F458548

General Info

Members Datasets Scaffolds Average Seq Length
520 243 1040 195

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10771518|Ga0207658_107715182
Length 215
Sequence VAARVHGLCRYSTPWTAGHSDPLLLVGSAPAPVGASGAGTTPSHAAPPSRSLPGGGETRRHVLVAVVLNKPGVLNRVSSLMRARNFNIDSLAVSHTDSDEISRMTITLHGDDVAVEQAAKQLYRLIDVLKVQELALVKIRASDSTRAEVLKLVELSRGRVVDLADGSVIVEVTGTESEVDAFVALVRTYGIKELVRTGAVVMARGSGSIEEAIKR

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
168 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 9.81
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10771518 3300025986 Bacteria 872
2 JGI25406J46586_10019513 3300003203 Bacteria 2761
3 rootH2_10091441 3300003320 Bacteria 1201
4 Ga0070676_10310814 3300005328 Bacteria 1071
5 Ga0070683_100009778 3300005329 Bacteria 8217
6 Ga0070690_100083193 3300005330 Bacteria 2096
7 Ga0070690_100142887 3300005330 Bacteria 1626
8 Ga0070670_100060876 3300005331 Bacteria 3241
9 Ga0070680_100000082 3300005336 Bacteria 52375
10 Ga0070680_100335323 3300005336 Bacteria 1285
11 Ga0070680_100584110 3300005336 Bacteria 959
12 Ga0070682_100041451 3300005337 Bacteria 2838
13 Ga0068868_100154379 3300005338 Bacteria 1892
14 Ga0068868_100423886 3300005338 Bacteria 1152
15 Ga0070689_100036636 3300005340 Bacteria 3752
16 Ga0070687_100001421 3300005343 Bacteria 8412
17 Ga0070687_100154610 3300005343 Bacteria 1350
18 Ga0070661_100128456 3300005344 Bacteria 1902
19 Ga0070692_10108223 3300005345 Bacteria 1534
20 Ga0070668_100099763 3300005347 Bacteria 2300
21 Ga0070669_100193444 3300005353 Bacteria 1597
22 Ga0070669_100337273 3300005353 Bacteria 1221
23 Ga0070675_101036469 3300005354 Bacteria 754
24 Ga0070674_100004710 3300005356 Bacteria 7805
25 Ga0070673_100361460 3300005364 Bacteria 1290
26 Ga0070688_100021328 3300005365 Bacteria 3783
27 Ga0070688_100116778 3300005365 Bacteria 1782
28 Ga0070659_100005140 3300005366 Bacteria 9384
29 Ga0070701_10002065 3300005438 Bacteria 7630
30 Ga0070701_10701670 3300005438 Bacteria 681
31 Ga0070705_100024632 3300005440 Bacteria 3251
32 Ga0070705_100242337 3300005440 Bacteria 1261
33 Ga0070700_100010904 3300005441 Bacteria 5027
34 Ga0070700_100064864 3300005441 Bacteria 2314
35 Ga0070694_100032048 3300005444 Bacteria 3449
36 Ga0070694_100096656 3300005444 Bacteria 2082
37 Ga0070694_100627903 3300005444 Unclassified 868
38 Ga0070708_100001680 3300005445 Bacteria 16992
39 Ga0070708_100003100 3300005445 Bacteria 12934
40 Ga0070708_100010936 3300005445 Bacteria 7373
41 Ga0070708_100235420 3300005445 Bacteria 1719
42 Ga0070708_100512591 3300005445 Bacteria 1131
43 Ga0070708_100669403 3300005445 Bacteria 977
44 Ga0070708_100688614 3300005445 Bacteria 962
45 Ga0070663_100010643 3300005455 Bacteria 5739
46 Ga0070663_100879047 3300005455 Bacteria 773
47 Ga0070678_100073416 3300005456 Bacteria 2568
48 Ga0070678_100223014 3300005456 Bacteria 1568
49 Ga0070678_100292380 3300005456 Bacteria 1382
