | Bacteria | 2700 |
| 109 | Ga0157376_10002020 | 3300014969 | Bacteria | 13604 |
| 110 | Ga0209677_101634 | 3300025253 | Bacteria | 9449 |
| 111 | Ga0209677_102008 | 3300025253 | Bacteria | 8092 |
| 112 | Ga0209233_1002848 | 3300025261 | Bacteria | 6200 |
| 113 | Ga0209233_1008434 | 3300025261 | Bacteria | 3193 |
| 114 | Ga0209455_1004485 | 3300025272 | Bacteria | 4550 |
| 115 | Ga0209758_1003514 | 3300025297 | Bacteria | 14143 |
| 116 | Ga0209758_1004217 | 3300025297 | Bacteria | 12175 |
| 117 | Ga0207426_1000420 | 3300025302 | Bacteria | 69895 |
| 118 | Ga0207426_1020116 | 3300025302 | Bacteria | 2324 |
| 119 | Ga0207692_10003479 | 3300025898 | Bacteria | 6154 |
| 120 | Ga0207688_10045394 | 3300025901 | Bacteria | 2451 |
| 121 | Ga0207647_10004518 | 3300025904 | Bacteria | 10306 |
| 122 | Ga0207699_10013790 | 3300025906 | Bacteria | 4147 |
| 123 | Ga0207645_10020873 | 3300025907 | Bacteria | 4279 |
| 124 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 125 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 126 | Ga0207695_10030300 | 3300025913 | Bacteria | 5958 |
| 127 | Ga0207671_10034794 | 3300025914 | Bacteria | 3742 |
| 128 | Ga0207671_10041863 | 3300025914 | Bacteria | 3391 |
| 129 | Ga0207693_10001606 | 3300025915 | Bacteria | 20003 |
| 130 | Ga0207693_10003386 | 3300025915 | Bacteria | 13620 |
| 131 | Ga0207693_10053413 | 3300025915 | Bacteria | 3170 |
| 132 | Ga0207663_10000390 | 3300025916 | Bacteria | 19024 |
| 133 | Ga0207663_10005653 | 3300025916 | Bacteria | 6319 |
| 134 | Ga0207657_10169132 | 3300025919 | Bacteria | 1772 |
| 135 | Ga0207694_10000564 | 3300025924 | Bacteria | 33580 |
| 136 | Ga0207694_10079452 | 3300025924 | Bacteria | 2572 |
| 137 | Ga0207664_10025264 | 3300025929 | Bacteria | 4472 |
| 138 | Ga0207664_10056988 | 3300025929 | Bacteria | 3105 |
| 139 | Ga0207706_10062207 | 3300025933 | Bacteria | 3287 |
| 140 | Ga0207709_10019916 | 3300025935 | Bacteria | 3779 |
| 141 | Ga0207665_10000444 | 3300025939 | Bacteria | 28370 |
| 142 | Ga0207691_10033936 | 3300025940 | Bacteria | 4750 |
| 143 | Ga0207691_10139354 | 3300025940 | Bacteria | 2138 |
| 144 | Ga0207691_10145427 | 3300025940 | Bacteria | 2087 |
| 145 | Ga0207689_10035377 | 3300025942 | Bacteria | 4150 |
| 146 | Ga0207689_10111356 | 3300025942 | Bacteria | 2250 |
| 147 | Ga0207679_10062491 | 3300025945 | Bacteria | 2775 |
| 148 | Ga0207667_10009339 | 3300025949 | Bacteria | 11566 |
| 149 | Ga0207667_10144053 | 3300025949 | Bacteria | 2453 |
| 150 | Ga0207668_10088648 | 3300025972 | Bacteria | 2266 |
| 151 | Ga0207640_10035826 | 3300025981 | Bacteria | 3109 |
| 152 | Ga0207658_10085560 | 3300025986 | Bacteria | 2429 |
| 153 | Ga0207677_10020870 | 3300026023 | Bacteria | 3991 |
| 154 | Ga0207703_10123765 | 3300026035 | Bacteria | 2223 |
| 155 | Ga0207639_10001424 | 3300026041 | Bacteria | 16178 |
| 156 | Ga0207639_10064311 | 3300026041 | Bacteria | 2844 |
| 157 | Ga0207678_10015000 | 3300026067 | Bacteria | 6817 |
| 158 | Ga0207678_10027531 | 3300026067 | Bacteria | 4960 |
| 159 | Ga0207678_10043553 | 3300026067 | Bacteria | 3884 |
| 160 | Ga0207678_10053426 | 3300026067 | Bacteria | 3481 |
| 161 | Ga0207678_10131745 | 3300026067 | Bacteria | 2133 |
| 162 | Ga0207708_10120651 | 3300026075 | Bacteria | 2042 |
| 163 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 164 | Ga0207702_10028205 | 3300026078 | Bacteria | 4665 |
| 165 | Ga0207702_10067275 | 3300026078 | Bacteria | 3074 |
| 166 | Ga0207648_10036345 | 3300026089 | Bacteria | 4339 |
| 167 | Ga0207676_10157760 | 3300026095 | Bacteria | 1962 |
| 168 | Ga0207674_10005590 | 3300026116 | Bacteria | 14903 |
| 169 | Ga0207683_10145147 | 3300026121 | Bacteria | 2140 |
| 170 | Ga0207698_10062289 | 3300026142 | Bacteria | 2912 |
| 171 | Ga0207698_10070609 | 3300026142 | Bacteria | 2768 |
| 172 | Ga0207698_10164287 | 3300026142 | Bacteria | 1946 |
| 173 | Ga0207698_10186115 | 3300026142 | Bacteria | 1845 |
| 174 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 175 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 176 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 177 | Ga0207428_10054066 | 3300027907 | Bacteria | 3199 |
| 178 | Ga0268266_10000680 | 3300028379 | Bacteria | 45937 |
| 179 | Ga0268266_10012906 | 3300028379 | Bacteria | 7208 |
| 180 | Ga0268266_10057719 | 3300028379 | Bacteria | 3341 |
| 181 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 182 | Ga0265318_10007399 | 3300028577 | Bacteria | 4968 |
| 183 | Ga0265323_10008033 | 3300028653 | Bacteria | 4363 |
| 184 | Ga0265336_10011786 | 3300028666 | Bacteria | 2959 |
| 185 | Ga0307517_10000942 | 3300028786 | Bacteria | 49547 |
| 186 | Ga0307515_10068562 | 3300028794 | Bacteria | 4870 |
| 187 | Ga0265338_10009376 | 3300028800 | Bacteria | 11688 |
| 188 | Ga0265324_10015196 | 3300029957 | Bacteria | 2834 |
| 189 | Ga0265330_10013047 | 3300031235 | Bacteria | 3877 |
| 190 | Ga0265332_10011856 | 3300031238 | Bacteria | 3872 |
| 191 | Ga0265340_10002209 | 3300031247 | Bacteria | 11138 |
| 192 | Ga0307508_10000108 | 3300031616 | Bacteria | 97443 |
| 193 | Ga0265314_10002048 | 3300031711 | Bacteria | 21322 |
| 194 | Ga0265314_10038049 | 3300031711 | Bacteria | 3480 |
| 195 | Ga0265342_10015551 | 3300031712 | Bacteria | 5002 |
| 196 | Ga0307516_10061413 | 3300031730 | Bacteria | 3646 |
| 197 | Ga0307510_10003483 | 3300033180 | Bacteria | 18332 |
| 198 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 199 | Ga0316214_1003581 | 3300033545 | Bacteria | 1965 |
| 200 | Ga0373936_0012325 | 3300035113 | Bacteria | 3251 |
| 201 | Ga0373945_0013871 | 3300035116 | Bacteria | 2695 |
| 202 | Ga0373954_0000242 | 3300035118 | Bacteria | 20003 |
| 203 | Ga0373954_0013828 | 3300035118 | Bacteria | 3597 |
| 204 | Ga0373957_0000417 | 3300035120 | Bacteria | 10760 |
| 205 | Ga0373943_0002237 | 3300035170 | Bacteria | 8797 |
| 206 | Ga0373946_0018418 | 3300035171 | Bacteria | 2682 |
| 207 | Ga0373955_0001044 | 3300035172 | Bacteria | 11768 |
| 208 | Ga0373935_0000500 | 3300035692 | Bacteria | 20245 |
| 209 | Ga0373927_0000337 | 3300035695 | Bacteria | 36861 |
| 210 | Ga0373927_0047665 | 3300035695 | Bacteria | 2772 |
| 211 | Ga0373933_0007539 | 3300035724 | Bacteria | 5945 |
| 212 | Ga0373947_0002043 | 3300035725 | Bacteria | 12316 |
| 213 | Ga0373947_0028453 | 3300035725 | Bacteria | 3277 |
| 214 | Ga0373937_0067455 | 3300036401 | Bacteria | 3296 |
| 215 | Ga0373925_0003157 | 3300037068 | Bacteria | 12909 |
| 216 | Ga0373925_0076785 | 3300037068 | Bacteria | 2534 |
| 217 | Ga0395898_0010389 | 3300037466 | Bacteria | 9734 |
| 218 | Ga0436365_1721875 | 3300039437 | Bacteria | 3982 |
| 219 | Ga0436360_0974944 | 3300039438 | Bacteria | 2922 |
| 220 | Ga0436361_0053567 | 3300039447 | Bacteria | 1845 |
| 221 | Ga0466969_0006896 | 3300044656 | Bacteria | 6046 |
| 222 | Ga0466966_0000359 | 3300044684 | Bacteria | 29538 |
| 223 | Ga0466961_0000074 | 3300044693 | Bacteria | 61968 |
| 224 | Ga0466959_0008397 | 3300045049 | Bacteria | 7300 |
| 225 | Ga0466967_0069108 | 3300045976 | Bacteria | 3156 |
| 226 | Ga0495603_0002436 | 3300046455 | Bacteria | 10943 |