50 Ga0070678_101008142 3300005456 Bacteria 766
51 Ga0070662_100089422 3300005457 Bacteria 2310
52 Ga0070681_10528132 3300005458 Bacteria 1093
53 Ga0070681_10664994 3300005458 Bacteria 957
54 Ga0070706_100000401 3300005467 Bacteria 52276
55 Ga0070706_100038259 3300005467 Bacteria 4428
56 Ga0070706_100043090 3300005467 Bacteria 4169
57 Ga0070706_100051925 3300005467 Bacteria 3785
58 Ga0070706_100206837 3300005467 Bacteria 1833
59 Ga0070707_100000698 3300005468 Bacteria 33367
60 Ga0070707_100005010 3300005468 Bacteria 12408
61 Ga0070707_100235161 3300005468 Bacteria 1783
62 Ga0070707_100242919 3300005468 Bacteria 1752
63 Ga0070707_100254566 3300005468 Bacteria 1709
64 Ga0070707_100345374 3300005468 Bacteria 1445
65 Ga0070707_100668249 3300005468 Bacteria 1002
66 Ga0070707_100829264 3300005468 Unclassified 889
67 Ga0070698_100478298 3300005471 Bacteria 1182
68 Ga0070698_100915258 3300005471 Bacteria 823
69 Ga0070699_100063171 3300005518 Bacteria 3210
70 Ga0070699_100122204 3300005518 Bacteria 2290
71 Ga0070679_100679133 3300005530 Bacteria 972
72 Ga0070684_100064749 3300005535 Bacteria 3207
73 Ga0070684_101067547 3300005535 Bacteria 758
74 Ga0070697_100015181 3300005536 Bacteria 6048
75 Ga0070697_100508869 3300005536 Bacteria 1053
76 Ga0070686_100001586 3300005544 Bacteria 12772
77 Ga0070686_100200346 3300005544 Bacteria 1431
78 Ga0070686_100466485 3300005544 Bacteria 974
79 Ga0070695_100003708 3300005545 Bacteria 8901
80 Ga0070695_100008360 3300005545 Bacteria 6140
81 Ga0070695_100017368 3300005545 Bacteria 4362
82 Ga0070695_100335246 3300005545 Bacteria 1129
83 Ga0070696_100002686 3300005546 Bacteria 11790
84 Ga0070696_100053307 3300005546 Bacteria 2815
85 Ga0070696_100057861 3300005546 Bacteria 2706
86 Ga0070693_100079475 3300005547 Bacteria 1952
87 Ga0070693_100418678 3300005547 Bacteria 933
88 Ga0070704_100052128 3300005549 Bacteria 2885
89 Ga0070704_100328498 3300005549 Bacteria 1284
90 Ga0070704_100394906 3300005549 Bacteria 1179
91 Ga0070704_100506224 3300005549 Unclassified 1049
92 Ga0070704_100587146 3300005549 Bacteria 978
93 Ga0068855_100133286 3300005563 Bacteria 2836
94 Ga0068855_100282463 3300005563 Bacteria 1843
95 Ga0068855_100596423 3300005563 Bacteria 1192
96 Ga0070664_100089694 3300005564 Bacteria 2660
97 Ga0070664_100910436 3300005564 Bacteria 825
98 Ga0068854_100076327 3300005578 Bacteria 2462
99 Ga0068854_100188990 3300005578 Bacteria 1613
100 Ga0068854_100427353 3300005578 Bacteria 1102
101 Ga0070702_100007386 3300005615 Bacteria 5261
102 Ga0068852_100080321 3300005616 Bacteria 2891
103 Ga0068852_100564269 3300005616 Bacteria 1140
104 Ga0068859_100221073 3300005617 Bacteria 1982
105 Ga0068859_101498353 3300005617 Bacteria 744
106 Ga0068864_100014991 3300005618 Bacteria 6443
107 Ga0068864_100021366 3300005618 Bacteria 5422
108 Ga0068861_100028924 3300005719 Bacteria 4047
109 Ga0068861_100391496 3300005719 Bacteria 1231