| 227 | Ga0495603_0011272 | 3300046455 | Bacteria | 5417 |
| 228 | Ga0495629_0000727 | 3300046459 | Bacteria | 26728 |
| 229 | Ga0495638_0089919 | 3300046460 | Bacteria | 1851 |
| 230 | Ga0495641_0007117 | 3300046461 | Bacteria | 7073 |
| 231 | Ga0495651_0032462 | 3300046462 | Bacteria | 4072 |
| 232 | Ga0495651_0035673 | 3300046462 | Bacteria | 3872 |
| 233 | Ga0495653_0000465 | 3300046463 | Bacteria | 31535 |
| 234 | Ga0495580_0002297 | 3300046472 | Bacteria | 16691 |
| 235 | Ga0495582_0000494 | 3300046473 | Bacteria | 21572 |
| 236 | Ga0495605_0050823 | 3300046474 | Bacteria | 2021 |
| 237 | Ga0495639_0000119 | 3300046475 | Bacteria | 39930 |
| 238 | Ga0495662_0001142 | 3300046476 | Bacteria | 13095 |
| 239 | Ga0495664_0030058 | 3300046477 | Bacteria | 3181 |
| 240 | Ga0495594_0008592 | 3300046499 | Bacteria | 5264 |
| 241 | Ga0495594_0058680 | 3300046499 | Bacteria | 2127 |
| 242 | Ga0495606_0076918 | 3300046507 | Bacteria | 2085 |
| 243 | Ga0495608_0001489 | 3300046511 | Bacteria | 16666 |
| 244 | Ga0495608_0098998 | 3300046511 | Bacteria | 1881 |
| 245 | Ga0495608_0123468 | 3300046511 | Bacteria | 1659 |
| 246 | Ga0495628_0136539 | 3300046516 | Bacteria | 1874 |
| 247 | Ga0495630_0003675 | 3300046517 | Bacteria | 10698 |
| 248 | Ga0495648_0099499 | 3300046524 | Bacteria | 1608 |
| 249 | Ga0495663_0008257 | 3300046525 | Bacteria | 2883 |
| 250 | Ga0495666_0006549 | 3300046526 | Bacteria | 5859 |
| 251 | Ga0495666_0046855 | 3300046526 | Bacteria | 2083 |
| 252 | Ga0495652_0022017 | 3300046529 | Bacteria | 5662 |
| 253 | Ga0495665_0000251 | 3300046531 | Bacteria | 26959 |
| 254 | Ga0495640_0002679 | 3300046533 | Bacteria | 14309 |
| 255 | Ga0495587_0004444 | 3300046536 | Bacteria | 9241 |
| 256 | Ga0495587_0008499 | 3300046536 | Bacteria | 6599 |
| 257 | Ga0495645_0017210 | 3300046543 | Bacteria | 5177 |
| 258 | Ga0495622_0004931 | 3300046557 | Bacteria | 6179 |
| 259 | Ga0495667_0001146 | 3300046559 | Bacteria | 17281 |
| 260 | Ga0495667_0013097 | 3300046559 | Bacteria | 5617 |
| 261 | Ga0495656_0021325 | 3300046615 | Bacteria | 2521 |
| 262 | Ga0495656_0044683 | 3300046615 | Bacteria | 1867 |
| 263 | Ga0495634_0000886 | 3300046642 | Bacteria | 28754 |
| 264 | Ga0495634_0004544 | 3300046642 | Bacteria | 10857 |
| 265 | Ga0495634_0018287 | 3300046642 | Bacteria | 4991 |
| 266 | Ga0495635_0001208 | 3300046663 | Bacteria | 17261 |
| 267 | Ga0495635_0005740 | 3300046663 | Bacteria | 8646 |
| 268 | Ga0495635_0010109 | 3300046663 | Bacteria | 6599 |
| 269 | Ga0495659_0013259 | 3300046664 | Bacteria | 2682 |
| 270 | Ga0495588_0041941 | 3300046674 | Bacteria | 2338 |
| 271 | Ga0495657_0001030 | 3300046675 | Bacteria | 24459 |
| 272 | Ga0495657_0001337 | 3300046675 | Bacteria | 21445 |
| 273 | Ga0495657_0040622 | 3300046675 | Bacteria | 3189 |
| 274 | Ga0495599_0000873 | 3300046678 | Bacteria | 16867 |
| 275 | Ga0495599_0017403 | 3300046678 | Bacteria | 4469 |
| 276 | Ga0495623_0004412 | 3300046679 | Bacteria | 9246 |
| 277 | Ga0495646_0001852 | 3300046680 | Bacteria | 12711 |
| 278 | Ga0495646_0023800 | 3300046680 | Bacteria | 3856 |
| 279 | Ga0495647_0000085 | 3300046681 | Bacteria | 22908 |
| 280 | Ga0495658_0000135 | 3300046683 | Bacteria | 40991 |
| 281 | Ga0495669_0000707 | 3300046684 | Bacteria | 14557 |
| 282 | Ga0495613_0001617 | 3300046689 | Bacteria | 17148 |
| 283 | Ga0495624_0000144 | 3300046690 | Bacteria | 51509 |
| 284 | Ga0495624_0016618 | 3300046690 | Bacteria | 4952 |
| 285 | Ga0495649_0013892 | 3300046694 | Bacteria | 4631 |
| 286 | Ga0495600_0000768 | 3300046809 | Bacteria | 16897 |
| 287 | Ga0495600_0002466 | 3300046809 | Bacteria | 10617 |
| 288 | Ga0495581_0000421 | 3300047315 | Bacteria | 21445 |
| 289 | Ga0495604_0003032 | 3300047317 | Bacteria | 13430 |
| 290 | Ga0495604_0009371 | 3300047317 | Bacteria | 7744 |
| 291 | Ga0495604_0130453 | 3300047317 | Bacteria | 1807 |
| 292 | Ga0495674_0001274 | 3300047319 | Bacteria | 24483 |
| 293 | Ga0495674_0026496 | 3300047319 | Bacteria | 5304 |
| 294 | Ga0495676_0006058 | 3300047321 | Bacteria | 11115 |
| 295 | Ga0495676_0007487 | 3300047321 | Bacteria | 10015 |
| 296 | Ga0495680_0000791 | 3300047322 | Bacteria | 35389 |
| 297 | Ga0495683_0043674 | 3300047323 | Bacteria | 2256 |
| 298 | Ga0495675_0003063 | 3300047444 | Bacteria | 10046 |
| 299 | Ga0495675_0003289 | 3300047444 | Bacteria | 9716 |
| 300 | Ga0495684_0000169 | 3300047471 | Bacteria | 49164 |
| 301 | Ga0495593_0000007 | 3300047673 | Bacteria | 87657 |
| 302 | Ga0495602_0051410 | 3300048088 | Bacteria | 3670 |
| 303 | Ga0496100_0027040 | 3300048903 | Bacteria | 3523 |
| 304 | Ga0496101_0016754 | 3300048904 | Bacteria | 4960 |
| 305 | Ga0496101_0154224 | 3300048904 | Bacteria | 1758 |
| 306 | Ga0496102_0003496 | 3300048905 | Bacteria | 13323 |
| 307 | Ga0496102_0009172 | 3300048905 | Bacteria | 8488 |
| 308 | Ga0496104_0070977 | 3300048907 | Bacteria | 3311 |
| 309 | Ga0496105_0033599 | 3300048908 | Bacteria | 4214 |
| 310 | Ga0496106_0020145 | 3300048909 | Bacteria | 4948 |
| 311 | Ga0496106_0021442 | 3300048909 | Bacteria | 4797 |
| 312 | Ga0496107_0005303 | 3300048910 | Bacteria | 8810 |
| 313 | Ga0496107_0036264 | 3300048910 | Bacteria | 3537 |
| 314 | Ga0496107_0064227 | 3300048910 | Bacteria | 2661 |
| 315 | Ga0496108_0007489 | 3300048911 | Bacteria | 8847 |
| 316 | Ga0496108_0013286 | 3300048911 | Bacteria | 6713 |
| 317 | Ga0496109_0003252 | 3300048912 | Bacteria | 13541 |
| 318 | Ga0496109_0035144 | 3300048912 | Bacteria | 4519 |
| 319 | Ga0496109_0051350 | 3300048912 | Bacteria | 3756 |
| 320 | Ga0496110_0012904 | 3300048913 | Bacteria | 6888 |
| 321 | Ga0496110_0016515 | 3300048913 | Bacteria | 6164 |
| 322 | Ga0496110_0050682 | 3300048913 | Bacteria | 3646 |
| 323 | Ga0496111_0024507 | 3300048914 | Bacteria | 4250 |
| 324 | Ga0496112_0000035 | 3300048915 | Bacteria | 106983 |
| 325 | Ga0496112_0003481 | 3300048915 | Bacteria | 13031 |
| 326 | Ga0496112_0142116 | 3300048915 | Bacteria | 2369 |
| 327 | Ga0496113_0048497 | 3300048916 | Bacteria | 3160 |
| 328 | Ga0496113_0061661 | 3300048916 | Bacteria | 2830 |
| 329 | Ga0496113_0083612 | 3300048916 | Bacteria | 2449 |
| 330 | Ga0496113_0114707 | 3300048916 | Bacteria | 2101 |
| 331 | Ga0496114_0031719 | 3300048917 | Bacteria | 4347 |
| 332 | Ga0496115_0002653 | 3300048918 | Bacteria | 12842 |
| 333 | Ga0496115_0012788 | 3300048918 | Bacteria | 6328 |
| 334 | Ga0496115_0014031 | 3300048918 | Bacteria | 6065 |
| 335 | Ga0496115_0031184 | 3300048918 | Bacteria | 4198 |
| 336 | Ga0496115_0065946 | 3300048918 | Bacteria | 2925 |
| 337 | Ga0496115_0141090 | 3300048918 | Bacteria | 1988 |
| 338 | Ga0496117_0010324 | 3300048920 | Bacteria | 8535 |
| 339 | Ga0496117_0062325 | 3300048920 | Bacteria | 2556 |
| 340 | Ga0496118_0010548 | 3300048921 | Bacteria | 9136 |
| 341 | Ga0496118_0020937 | 3300048921 | Bacteria | 5782 |
| 342 | Ga0496121_0000203 | 3300048924 | Bacteria | 130984 |
| 343 | Ga0496121_0000893 | 3300048924 | Bacteria | 53847 |
| 344 | Ga0496121_0082204 | 3300048924 | Bacteria | 2547 |
| 345 | Ga0496124_0022134 | 3300048927 | Bacteria | 5834 |
| 346 | Ga0496125_0050627 | 3300048928 | Bacteria | 3437 |
| 347 | Ga0496126_0017429 | 3300048929 | Bacteria | 7156 |
| 348 | Ga0496126_0022033 | 3300048929 | Bacteria | 6208 |
| 349 | Ga0496126_0027307 | 3300048929 | Bacteria | 5454 |
| 350 | Ga0496126_0060915 | 3300048929 | Bacteria | 3392 |
| 351 | Ga0496126_0073482 | 3300048929 | Bacteria | 3040 |
| 352 | Ga0495682_0008725 | 3300049460 | Bacteria | 3989 |
| 353 | Ga0501032_0000303 | 3300049569 | Bacteria | 41504 |
| 354 | Ga0501033_0000881 | 3300049570 | Bacteria | 27428 |
| 355 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 356 | Ga0501036_0000047 | 3300049572 | Bacteria | 75675 |
| 357 | Ga0501036_0172453 | 3300049572 | Bacteria | 1822 |
| 358 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 359 | Ga0501037_0053739 | 3300049573 | Bacteria | 2946 |
| 360 | Ga0501037_0078631 | 3300049573 | Bacteria | 2393 |
| 361 | Ga0501038_0004865 | 3300049574 | Bacteria | 12475 |
| 362 | Ga0501039_0000085 | 3300049575 | Bacteria | 70306 |
| 363 | Ga0501042_0016184 | 3300049578 | Bacteria | 5116 |
| 364 | Ga0501043_0005729 | 3300049579 | Bacteria | 10008 |
| 365 | Ga0501043_0020072 | 3300049579 | Bacteria | 5244 |
| 366 | Ga0501046_0000624 | 3300049580 | Bacteria | 34712 |
| 367 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 368 | Ga0501048_0007360 | 3300049582 | Bacteria | 8340 |
| 369 | Ga0501067_0002068 | 3300049583 | Bacteria | 11051 |
| 370 | Ga0501068_0001544 | 3300049584 | Bacteria | 12237 |
| 371 | Ga0501069_0000513 | 3300049585 | Bacteria | 17707 |
| 372 | Ga0501071_0030454 | 3300049587 | Bacteria | 3817 |
| 373 | Ga0501072_0002213 | 3300049588 | Bacteria | 14529 |
| 374 | Ga0501073_0000109 | 3300049589 | Bacteria | 53094 |
| 375 | Ga0501074_0000250 | 3300049590 | Bacteria | 30239 |
| 376 | Ga0501076_0044203 | 3300049592 | Bacteria | 3513 |
| 377 | Ga0501079_0005328 | 3300049741 | Bacteria | 9573 |
| 378 | Ga0501079_0122200 | 3300049741 | Bacteria | 2025 |
| 379 | Ga0501083_0001496 | 3300049744 | Bacteria | 15948 |
| 380 | Ga0501035_0006867 | 3300049822 | Bacteria | 10631 |
| 381 | Ga0501035_0191630 | 3300049822 | Bacteria | 1757 |
| 382 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 383 | Ga0501044_0016861 | 3300049823 | Bacteria | 7837 |
| 384 | Ga0501044_0196885 | 3300049823 | Bacteria | 1974 |
| 385 | nmdc:mga03n38_100_c1 | 3300050490 | Bacteria | 19063 |
| 386 | nmdc:mga0yw44_15340_c1 | 3300050492 | Bacteria | 4100 |
| 387 | nmdc:mga0k408_67651_c1 | 3300050493 | Bacteria | 2082 |
| 388 | nmdc:mga07m45_45723_c1 | 3300050496 | Bacteria | 2458 |
| 389 | nmdc:mga05p37_82927_c1 | 3300050507 | Bacteria | 3950 |
| 390 | nmdc:mga0sz30_14357_c1 | 3300050516 | Bacteria | 3116 |
| 391 | nmdc:mga0sz30_49283_c1 | 3300050516 | Bacteria | 1784 |
| 392 | Ga0495601_0011752 | 3300053077 | Bacteria | 5249 |
| 393 | Ga0495595_0000668 | 3300053084 | Bacteria | 13098 |
| 394 | Ga0495595_0018362 | 3300053084 | Bacteria | 3022 |
| 395 | Ga0495619_0000719 | 3300053085 | Bacteria | 21645 |
| 396 | Ga0495619_0081978 | 3300053085 | Bacteria | 2173 |
| 397 | Ga0500566_0000150 | 3300053094 | Bacteria | 35703 |
| 398 | Ga0500641_0007715 | 3300053096 | Bacteria | 3835 |
| 399 | Ga0500572_000234 | 3300053111 | Bacteria | 19736 |
| 400 | Ga0500595_000258 | 3300053119 | Bacteria | 35116 |
| 401 | Ga0500595_002380 | 3300053119 | Bacteria | 9400 |
| 402 | Ga0500642_0046354 | 3300053130 | Bacteria | 1901 |
| 403 | Ga0500559_0000244 | 3300053136 | Bacteria | 42994 |
| 404 | Ga0500568_0012485 | 3300053139 | Bacteria | 3905 |
| 405 | Ga0500639_057596 | 3300053163 | Bacteria | 2009 |
| 406 | Ga0500637_0000147 | 3300053178 | Bacteria | 25930 |
| 407 | Ga0500637_0023478 | 3300053178 | Bacteria | 3373 |
| 408 | Ga0500576_055274 | 3300053725 | Bacteria | 1750 |
| 409 | Ga0500645_016945 | 3300053730 | Bacteria | 2289 |
| 410 | Ga0501084_0006091 | 3300054114 | Bacteria | 9917 |
| 411 | Ga0500661_000057 | 3300055283 | Bacteria | 17586 |
| 412 | Ga0501082_0002413 | 3300060353 | Bacteria | 16404 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025940 | Ga0207691_10145427 | Ga0207691_101454272 | 407 |
| 2 | 3300005435 | Ga0070714_100073645 | Ga0070714_1000736452 | 419 |
| 3 | 3300025929 | Ga0207664_10056988 | Ga0207664_100569882 | 419 |
| 4 | 3300039437 | Ga0436365_1721875 | Ga0436365_1721875_730_2055 | 419 |
| 5 | 3300048920 | Ga0496117_0062325 | Ga0496117_0062325_893_2257 | 419 |
| 6 | 3300048921 | Ga0496118_0010548 | Ga0496118_0010548_2122_3486 | 419 |
| 7 | 3300005548 | Ga0070665_100171531 | Ga0070665_1001715312 | 421 |
| 8 | 3300025302 | Ga0207426_1020116 | Ga0207426_10201162 | 421 |
| 9 | 3300003354 | JGI25160J50197_1001638 | JGI25160J50197_10016388 | 422 |
| 10 | 3300003354 | JGI25160J50197_1002980 | JGI25160J50197_10029803 | 422 |
| 11 | 3300004625 | Ga0055543_1004294 | Ga0055543_10042941 | 422 |
| 12 | 3300005262 | Ga0065165_1002933 | Ga0065165_10029332 | 422 |
| 13 | 3300009174 | Ga0105241_10043573 | Ga0105241_100435731 | 422 |
| 14 | 3300025297 | Ga0209758_1003514 | Ga0209758_100351411 | 422 |
| 15 | 3300025302 | Ga0207426_1000420 | Ga0207426_100042038 | 422 |
| 16 | 3300027357 | Ga0209589_1000021 | Ga0209589_100002162 | 422 |
| 17 | 3300027361 | Ga0209489_100028 | Ga0209489_10002862 | 422 |
| 18 | 3300027363 | Ga0209700_100037 | Ga0209700_10003762 | 422 |
| 19 | 3300046462 | Ga0495651_0035673 | Ga0495651_0035673_1616_3004 | 422 |
| 20 | 3300050496 | nmdc:mga07m45_45723_c1 | nmdc:mga07m45_45723_c1_154_1542 | 422 |
| 21 | 3300005435 | Ga0070714_100014255 | Ga0070714_1000142554 | 423 |
| 22 | 3300005436 | Ga0070713_100002398 | Ga0070713_1000023982 | 423 |
| 23 | 3300005437 | Ga0070710_10000880 | Ga0070710_100008808 | 423 |
| 24 | 3300005439 | Ga0070711_100007845 | Ga0070711_1000078452 | 423 |
| 25 | 3300005983 | Ga0081540_1005988 | Ga0081540_10059884 | 423 |
| 26 | 3300025898 | Ga0207692_10003479 | Ga0207692_100034793 | 423 |
| 27 | 3300025906 | Ga0207699_10013790 | Ga0207699_100137902 | 423 |
| 28 | 3300025915 | Ga0207693_10001606 | Ga0207693_100016068 | 423 |
| 29 | 3300025916 | Ga0207663_10000390 | Ga0207663_100003909 | 423 |
| 30 | 3300025939 | Ga0207665_10000444 | Ga0207665_1000044416 | 423 |
| 31 | 3300025986 | Ga0207658_10085560 | Ga0207658_100855602 | 423 |
| 32 | 3300048905 | Ga0496102_0009172 | Ga0496102_0009172_2097_3482 | 423 |
| 33 | 3300048910 | Ga0496107_0064227 | Ga0496107_0064227_668_2053 | 423 |
| 34 | 3300048912 | Ga0496109_0035144 | Ga0496109_0035144_2246_3631 | 423 |
| 35 | 3300048916 | Ga0496113_0061661 | Ga0496113_0061661_1028_2413 | 423 |
| 36 | 3300048918 | Ga0496115_0065946 | Ga0496115_0065946_240_1649 | 423 |
| 37 | 3300005937 | Ga0081455_10005195 | Ga0081455_1000519512 | 424 |
| 38 | 3300025942 | Ga0207689_10035377 | Ga0207689_100353772 | 424 |
| 39 | 3300025972 | Ga0207668_10088648 | Ga0207668_100886482 | 424 |
| 40 | 3300026089 | Ga0207648_10036345 | Ga0207648_100363453 | 424 |
| 41 | 3300031238 | Ga0265332_10011856 | Ga0265332_100118564 | 424 |
| 42 | 3300031616 | Ga0307508_10000108 | Ga0307508_100001087 | 424 |