110 Ga0068863_100101317 3300005841 Bacteria 2738
111 Ga0068863_100584342 3300005841 Bacteria 1105
112 Ga0068858_100017193 3300005842 Bacteria 6787
113 Ga0068860_100313112 3300005843 Bacteria 1539
114 Ga0081455_10133196 3300005937 Bacteria 1940
115 Ga0081455_10134952 3300005937 Bacteria 1924
116 Ga0081538_10111149 3300005981 Bacteria 1345
117 Ga0081539_10004686 3300005985 Bacteria 14841
118 Ga0081539_10114402 3300005985 Bacteria 1352
119 Ga0075365_10115711 3300006038 Bacteria 1846
120 Ga0097621_100256896 3300006237 Bacteria 1532
121 Ga0068871_100144902 3300006358 Bacteria 2021
122 Ga0075428_100000172 3300006844 Bacteria 60193
123 Ga0075428_100157449 3300006844 Bacteria 2467
124 Ga0075428_100462885 3300006844 Bacteria 1358
125 Ga0075431_100155602 3300006847 Bacteria 2352
126 Ga0075431_100370654 3300006847 Bacteria 1437
127 Ga0075433_10073074 3300006852 Bacteria 3016
128 Ga0075433_10477218 3300006852 Bacteria 1099
129 Ga0075434_100435178 3300006871 Bacteria 1333
130 Ga0075436_100441291 3300006914 Bacteria 947
131 Ga0097620_100221057 3300006931 Bacteria 1982
132 Ga0097620_101498343 3300006931 Bacteria 744
133 Ga0075435_100124011 3300007076 Bacteria 2157
134 Ga0075435_100367913 3300007076 Bacteria 1234
135 Ga0111539_10063564 3300009094 Bacteria 4367
136 Ga0111539_10119194 3300009094 Bacteria 3093
137 Ga0111539_10467512 3300009094 Bacteria 1469
138 Ga0105245_10282337 3300009098 Bacteria 1623
139 Ga0105245_10463053 3300009098 Bacteria 1278
140 Ga0105247_10107798 3300009101 Bacteria 1789
141 Ga0114129_10247639 3300009147 Bacteria 2393
142 Ga0114129_10260409 3300009147 Bacteria 2325
143 Ga0114129_10330450 3300009147 Bacteria 2024
144 Ga0114129_10550361 3300009147 Bacteria 1501
145 Ga0105243_10032373 3300009148 Bacteria 4040
146 Ga0105243_10446389 3300009148 Bacteria 1212
147 Ga0105243_10483211 3300009148 Unclassified 1169
148 Ga0105243_10803511 3300009148 Unclassified 927
149 Ga0105242_10202930 3300009176 Bacteria 1762
150 Ga0105242_10296236 3300009176 Bacteria 1475
151 Ga0105242_10411738 3300009176 Bacteria 1264
152 Ga0105242_10419046 3300009176 Bacteria 1254
153 Ga0105242_10583603 3300009176 Bacteria 1077
154 Ga0105248_10342423 3300009177 Bacteria 1683
155 Ga0105248_10425330 3300009177 Bacteria 1496
156 Ga0105248_10594221 3300009177 Bacteria 1249
157 Ga0105238_10407861 3300009551 Bacteria 1353
158 Ga0105249_10083350 3300009553 Bacteria 2976
159 Ga0105249_10885935 3300009553 Bacteria 959
160 Ga0105249_10999407 3300009553 Bacteria 905
161 Ga0105249_11791039 3300009553 Bacteria 687
162 Ga0099796_10147050 3300010159 Bacteria 925
163 Ga0105239_10019677 3300010375 Bacteria 7451
164 Ga0105239_10049266 3300010375 Bacteria 4619
165 Ga0105239_10055394 3300010375 Bacteria 4349
166 Ga0105239_10855479 3300010375 Bacteria 1043
167 Ga0105246_10438475 3300011119 Bacteria 1095
168 Ga0157374_10212492 3300013296 Bacteria 1897
169 Ga0157378_10103976 3300013297 Bacteria 2596