| 43 | 3300031711 | Ga0265314_10038049 | Ga0265314_100380492 | 424 |
| 44 | 3300031712 | Ga0265342_10015551 | Ga0265342_100155512 | 424 |
| 45 | 3300033545 | Ga0316214_1003581 | Ga0316214_10035811 | 424 |
| 46 | 3300035118 | Ga0373954_0000242 | Ga0373954_0000242_15086_16501 | 424 |
| 47 | 3300035120 | Ga0373957_0000417 | Ga0373957_0000417_2526_3941 | 424 |
| 48 | 3300035172 | Ga0373955_0001044 | Ga0373955_0001044_6993_8408 | 424 |
| 49 | 3300035724 | Ga0373933_0007539 | Ga0373933_0007539_4392_5801 | 424 |
| 50 | 3300037068 | Ga0373925_0076785 | Ga0373925_0076785_824_2227 | 424 |
| 51 | 3300046462 | Ga0495651_0032462 | Ga0495651_0032462_961_2376 | 424 |
| 52 | 3300046463 | Ga0495653_0000465 | Ga0495653_0000465_891_2306 | 424 |
| 53 | 3300046474 | Ga0495605_0050823 | Ga0495605_0050823_608_1993 | 424 |
| 54 | 3300046511 | Ga0495608_0001489 | Ga0495608_0001489_8386_9801 | 424 |
| 55 | 3300046533 | Ga0495640_0002679 | Ga0495640_0002679_2823_4238 | 424 |
| 56 | 3300046536 | Ga0495587_0004444 | Ga0495587_0004444_961_2376 | 424 |
| 57 | 3300046543 | Ga0495645_0017210 | Ga0495645_0017210_360_1775 | 424 |
| 58 | 3300046559 | Ga0495667_0001146 | Ga0495667_0001146_3344_4759 | 424 |
| 59 | 3300046642 | Ga0495634_0004544 | Ga0495634_0004544_7662_9077 | 424 |
| 60 | 3300046663 | Ga0495635_0005740 | Ga0495635_0005740_1089_2504 | 424 |
| 61 | 3300046675 | Ga0495657_0001030 | Ga0495657_0001030_3381_4796 | 424 |
| 62 | 3300046678 | Ga0495599_0000873 | Ga0495599_0000873_199_1614 | 424 |
| 63 | 3300046680 | Ga0495646_0001852 | Ga0495646_0001852_1076_2491 | 424 |
| 64 | 3300046694 | Ga0495649_0013892 | Ga0495649_0013892_634_2019 | 424 |
| 65 | 3300046809 | Ga0495600_0000768 | Ga0495600_0000768_12011_13426 | 424 |
| 66 | 3300047317 | Ga0495604_0009371 | Ga0495604_0009371_4633_6048 | 424 |
| 67 | 3300047323 | Ga0495683_0043674 | Ga0495683_0043674_840_2225 | 424 |
| 68 | 3300047444 | Ga0495675_0003063 | Ga0495675_0003063_3253_4668 | 424 |
| 69 | 3300047471 | Ga0495684_0000169 | Ga0495684_0000169_24010_25425 | 424 |
| 70 | 3300049460 | Ga0495682_0008725 | Ga0495682_0008725_1241_2626 | 424 |
| 71 | 3300050493 | nmdc:mga0k408_67651_c1 | nmdc:mga0k408_67651_c1_317_1702 | 424 |
| 72 | 3300050516 | nmdc:mga0sz30_49283_c1 | nmdc:mga0sz30_49283_c1_78_1463 | 424 |
| 73 | 3300053077 | Ga0495601_0011752 | Ga0495601_0011752_2873_4288 | 424 |
| 74 | 3300053084 | Ga0495595_0000668 | Ga0495595_0000668_10222_11637 | 424 |
| 75 | 3300053085 | Ga0495619_0000719 | Ga0495619_0000719_1089_2504 | 424 |
| 76 | 3300005328 | Ga0070676_10071214 | Ga0070676_100712142 | 425 |
| 77 | 3300005347 | Ga0070668_100047884 | Ga0070668_1000478841 | 425 |
| 78 | 3300005439 | Ga0070711_100011167 | Ga0070711_1000111672 | 425 |
| 79 | 3300005441 | Ga0070700_100029325 | Ga0070700_1000293252 | 425 |
| 80 | 3300005455 | Ga0070663_100035190 | Ga0070663_1000351902 | 425 |
| 81 | 3300005455 | Ga0070663_100061577 | Ga0070663_1000615772 | 425 |
| 82 | 3300005456 | Ga0070678_100186806 | Ga0070678_1001868062 | 425 |
| 83 | 3300005457 | Ga0070662_100041752 | Ga0070662_1000417521 | 425 |
| 84 | 3300005548 | Ga0070665_100039229 | Ga0070665_1000392292 | 425 |
| 85 | 3300005549 | Ga0070704_100105694 | Ga0070704_1001056941 | 425 |
| 86 | 3300005563 | Ga0068855_100009982 | Ga0068855_1000099829 | 425 |
| 87 | 3300005564 | Ga0070664_100070956 | Ga0070664_1000709562 | 425 |
| 88 | 3300005614 | Ga0068856_100134990 | Ga0068856_1001349902 | 425 |
| 89 | 3300005615 | Ga0070702_100145263 | Ga0070702_1001452631 | 425 |
| 90 | 3300005719 | Ga0068861_100011567 | Ga0068861_1000115674 | 425 |
| 91 | 3300006358 | Ga0068871_100142224 | Ga0068871_1001422242 | 425 |
| 92 | 3300009093 | Ga0105240_10037459 | Ga0105240_100374593 | 425 |
| 93 | 3300009094 | Ga0111539_10043992 | Ga0111539_100439923 | 425 |
| 94 | 3300009148 | Ga0105243_10167515 | Ga0105243_101675151 | 425 |
| 95 | 3300010375 | Ga0105239_10100673 | Ga0105239_101006732 | 425 |
| 96 | 3300010375 | Ga0105239_10221994 | Ga0105239_102219942 | 425 |
| 97 | 3300013297 | Ga0157378_10075530 | Ga0157378_100755302 | 425 |
| 98 | 3300014326 | Ga0157380_10101275 | Ga0157380_101012751 | 425 |
| 99 | 3300014969 | Ga0157376_10002020 | Ga0157376_1000202010 | 425 |
| 100 | 3300025261 | Ga0209233_1008434 | Ga0209233_10084342 | 425 |
| 101 | 3300025272 | Ga0209455_1004485 | Ga0209455_10044853 | 425 |
| 102 | 3300025901 | Ga0207688_10045394 | Ga0207688_100453942 | 425 |
| 103 | 3300025907 | Ga0207645_10020873 | Ga0207645_100208733 | 425 |
| 104 | 3300025915 | Ga0207693_10053413 | Ga0207693_100534132 | 425 |
| 105 | 3300025916 | Ga0207663_10005653 | Ga0207663_100056533 | 425 |
| 106 | 3300025940 | Ga0207691_10033936 | Ga0207691_100339361 | 425 |
| 107 | 3300025945 | Ga0207679_10062491 | Ga0207679_100624912 | 425 |
| 108 | 3300026067 | Ga0207678_10043553 | Ga0207678_100435532 | 425 |
| 109 | 3300026067 | Ga0207678_10131745 | Ga0207678_101317452 | 425 |
| 110 | 3300026075 | Ga0207708_10120651 | Ga0207708_101206511 | 425 |
| 111 | 3300026142 | Ga0207698_10070609 | Ga0207698_100706092 | 425 |
| 112 | 3300027907 | Ga0207428_10054066 | Ga0207428_100540662 | 425 |
| 113 | 3300028379 | Ga0268266_10057719 | Ga0268266_100577192 | 425 |
| 114 | 3300044656 | Ga0466969_0006896 | Ga0466969_0006896_188_1573 | 425 |
| 115 | 3300044684 | Ga0466966_0000359 | Ga0466966_0000359_20732_22117 | 425 |
| 116 | 3300044693 | Ga0466961_0000074 | Ga0466961_0000074_37915_39300 | 425 |
| 117 | 3300045049 | Ga0466959_0008397 | Ga0466959_0008397_1866_3251 | 425 |
| 118 | 3300046499 | Ga0495594_0058680 | Ga0495594_0058680_386_1774 | 425 |
| 119 | 3300046507 | Ga0495606_0076918 | Ga0495606_0076918_539_1927 | 425 |
| 120 | 3300046511 | Ga0495608_0123468 | Ga0495608_0123468_101_1489 | 425 |
| 121 | 3300046526 | Ga0495666_0046855 | Ga0495666_0046855_594_1979 | 425 |
| 122 | 3300046642 | Ga0495634_0018287 | Ga0495634_0018287_109_1497 | 425 |
| 123 | 3300046664 | Ga0495659_0013259 | Ga0495659_0013259_1236_2627 | 425 |
| 124 | 3300046675 | Ga0495657_0040622 | Ga0495657_0040622_527_1915 | 425 |
| 125 | 3300046690 | Ga0495624_0016618 | Ga0495624_0016618_2175_3563 | 425 |
| 126 | 3300047317 | Ga0495604_0130453 | Ga0495604_0130453_342_1730 | 425 |
| 127 | 3300047321 | Ga0495676_0006058 | Ga0495676_0006058_6313_7701 | 425 |
| 128 | 3300048903 | Ga0496100_0027040 | Ga0496100_0027040_337_1725 | 425 |
| 129 | 3300048904 | Ga0496101_0016754 | Ga0496101_0016754_1493_2881 | 425 |
| 130 | 3300048904 | Ga0496101_0154224 | Ga0496101_0154224_95_1480 | 425 |
| 131 | 3300048905 | Ga0496102_0003496 | Ga0496102_0003496_9923_11311 | 425 |
| 132 | 3300048907 | Ga0496104_0070977 | Ga0496104_0070977_1668_3056 | 425 |
| 133 | 3300048912 | Ga0496109_0051350 | Ga0496109_0051350_2007_3395 | 425 |
| 134 | 3300048913 | Ga0496110_0012904 | Ga0496110_0012904_75_1463 | 425 |
| 135 | 3300048915 | Ga0496112_0142116 | Ga0496112_0142116_198_1586 | 425 |
| 136 | 3300048918 | Ga0496115_0002653 | Ga0496115_0002653_6882_8270 | 425 |
| 137 | 3300048918 | Ga0496115_0031184 | Ga0496115_0031184_137_1522 | 425 |
| 138 | 3300053119 | Ga0500595_000258 | Ga0500595_000258_20855_22306 | 425 |
| 139 | 3300053178 | Ga0500637_0000147 | Ga0500637_0000147_3030_4481 | 425 |
| 140 | 3300055283 | Ga0500661_000057 | Ga0500661_000057_8649_10100 | 425 |
| 141 | 3300006914 | Ga0075436_100060692 | Ga0075436_1000606923 | 426 |
| 142 | 3300009551 | Ga0105238_10007309 | Ga0105238_100073092 | 426 |
| 143 | 3300009551 | Ga0105238_10087810 | Ga0105238_100878102 | 426 |
| 144 | 3300010375 | Ga0105239_10047342 | Ga0105239_100473422 | 426 |
| 145 | 3300025261 | Ga0209233_1002848 | Ga0209233_10028482 | 426 |
| 146 | 3300025297 | Ga0209758_1004217 | Ga0209758_100421710 | 426 |
| 147 | 3300025924 | Ga0207694_10079452 | Ga0207694_100794522 | 426 |
| 148 | 3300033442 | Ga0315911_1000008 | Ga0315911_1000008252 | 426 |
| 149 | 3300039438 | Ga0436360_0974944 | Ga0436360_0974944_1272_2696 | 426 |
| 150 | 3300039447 | Ga0436361_0053567 | Ga0436361_0053567_240_1637 | 426 |
| 151 | 3300045976 | Ga0466967_0069108 | Ga0466967_0069108_1151_2536 | 426 |
| 152 | 3300048910 | Ga0496107_0005303 | Ga0496107_0005303_1835_3220 | 426 |
| 153 | 3300048911 | Ga0496108_0007489 | Ga0496108_0007489_3891_5276 | 426 |
| 154 | 3300048912 | Ga0496109_0003252 | Ga0496109_0003252_3277_4662 | 426 |
| 155 | 3300048913 | Ga0496110_0016515 | Ga0496110_0016515_2728_4113 | 426 |
| 156 | 3300048914 | Ga0496111_0024507 | Ga0496111_0024507_154_1539 | 426 |
| 157 | 3300048915 | Ga0496112_0003481 | Ga0496112_0003481_9129_10514 | 426 |
| 158 | 3300048916 | Ga0496113_0048497 | Ga0496113_0048497_1406_2791 | 426 |
| 159 | 3300048918 | Ga0496115_0141090 | Ga0496115_0141090_80_1465 | 426 |
| 160 | 3300037466 | Ga0395898_0010389 | Ga0395898_0010389_7948_9333 | 428 |
| 161 | 3300048929 | Ga0496126_0073482 | Ga0496126_0073482_870_2279 | 429 |
| 162 | 3300006028 | Ga0070717_10072932 | Ga0070717_100729321 | 431 |
| 163 | 3300048088 | Ga0495602_0051410 | Ga0495602_0051410_21_1382 | 431 |
| 164 | 3300049572 | Ga0501036_0172453 | Ga0501036_0172453_351_1766 | 432 |
| 165 | 3300049573 | Ga0501037_0053739 | Ga0501037_0053739_481_1890 | 432 |
| 166 | 3300049823 | Ga0501044_0196885 | Ga0501044_0196885_283_1692 | 432 |
| 167 | 3300053084 | Ga0495595_0018362 | Ga0495595_0018362_235_1623 | 432 |
| 168 | 3300005439 | Ga0070711_100110667 | Ga0070711_1001106671 | 433 |
| 169 | 3300006175 | Ga0070712_100003780 | Ga0070712_1000037802 | 433 |
| 170 | 3300025915 | Ga0207693_10003386 | Ga0207693_100033862 | 433 |
| 171 | 3300025929 | Ga0207664_10025264 | Ga0207664_100252642 | 433 |
| 172 | 3300035113 | Ga0373936_0012325 | Ga0373936_0012325_1360_2745 | 434 |
| 173 | 3300053094 | Ga0500566_0000150 | Ga0500566_0000150_19936_21321 | 434 |
| 174 | 3300053163 | Ga0500639_057596 | Ga0500639_057596_275_1660 | 434 |
| 175 | 3300053178 | Ga0500637_0023478 | Ga0500637_0023478_1237_2622 | 434 |
| 176 | iso_pu_bacteria | 8006926726 | 8006933249 | 434 |
| 177 | iso_pu_bacteria | 2885374607 | 2885377502 | 435 |
| 178 | iso_pu_bacteria | 2885409591 | 2885411617 | 435 |
| 179 | iso_pu_bacteria | 2906610324 | 2906613926 | 435 |
| 180 | iso_pu_bacteria | 2906635258 | 2906642274 | 435 |
| 181 | iso_pu_bacteria | 2906660503 | 2906667302 | 435 |
| 182 | iso_pu_bacteria | 2908739725 | 2908747501 | 435 |
| 183 | iso_pu_bacteria | 2922425934 | 2922434166 | 435 |
| 184 | iso_pu_bacteria | 2935630451 | 2935637083 | 435 |
| 185 | iso_pu_bacteria | 2941507105 | 2941513650 | 435 |
| 186 | iso_pu_bacteria | 2941515067 | 2941521613 | 435 |
| 187 | iso_pu_bacteria | 2941523033 | 2941529438 | 435 |
| 188 | iso_pu_bacteria | 3005474847 | 3005475124 | 435 |
| 189 | 3300049573 | Ga0501037_0078631 | Ga0501037_0078631_261_1649 | 436 |
| 190 | iso_pu_bacteria | 2513237094 | 2513644635 | 436 |
| 191 | iso_pu_bacteria | 2513237101 | 2513695150 | 436 |
| 192 | iso_pu_bacteria | 2513237139 | 2513873486 | 436 |
| 193 | iso_pu_bacteria | 2513237141 | 2513888815 | 436 |
| 194 | iso_pu_bacteria | 2513237161 | 2514012529 | 436 |
| 195 | iso_pu_bacteria | 2517093001 | 2517107154 | 436 |
| 196 | iso_pu_bacteria | 2528768022 | 2528854061 | 436 |
| 197 | iso_pu_bacteria | 2617270735 | 2617352441 | 436 |
| 198 | iso_pu_bacteria | 2721755755 | 2723841680 | 436 |
| 199 | iso_pu_bacteria | 2728368998 | 2728755044 | 436 |
| 200 | iso_pu_bacteria | 2744054633 | 2745081736 | 436 |
| 201 | iso_pu_bacteria | 2791355199 | 2793083617 | 436 |
| 202 | iso_pu_bacteria | 2802429603 | 2805915570 | 436 |
| 203 | iso_pu_bacteria | 2824661429 | 2824670263 | 436 |
| 204 | iso_pu_bacteria | 2824687955 | 2824691105 | 436 |
| 205 | iso_pu_bacteria | 2824696289 | 2824703942 | 436 |
| 206 | iso_pu_bacteria | 2824773399 | 2824781221 | 436 |
| 207 | iso_pu_bacteria | 2838122688 | 2838124559 | 436 |
| 208 | iso_pu_bacteria | 2841941048 | 2841945246 | 436 |
| 209 | iso_pu_bacteria | 2841949485 | 2841952027 | 436 |
| 210 | iso_pu_bacteria | 2841957949 | 2841965576 | 436 |
| 211 | iso_pu_bacteria | 2841966195 | 2841970579 | 436 |
| 212 | iso_pu_bacteria | 2841974524 | 2841981828 | 436 |
| 213 | iso_pu_bacteria | 2841983080 | 2841985106 | 436 |
| 214 | iso_pu_bacteria | 2847939898 | 2847942198 | 436 |
| 215 | iso_pu_bacteria | 2849076700 | 2849083078 | 436 |
| 216 | iso_pu_bacteria | 2874604998 | 2874608025 | 436 |
| 217 | iso_pu_bacteria | 2876761206 | 2876770948 | 436 |
| 218 | iso_pu_bacteria | 2876808645 | 2876809852 | 436 |
| 219 | iso_pu_bacteria | 2879110137 | 2879112215 | 436 |
| 220 | iso_pu_bacteria | 2881364244 | 2881365275 | 436 |
| 221 | iso_pu_bacteria | 2888388044 | 2888390635 | 436 |
| 222 | iso_pu_bacteria | 2889033259 | 2889035446 | 436 |
| 223 | iso_pu_bacteria | 2906626472 | 2906628487 | 436 |
| 224 | iso_pu_bacteria | 2922368715 | 2922369529 | 436 |
| 225 | iso_pu_bacteria | 2922386360 | 2922392604 | 436 |
| 226 | iso_pu_bacteria | 2929615660 | 2929618649 | 436 |
| 227 | iso_pu_bacteria | 2929624759 | 2929628666 | 436 |
| 228 | iso_pu_bacteria | 2932784394 | 2932790828 | 436 |
| 229 | iso_pu_bacteria | 2932794094 | 2932794267 | 436 |
| 230 | iso_pu_bacteria | 2932801729 | 2932808139 | 436 |
| 231 | iso_pu_bacteria | 2932818245 | 2932823109 | 436 |
| 232 | iso_pu_bacteria | 2932828146 | 2932833515 | 436 |
| 233 | iso_pu_bacteria | 2933577622 | 2933580639 | 436 |
| 234 | iso_pu_bacteria | 2935616580 | 2935623071 | 436 |
| 235 | iso_pu_bacteria | 2935638405 | 2935644146 | 436 |
| 236 | iso_pu_bacteria | 2935665750 | 2935672272 | 436 |
| 237 | iso_pu_bacteria | 2935675223 | 2935679203 | 436 |
| 238 | iso_pu_bacteria | 2935684952 | 2935686449 | 436 |
| 239 | iso_pu_bacteria | 2935694250 | 2935700229 | 436 |
| 240 | iso_pu_bacteria | 2935703347 | 2935710178 | 436 |
| 241 | iso_pu_bacteria | 2935713505 | 2935716137 | 436 |
| 242 | iso_pu_bacteria | 2935722832 | 2935723739 | 436 |
| 243 | iso_pu_bacteria | 2935732158 | 2935735294 | 436 |
| 244 | iso_pu_bacteria | 2935741537 | 2935743915 | 436 |
| 245 | iso_pu_bacteria | 2935750917 | 2935752415 | 436 |
| 246 | iso_pu_bacteria | 2935801545 | 2935808170 | 436 |
| 247 | iso_pu_bacteria | 2935810662 | 2935816217 | 436 |
| 248 | iso_pu_bacteria | 2935827899 | 2935833610 | 436 |