170 Ga0157378_10282257 3300013297 Bacteria 1601
171 Ga0157378_10353450 3300013297 Unclassified 1436
172 Ga0157378_10414413 3300013297 Bacteria 1330
173 Ga0163162_11124771 3300013306 Bacteria 890
174 Ga0157375_10011630 3300013308 Bacteria 7776
175 Ga0157375_10318283 3300013308 Bacteria 1720
176 Ga0157375_10379414 3300013308 Bacteria 1580
177 Ga0163163_10031002 3300014325 Bacteria 5156
178 Ga0163163_10063075 3300014325 Bacteria 3673
179 Ga0163163_10127126 3300014325 Bacteria 2587
180 Ga0163163_10306940 3300014325 Bacteria 1639
181 Ga0157380_10005741 3300014326 Bacteria 8682
182 Ga0157380_10096472 3300014326 Bacteria 2451
183 Ga0157380_10494365 3300014326 Bacteria 1187
184 Ga0157380_11186883 3300014326 Bacteria 806
185 Ga0157377_10054638 3300014745 Bacteria 2262
186 Ga0157377_10434169 3300014745 Bacteria 903
187 Ga0157379_10064742 3300014968 Bacteria 3267
188 Ga0157379_10126460 3300014968 Bacteria 2300
189 Ga0157379_10254842 3300014968 Bacteria 1594
190 Ga0157379_10459966 3300014968 Bacteria 1176
191 Ga0157376_10114734 3300014969 Bacteria 2377
192 Ga0157376_10281890 3300014969 Bacteria 1565
193 Ga0163161_10239054 3300017792 Bacteria 1412
194 Ga0163161_10326667 3300017792 Bacteria 1214
195 Ga0207688_10003570 3300025901 Bacteria 8490
196 Ga0207680_10211803 3300025903 Bacteria 1325
197 Ga0207680_10419458 3300025903 Bacteria 948
198 Ga0207647_10315844 3300025904 Bacteria 888
199 Ga0207645_10064877 3300025907 Bacteria 2333
200 Ga0207684_10000381 3300025910 Bacteria 59899
201 Ga0207684_10001682 3300025910 Bacteria 23510
202 Ga0207684_10016310 3300025910 Bacteria 6379
203 Ga0207684_10019148 3300025910 Bacteria 5855
204 Ga0207684_10076964 3300025910 Bacteria 2836
205 Ga0207684_10349236 3300025910 Bacteria 1273
206 Ga0207654_10580779 3300025911 Bacteria 798
207 Ga0207707_10429604 3300025912 Bacteria 1132
208 Ga0207671_10411038 3300025914 Bacteria 1076
209 Ga0207693_10369896 3300025915 Bacteria 1121
210 Ga0207660_10000004 3300025917 Bacteria 371608
211 Ga0207660_10246027 3300025917 Bacteria 1410
212 Ga0207660_10388473 3300025917 Bacteria 1122
213 Ga0207662_10021411 3300025918 Bacteria 3695
214 Ga0207662_10039436 3300025918 Bacteria 2771
215 Ga0207662_10258080 3300025918 Bacteria 1146
216 Ga0207657_10285882 3300025919 Bacteria 1308
217 Ga0207649_10280492 3300025920 Bacteria 1211
218 Ga0207652_10241778 3300025921 Bacteria 1627
219 Ga0207652_10665653 3300025921 Bacteria 930
220 Ga0207646_10001103 3300025922 Bacteria 34407
221 Ga0207646_10002110 3300025922 Bacteria 23824
222 Ga0207646_10006521 3300025922 Bacteria 12047
223 Ga0207646_10020069 3300025922 Bacteria 6197
224 Ga0207646_10068959 3300025922 Bacteria 3158
225 Ga0207646_10237783 3300025922 Bacteria 1646
226 Ga0207681_10855630 3300025923 Unclassified 761
227 Ga0207687_10008896 3300025927 Bacteria 6564
228 Ga0207687_10302924 3300025927 Bacteria 1288
229 Ga0207687_10771948 3300025927 Bacteria 819