| 249 | iso_pu_bacteria | 2935837841 | 2935844563 | 436 |
| 250 | iso_pu_bacteria | 2935855204 | 2935861319 | 436 |
| 251 | iso_pu_bacteria | 2935864058 | 2935869438 | 436 |
| 252 | iso_pu_bacteria | 2935873716 | 2935879767 | 436 |
| 253 | iso_pu_bacteria | 2935883170 | 2935890044 | 436 |
| 254 | iso_pu_bacteria | 2935992306 | 2935998010 | 436 |
| 255 | iso_pu_bacteria | 2936002035 | 2936008724 | 436 |
| 256 | iso_pu_bacteria | 2936037263 | 2936041222 | 436 |
| 257 | iso_pu_bacteria | 2940556831 | 2940558328 | 436 |
| 258 | iso_pu_bacteria | 2941531003 | 2941535466 | 436 |
| 259 | iso_pu_bacteria | 2941538514 | 2941543252 | 436 |
| 260 | iso_pu_bacteria | 3005594810 | 3005595100 | 436 |
| 261 | iso_pu_bacteria | 3005710791 | 3005711043 | 436 |
| 262 | iso_pu_bacteria | 3005718088 | 3005718351 | 436 |
| 263 | iso_pu_bacteria | 8006964411 | 8006967497 | 436 |
| 264 | iso_pu_bacteria | 8006994254 | 8006996470 | 436 |
| 265 | iso_pu_bacteria | 8016511872 | 8016518136 | 436 |
| 266 | iso_pu_bacteria | 8016583857 | 8016586318 | 436 |
| 267 | iso_pu_bacteria | 8017057580 | 8017058510 | 436 |
| 268 | iso_pu_bacteria | 8019576017 | 8019577183 | 436 |
| 269 | iso_pu_bacteria | 8019597564 | 8019606492 | 436 |
| 270 | iso_pu_bacteria | 8055742211 | 8055742499 | 436 |
| 271 | iso_pu_bacteria | 8056673599 | 8056675776 | 436 |
| 272 | 3300025253 | Ga0209677_101634 | Ga0209677_1016348 | 437 |
| 273 | iso_pu_bacteria | 2935959822 | 2935962685 | 437 |
| 274 | 3300005937 | Ga0081455_10160677 | Ga0081455_101606772 | 438 |
| 275 | 3300005337 | Ga0070682_100111510 | Ga0070682_1001115102 | 439 |
| 276 | 3300005539 | Ga0068853_100105212 | Ga0068853_1001052121 | 439 |
| 277 | 3300026041 | Ga0207639_10064311 | Ga0207639_100643112 | 439 |
| 278 | 3300031711 | Ga0265314_10002048 | Ga0265314_1000204818 | 439 |
| 279 | 3300048924 | Ga0496121_0000893 | Ga0496121_0000893_41448_42830 | 439 |
| 280 | 3300053119 | Ga0500595_002380 | Ga0500595_002380_7944_9329 | 439 |
| 281 | 3300053139 | Ga0500568_0012485 | Ga0500568_0012485_2398_3783 | 439 |
| 282 | 3300053730 | Ga0500645_016945 | Ga0500645_016945_583_1968 | 439 |
| 283 | iso_pu_bacteria | 2513237096 | 2513658870 | 439 |
| 284 | iso_pu_bacteria | 2513237137 | 2513860876 | 439 |
| 285 | iso_pu_bacteria | 2513237145 | 2513921134 | 439 |
| 286 | iso_pu_bacteria | 2517572143 | 2517888898 | 439 |
| 287 | iso_pu_bacteria | 2667528175 | 2671122504 | 439 |
| 288 | iso_pu_bacteria | 2791355197 | 2793072988 | 439 |
| 289 | iso_pu_bacteria | 2903748898 | 2903752082 | 439 |
| 290 | iso_pu_bacteria | 2904699407 | 2904708624 | 439 |
| 291 | iso_pu_bacteria | 8006933436 | 8006936167 | 439 |
| 292 | iso_pu_bacteria | 8006973647 | 8006976113 | 439 |
| 293 | iso_pu_bacteria | 8019555841 | 8019562492 | 439 |
| 294 | iso_pu_bacteria | 8019565922 | 8019572566 | 439 |
| 295 | 3300001979 | JGI24740J21852_10000570 | JGI24740J21852_100005707 | 440 |
| 296 | 3300001989 | JGI24739J22299_10030723 | JGI24739J22299_100307232 | 440 |
| 297 | 3300003203 | JGI25406J46586_10000463 | JGI25406J46586_100004632 | 440 |
| 298 | 3300003354 | JGI25160J50197_1011101 | JGI25160J50197_10111012 | 440 |
| 299 | 3300005262 | Ga0065165_1022823 | Ga0065165_10228232 | 440 |
| 300 | 3300005353 | Ga0070669_100141110 | Ga0070669_1001411102 | 440 |
| 301 | 3300005366 | Ga0070659_100094014 | Ga0070659_1000940142 | 440 |
| 302 | 3300005434 | Ga0070709_10113366 | Ga0070709_101133661 | 440 |
| 303 | 3300005435 | Ga0070714_100065114 | Ga0070714_1000651142 | 440 |
| 304 | 3300005436 | Ga0070713_100226423 | Ga0070713_1002264232 | 440 |
| 305 | 3300005455 | Ga0070663_100023849 | Ga0070663_1000238492 | 440 |
| 306 | 3300005455 | Ga0070663_100071998 | Ga0070663_1000719982 | 440 |
| 307 | 3300005539 | Ga0068853_100021754 | Ga0068853_1000217541 | 440 |
| 308 | 3300005539 | Ga0068853_100028465 | Ga0068853_1000284651 | 440 |
| 309 | 3300005548 | Ga0070665_100109966 | Ga0070665_1001099662 | 440 |
| 310 | 3300005563 | Ga0068855_100101281 | Ga0068855_1001012812 | 440 |
| 311 | 3300005577 | Ga0068857_100008515 | Ga0068857_1000085152 | 440 |
| 312 | 3300005578 | Ga0068854_100003786 | Ga0068854_1000037861 | 440 |
| 313 | 3300005578 | Ga0068854_100139813 | Ga0068854_1001398132 | 440 |
| 314 | 3300005578 | Ga0068854_100161047 | Ga0068854_1001610472 | 440 |
| 315 | 3300005614 | Ga0068856_100002838 | Ga0068856_1000028384 | 440 |
| 316 | 3300005614 | Ga0068856_100026353 | Ga0068856_1000263535 | 440 |
| 317 | 3300005614 | Ga0068856_100038677 | Ga0068856_1000386773 | 440 |
| 318 | 3300005617 | Ga0068859_100087949 | Ga0068859_1000879492 | 440 |
| 319 | 3300005719 | Ga0068861_100095412 | Ga0068861_1000954122 | 440 |
| 320 | 3300005834 | Ga0068851_10000402 | Ga0068851_100004029 | 440 |
| 321 | 3300005842 | Ga0068858_100059862 | Ga0068858_1000598621 | 440 |
| 322 | 3300005842 | Ga0068858_100189859 | Ga0068858_1001898592 | 440 |
| 323 | 3300005843 | Ga0068860_100000433 | Ga0068860_10000043314 | 440 |
| 324 | 3300005843 | Ga0068860_100125812 | Ga0068860_1001258122 | 440 |
| 325 | 3300005844 | Ga0068862_100075845 | Ga0068862_1000758451 | 440 |
| 326 | 3300005844 | Ga0068862_100161814 | Ga0068862_1001618142 | 440 |
| 327 | 3300005983 | Ga0081540_1002478 | Ga0081540_10024784 | 440 |
| 328 | 3300005983 | Ga0081540_1014897 | Ga0081540_10148973 | 440 |
| 329 | 3300005985 | Ga0081539_10003530 | Ga0081539_100035302 | 440 |
| 330 | 3300006028 | Ga0070717_10005195 | Ga0070717_100051952 | 440 |
| 331 | 3300006038 | Ga0075365_10026794 | Ga0075365_100267942 | 440 |
| 332 | 3300006042 | Ga0075368_10035512 | Ga0075368_100355122 | 440 |
| 333 | 3300006048 | Ga0075363_100003251 | Ga0075363_1000032513 | 440 |
| 334 | 3300006178 | Ga0075367_10016644 | Ga0075367_100166441 | 440 |
| 335 | 3300006844 | Ga0075428_100053195 | Ga0075428_1000531952 | 440 |
| 336 | 3300006871 | Ga0075434_100332896 | Ga0075434_1003328961 | 440 |
| 337 | 3300006931 | Ga0097620_100087951 | Ga0097620_1000879512 | 440 |
| 338 | 3300007265 | Ga0099794_10011134 | Ga0099794_100111342 | 440 |
| 339 | 3300009093 | Ga0105240_10004430 | Ga0105240_1000443012 | 440 |
| 340 | 3300009093 | Ga0105240_10130297 | Ga0105240_101302972 | 440 |
| 341 | 3300009098 | Ga0105245_10192146 | Ga0105245_101921462 | 440 |
| 342 | 3300009101 | Ga0105247_10101419 | Ga0105247_101014192 | 440 |
| 343 | 3300009147 | Ga0114129_10023896 | Ga0114129_100238962 | 440 |
| 344 | 3300009545 | Ga0105237_10045715 | Ga0105237_100457152 | 440 |
| 345 | 3300009545 | Ga0105237_10202540 | Ga0105237_102025401 | 440 |
| 346 | 3300009551 | Ga0105238_10083597 | Ga0105238_100835972 | 440 |
| 347 | 3300010375 | Ga0105239_10007523 | Ga0105239_100075239 | 440 |
| 348 | 3300010375 | Ga0105239_10049388 | Ga0105239_100493883 | 440 |
| 349 | 3300010375 | Ga0105239_10080394 | Ga0105239_100803942 | 440 |
| 350 | 3300011119 | Ga0105246_10036214 | Ga0105246_100362142 | 440 |
| 351 | 3300013296 | Ga0157374_10078526 | Ga0157374_100785262 | 440 |
| 352 | 3300013297 | Ga0157378_10194580 | Ga0157378_101945801 | 440 |
| 353 | 3300013306 | Ga0163162_10102070 | Ga0163162_101020702 | 440 |
| 354 | 3300013306 | Ga0163162_10314283 | Ga0163162_103142831 | 440 |
| 355 | 3300013307 | Ga0157372_10080044 | Ga0157372_100800442 | 440 |
| 356 | 3300014968 | Ga0157379_10093325 | Ga0157379_100933252 | 440 |
| 357 | 3300025253 | Ga0209677_102008 | Ga0209677_1020081 | 440 |
| 358 | 3300025904 | Ga0207647_10004518 | Ga0207647_100045184 | 440 |
| 359 | 3300025911 | Ga0207654_10000058 | Ga0207654_1000005820 | 440 |
| 360 | 3300025913 | Ga0207695_10000453 | Ga0207695_100004536 | 440 |
| 361 | 3300025913 | Ga0207695_10030300 | Ga0207695_100303002 | 440 |
| 362 | 3300025914 | Ga0207671_10034794 | Ga0207671_100347943 | 440 |
| 363 | 3300025914 | Ga0207671_10041863 | Ga0207671_100418632 | 440 |
| 364 | 3300025919 | Ga0207657_10169132 | Ga0207657_101691321 | 440 |
| 365 | 3300025924 | Ga0207694_10000564 | Ga0207694_1000056417 | 440 |
| 366 | 3300025933 | Ga0207706_10062207 | Ga0207706_100622072 | 440 |
| 367 | 3300025935 | Ga0207709_10019916 | Ga0207709_100199162 | 440 |
| 368 | 3300025940 | Ga0207691_10139354 | Ga0207691_101393542 | 440 |
| 369 | 3300025942 | Ga0207689_10111356 | Ga0207689_101113562 | 440 |
| 370 | 3300025949 | Ga0207667_10009339 | Ga0207667_100093396 | 440 |
| 371 | 3300025949 | Ga0207667_10144053 | Ga0207667_101440532 | 440 |
| 372 | 3300025981 | Ga0207640_10035826 | Ga0207640_100358262 | 440 |
| 373 | 3300026023 | Ga0207677_10020870 | Ga0207677_100208702 | 440 |
| 374 | 3300026035 | Ga0207703_10123765 | Ga0207703_101237652 | 440 |
| 375 | 3300026041 | Ga0207639_10001424 | Ga0207639_100014249 | 440 |
| 376 | 3300026067 | Ga0207678_10015000 | Ga0207678_100150004 | 440 |
| 377 | 3300026067 | Ga0207678_10027531 | Ga0207678_100275314 | 440 |
| 378 | 3300026067 | Ga0207678_10053426 | Ga0207678_100534262 | 440 |
| 379 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004203 | 440 |
| 380 | 3300026078 | Ga0207702_10028205 | Ga0207702_100282051 | 440 |
| 381 | 3300026078 | Ga0207702_10067275 | Ga0207702_100672752 | 440 |
| 382 | 3300026095 | Ga0207676_10157760 | Ga0207676_101577601 | 440 |
| 383 | 3300026116 | Ga0207674_10005590 | Ga0207674_100055906 | 440 |
| 384 | 3300026121 | Ga0207683_10145147 | Ga0207683_101451472 | 440 |
| 385 | 3300026142 | Ga0207698_10062289 | Ga0207698_100622891 | 440 |
| 386 | 3300026142 | Ga0207698_10164287 | Ga0207698_101642871 | 440 |
| 387 | 3300026142 | Ga0207698_10186115 | Ga0207698_101861152 | 440 |
| 388 | 3300028379 | Ga0268266_10000680 | Ga0268266_1000068037 | 440 |
| 389 | 3300028379 | Ga0268266_10012906 | Ga0268266_100129062 | 440 |
| 390 | 3300028381 | Ga0268264_10000062 | Ga0268264_1000006273 | 440 |
| 391 | 3300028577 | Ga0265318_10007399 | Ga0265318_100073993 | 440 |
| 392 | 3300028653 | Ga0265323_10008033 | Ga0265323_100080331 | 440 |
| 393 | 3300028666 | Ga0265336_10011786 | Ga0265336_100117862 | 440 |
| 394 | 3300028786 | Ga0307517_10000942 | Ga0307517_100009423 | 440 |
| 395 | 3300028794 | Ga0307515_10068562 | Ga0307515_100685622 | 440 |
| 396 | 3300028800 | Ga0265338_10009376 | Ga0265338_100093765 | 440 |
| 397 | 3300029957 | Ga0265324_10015196 | Ga0265324_100151962 | 440 |
| 398 | 3300031235 | Ga0265330_10013047 | Ga0265330_100130474 | 440 |
| 399 | 3300031247 | Ga0265340_10002209 | Ga0265340_100022097 | 440 |
| 400 | 3300031730 | Ga0307516_10061413 | Ga0307516_100614133 | 440 |
| 401 | 3300033180 | Ga0307510_10003483 | Ga0307510_100034833 | 440 |
| 402 | 3300035116 | Ga0373945_0013871 | Ga0373945_0013871_131_1519 | 440 |
| 403 | 3300035118 | Ga0373954_0013828 | Ga0373954_0013828_900_2288 | 440 |
| 404 | 3300035170 | Ga0373943_0002237 | Ga0373943_0002237_3805_5193 | 440 |
| 405 | 3300035171 | Ga0373946_0018418 | Ga0373946_0018418_84_1472 | 440 |
| 406 | 3300035692 | Ga0373935_0000500 | Ga0373935_0000500_10227_11615 | 440 |
| 407 | 3300035695 | Ga0373927_0000337 | Ga0373927_0000337_14196_15584 | 440 |
| 408 | 3300035695 | Ga0373927_0047665 | Ga0373927_0047665_442_1833 | 440 |
| 409 | 3300035725 | Ga0373947_0002043 | Ga0373947_0002043_9633_11021 | 440 |
| 410 | 3300035725 | Ga0373947_0028453 | Ga0373947_0028453_1581_3020 | 440 |
| 411 | 3300036401 | Ga0373937_0067455 | Ga0373937_0067455_1013_2401 | 440 |
| 412 | 3300037068 | Ga0373925_0003157 | Ga0373925_0003157_8775_10163 | 440 |
| 413 | 3300046455 | Ga0495603_0002436 | Ga0495603_0002436_5195_6580 | 440 |
| 414 | 3300046455 | Ga0495603_0011272 | Ga0495603_0011272_1403_2842 | 440 |
| 415 | 3300046459 | Ga0495629_0000727 | Ga0495629_0000727_11877_13265 | 440 |
| 416 | 3300046460 | Ga0495638_0089919 | Ga0495638_0089919_204_1589 | 440 |
| 417 | 3300046461 | Ga0495641_0007117 | Ga0495641_0007117_1167_2555 | 440 |
| 418 | 3300046472 | Ga0495580_0002297 | Ga0495580_0002297_1765_3153 | 440 |
| 419 | 3300046473 | Ga0495582_0000494 | Ga0495582_0000494_5693_7081 | 440 |
| 420 | 3300046475 | Ga0495639_0000119 | Ga0495639_0000119_24849_26237 | 440 |
| 421 | 3300046476 | Ga0495662_0001142 | Ga0495662_0001142_8847_10235 | 440 |
| 422 | 3300046477 | Ga0495664_0030058 | Ga0495664_0030058_1706_3094 | 440 |
| 423 | 3300046499 | Ga0495594_0008592 | Ga0495594_0008592_1924_3312 | 440 |
| 424 | 3300046511 | Ga0495608_0098998 | Ga0495608_0098998_228_1616 | 440 |
| 425 | 3300046516 | Ga0495628_0136539 | Ga0495628_0136539_65_1453 | 440 |
| 426 | 3300046517 | Ga0495630_0003675 | Ga0495630_0003675_6872_8260 | 440 |
| 427 | 3300046524 | Ga0495648_0099499 | Ga0495648_0099499_188_1573 | 440 |
| 428 | 3300046525 | Ga0495663_0008257 | Ga0495663_0008257_619_2010 | 440 |
| 429 | 3300046526 | Ga0495666_0006549 | Ga0495666_0006549_281_1669 | 440 |
| 430 | 3300046529 | Ga0495652_0022017 | Ga0495652_0022017_2028_3416 | 440 |
| 431 | 3300046531 | Ga0495665_0000251 | Ga0495665_0000251_11879_13267 | 440 |
| 432 | 3300046536 | Ga0495587_0008499 | Ga0495587_0008499_165_1553 | 440 |
| 433 | 3300046557 | Ga0495622_0004931 | Ga0495622_0004931_2421_3809 | 440 |
| 434 | 3300046559 | Ga0495667_0013097 | Ga0495667_0013097_1793_3181 | 440 |
| 435 | 3300046615 | Ga0495656_0021325 | Ga0495656_0021325_1070_2461 | 440 |
| 436 | 3300046615 | Ga0495656_0044683 | Ga0495656_0044683_407_1795 | 440 |
| 437 | 3300046642 | Ga0495634_0000886 | Ga0495634_0000886_4545_5933 | 440 |
| 438 | 3300046663 | Ga0495635_0001208 | Ga0495635_0001208_4174_5562 | 440 |
| 439 | 3300046663 | Ga0495635_0010109 | Ga0495635_0010109_1993_3381 | 440 |
| 440 | 3300046674 | Ga0495588_0041941 | Ga0495588_0041941_825_2213 | 440 |
| 441 | 3300046675 | Ga0495657_0001337 | Ga0495657_0001337_8586_9974 | 440 |
| 442 | 3300046678 | Ga0495599_0017403 | Ga0495599_0017403_179_1567 | 440 |
| 443 | 3300046679 | Ga0495623_0004412 | Ga0495623_0004412_5853_7241 | 440 |
| 444 | 3300046680 | Ga0495646_0023800 | Ga0495646_0023800_1387_2775 | 440 |
| 445 | 3300046681 | Ga0495647_0000085 | Ga0495647_0000085_12771_14159 | 440 |
| 446 | 3300046683 | Ga0495658_0000135 | Ga0495658_0000135_26042_27430 | 440 |
| 447 | 3300046684 | Ga0495669_0000707 | Ga0495669_0000707_4651_6042 | 440 |
| 448 | 3300046689 | Ga0495613_0001617 | Ga0495613_0001617_8384_9772 | 440 |
| 449 | 3300046690 | Ga0495624_0000144 | Ga0495624_0000144_37735_39123 | 440 |