230 Ga0207644_10572757 3300025931 Bacteria 936
231 Ga0207706_10116723 3300025933 Bacteria 2348
232 Ga0207709_10348246 3300025935 Bacteria 1117
233 Ga0207670_10206815 3300025936 Bacteria 1494
234 Ga0207669_10113480 3300025937 Bacteria 1822
235 Ga0207704_10307829 3300025938 Bacteria 1217
236 Ga0207711_10427293 3300025941 Bacteria 1232
237 Ga0207689_10105977 3300025942 Bacteria 2309
238 Ga0207689_10447208 3300025942 Bacteria 1080
239 Ga0207689_10602322 3300025942 Unclassified 924
240 Ga0207661_10102997 3300025944 Bacteria 2401
241 Ga0207661_10155791 3300025944 Bacteria 1979
242 Ga0207661_10717008 3300025944 Bacteria 920
243 Ga0207679_10388155 3300025945 Bacteria 1225
244 Ga0207667_10386095 3300025949 Bacteria 1426
245 Ga0207651_10303160 3300025960 Bacteria 1329
246 Ga0207712_10072390 3300025961 Bacteria 2482
247 Ga0207712_10334644 3300025961 Bacteria 1253
248 Ga0207668_10125067 3300025972 Bacteria 1954
249 Ga0207668_10668976 3300025972 Bacteria 910
250 Ga0207640_10214872 3300025981 Bacteria 1468
251 Ga0207640_10653468 3300025981 Bacteria 896
252 Ga0207640_10750675 3300025981 Unclassified 841
253 Ga0207658_10707387 3300025986 Bacteria 911
254 Ga0207677_10136673 3300026023 Bacteria 1870
255 Ga0207677_10186889 3300026023 Bacteria 1635
256 Ga0207703_10470294 3300026035 Bacteria 1177
257 Ga0207678_10423293 3300026067 Bacteria 1155
258 Ga0207678_10682949 3300026067 Bacteria 903
259 Ga0207708_10023487 3300026075 Bacteria 4662
260 Ga0207708_10041762 3300026075 Bacteria 3496
261 Ga0207708_10063624 3300026075 Bacteria 2819
262 Ga0207708_10185783 3300026075 Bacteria 1652
263 Ga0207708_10223984 3300026075 Bacteria 1508
264 Ga0207641_10489840 3300026088 Bacteria 1193
265 Ga0207648_10027016 3300026089 Bacteria 5097
266 Ga0207648_10446351 3300026089 Bacteria 1177
267 Ga0207676_10032104 3300026095 Bacteria 3954
268 Ga0207676_10464807 3300026095 Bacteria 1195
269 Ga0207674_10001587 3300026116 Bacteria 29258
270 Ga0207674_10296481 3300026116 Bacteria 1566
271 Ga0207675_100031936 3300026118 Bacteria 4906
272 Ga0207675_101091440 3300026118 Bacteria 818
273 Ga0207683_10027680 3300026121 Bacteria 4897
274 Ga0207683_10038780 3300026121 Bacteria 4155
275 Ga0207683_10690773 3300026121 Bacteria 946
276 Ga0207698_10155692 3300026142 Bacteria 1990
277 Ga0207428_10066227 3300027907 Bacteria 2847
278 Ga0207428_10203650 3300027907 Bacteria 1489
279 Ga0268266_11279746 3300028379 Bacteria 709
280 Ga0268265_10159076 3300028380 Bacteria 1916
281 Ga0268264_10311976 3300028381 Bacteria 1484
282 Ga0265319_1006972 3300028563 Bacteria 5148
283 Ga0265319_1013860 3300028563 Bacteria 3186
284 Ga0265334_10018827 3300028573 Bacteria 2846
285 Ga0265334_10126804 3300028573 Bacteria 910
286 Ga0265318_10009499 3300028577 Bacteria 4275
287 Ga0265318_10010354 3300028577 Bacteria 4063
288 Ga0265318_10011680 3300028577 Bacteria 3768
289 Ga0265322_10028875 3300028654 Bacteria 1584
290 Ga0265336_10003977 3300028666