| 450 | 3300046809 | Ga0495600_0002466 | Ga0495600_0002466_5161_6549 | 440 |
| 451 | 3300047315 | Ga0495581_0000421 | Ga0495581_0000421_5566_6954 | 440 |
| 452 | 3300047317 | Ga0495604_0003032 | Ga0495604_0003032_8456_9844 | 440 |
| 453 | 3300047319 | Ga0495674_0001274 | Ga0495674_0001274_13539_14927 | 440 |
| 454 | 3300047319 | Ga0495674_0026496 | Ga0495674_0026496_444_1832 | 440 |
| 455 | 3300047321 | Ga0495676_0007487 | Ga0495676_0007487_8352_9740 | 440 |
| 456 | 3300047322 | Ga0495680_0000791 | Ga0495680_0000791_27911_29299 | 440 |
| 457 | 3300047444 | Ga0495675_0003289 | Ga0495675_0003289_7913_9301 | 440 |
| 458 | 3300047673 | Ga0495593_0000007 | Ga0495593_0000007_12683_14071 | 440 |
| 459 | 3300048908 | Ga0496105_0033599 | Ga0496105_0033599_777_2162 | 440 |
| 460 | 3300048909 | Ga0496106_0020145 | Ga0496106_0020145_335_1726 | 440 |
| 461 | 3300048909 | Ga0496106_0021442 | Ga0496106_0021442_1976_3361 | 440 |
| 462 | 3300048910 | Ga0496107_0036264 | Ga0496107_0036264_2058_3449 | 440 |
| 463 | 3300048911 | Ga0496108_0013286 | Ga0496108_0013286_718_2109 | 440 |
| 464 | 3300048913 | Ga0496110_0050682 | Ga0496110_0050682_2167_3552 | 440 |
| 465 | 3300048915 | Ga0496112_0000035 | Ga0496112_0000035_95483_96868 | 440 |
| 466 | 3300048916 | Ga0496113_0083612 | Ga0496113_0083612_158_1576 | 440 |
| 467 | 3300048916 | Ga0496113_0114707 | Ga0496113_0114707_696_2087 | 440 |
| 468 | 3300048917 | Ga0496114_0031719 | Ga0496114_0031719_2350_3741 | 440 |
| 469 | 3300048918 | Ga0496115_0012788 | Ga0496115_0012788_1680_3164 | 440 |
| 470 | 3300048918 | Ga0496115_0014031 | Ga0496115_0014031_4509_5897 | 440 |
| 471 | 3300048920 | Ga0496117_0010324 | Ga0496117_0010324_4891_6276 | 440 |
| 472 | 3300048921 | Ga0496118_0020937 | Ga0496118_0020937_2047_3432 | 440 |
| 473 | 3300048924 | Ga0496121_0000203 | Ga0496121_0000203_73659_75044 | 440 |
| 474 | 3300048924 | Ga0496121_0082204 | Ga0496121_0082204_961_2352 | 440 |
| 475 | 3300048927 | Ga0496124_0022134 | Ga0496124_0022134_2468_3853 | 440 |
| 476 | 3300048928 | Ga0496125_0050627 | Ga0496125_0050627_176_1561 | 440 |
| 477 | 3300048929 | Ga0496126_0017429 | Ga0496126_0017429_4722_6113 | 440 |
| 478 | 3300048929 | Ga0496126_0022033 | Ga0496126_0022033_2615_4000 | 440 |
| 479 | 3300048929 | Ga0496126_0027307 | Ga0496126_0027307_575_1960 | 440 |
| 480 | 3300048929 | Ga0496126_0060915 | Ga0496126_0060915_1118_2503 | 440 |
| 481 | 3300049569 | Ga0501032_0000303 | Ga0501032_0000303_6789_8201 | 440 |
| 482 | 3300049570 | Ga0501033_0000881 | Ga0501033_0000881_25796_27208 | 440 |
| 483 | 3300049571 | Ga0501034_0000250 | Ga0501034_0000250_92360_93772 | 440 |
| 484 | 3300049572 | Ga0501036_0000047 | Ga0501036_0000047_68749_70161 | 440 |
| 485 | 3300049573 | Ga0501037_0000092 | Ga0501037_0000092_1865_3277 | 440 |
| 486 | 3300049574 | Ga0501038_0004865 | Ga0501038_0004865_7378_8790 | 440 |
| 487 | 3300049575 | Ga0501039_0000085 | Ga0501039_0000085_3756_5168 | 440 |
| 488 | 3300049578 | Ga0501042_0016184 | Ga0501042_0016184_3594_5006 | 440 |
| 489 | 3300049579 | Ga0501043_0005729 | Ga0501043_0005729_8415_9827 | 440 |
| 490 | 3300049579 | Ga0501043_0020072 | Ga0501043_0020072_3450_4862 | 440 |
| 491 | 3300049580 | Ga0501046_0000624 | Ga0501046_0000624_25783_27195 | 440 |
| 492 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_198393_199805 | 440 |
| 493 | 3300049582 | Ga0501048_0007360 | Ga0501048_0007360_6616_8028 | 440 |
| 494 | 3300049583 | Ga0501067_0002068 | Ga0501067_0002068_7775_9187 | 440 |
| 495 | 3300049584 | Ga0501068_0001544 | Ga0501068_0001544_6060_7472 | 440 |
| 496 | 3300049585 | Ga0501069_0000513 | Ga0501069_0000513_3278_4690 | 440 |
| 497 | 3300049587 | Ga0501071_0030454 | Ga0501071_0030454_187_1599 | 440 |
| 498 | 3300049588 | Ga0501072_0002213 | Ga0501072_0002213_6447_7859 | 440 |
| 499 | 3300049589 | Ga0501073_0000109 | Ga0501073_0000109_955_2367 | 440 |
| 500 | 3300049590 | Ga0501074_0000250 | Ga0501074_0000250_6666_8078 | 440 |
| 501 | 3300049592 | Ga0501076_0044203 | Ga0501076_0044203_1045_2457 | 440 |
| 502 | 3300049741 | Ga0501079_0005328 | Ga0501079_0005328_4578_5990 | 440 |
| 503 | 3300049741 | Ga0501079_0122200 | Ga0501079_0122200_538_1950 | 440 |
| 504 | 3300049744 | Ga0501083_0001496 | Ga0501083_0001496_6851_8263 | 440 |
| 505 | 3300049822 | Ga0501035_0006867 | Ga0501035_0006867_5636_7048 | 440 |
| 506 | 3300049822 | Ga0501035_0191630 | Ga0501035_0191630_280_1692 | 440 |
| 507 | 3300049823 | Ga0501044_0000072 | Ga0501044_0000072_84990_86402 | 440 |
| 508 | 3300049823 | Ga0501044_0016861 | Ga0501044_0016861_3909_5321 | 440 |
| 509 | 3300050490 | nmdc:mga03n38_100_c1 | nmdc:mga03n38_100_c1_1896_3281 | 440 |
| 510 | 3300050492 | nmdc:mga0yw44_15340_c1 | nmdc:mga0yw44_15340_c1_1043_2428 | 440 |
| 511 | 3300050507 | nmdc:mga05p37_82927_c1 | nmdc:mga05p37_82927_c1_2205_3593 | 440 |
| 512 | 3300050516 | nmdc:mga0sz30_14357_c1 | nmdc:mga0sz30_14357_c1_104_1492 | 440 |
| 513 | 3300053085 | Ga0495619_0081978 | Ga0495619_0081978_133_1521 | 440 |
| 514 | 3300053096 | Ga0500641_0007715 | Ga0500641_0007715_1691_3145 | 440 |
| 515 | 3300053111 | Ga0500572_000234 | Ga0500572_000234_1623_3008 | 440 |
| 516 | 3300053130 | Ga0500642_0046354 | Ga0500642_0046354_52_1443 | 440 |
| 517 | 3300053136 | Ga0500559_0000244 | Ga0500559_0000244_24882_26267 | 440 |
| 518 | 3300053725 | Ga0500576_055274 | Ga0500576_055274_242_1627 | 440 |
| 519 | 3300054114 | Ga0501084_0006091 | Ga0501084_0006091_7830_9242 | 440 |
| 520 | 3300060353 | Ga0501082_0002413 | Ga0501082_0002413_6460_7872 | 440 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8t6b-assembly1.cif.gz_A | human vmat2 in complex with serotonin | 0.7027 | 19 | 435 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.6975 | 19 | 439 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.6878 | 19 | 439 |
| 8t6b-assembly1.cif.gz_A | human vmat2 in complex with serotonin | 0.6868 | 19 | 435 |
| 8d2s-assembly1.cif.gz_A | zebrafish mfsd2a isoform b in inward open ligand bound conformation | 0.6811 | 15 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06171_14_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8873 | 21 | 227 | 1.20.1250.20 |
| af_O06171_14_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8362 | 21 | 227 | 1.20.1250.20 |
| af_Q54IX9_60_277_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.787 | 18 | 237 | 1.20.1250.20 |
| af_O23203_10_235_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7784 | 21 | 231 | 1.20.1250.20 |
| af_Q08268_95_284_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7768 | 20 | 238 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K0VTF6-F1-model_v4 | Major facilitator superfamily protein | 0.9304 | 38 | 319 |
GO:0012505
GO:0016020 |
| AF-A0A431P721-F1-model_v4 | deleted | 0.9283 | 1 | 274 |
|
| AF-K0VTF6-F1-model_v4 | Major facilitator superfamily protein | 0.9242 | 38 | 319 |
GO:0012505
GO:0016020 |
| AF-A0A3D5U8F1-F1-model_v4 | MFS transporter | 0.9223 | 18 | 312 |
GO:0012505
GO:0016020 |
| AF-A0A7X4EVL7-F1-model_v4 | MFS transporter | 0.922 | 3 | 296 |
GO:0012505
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar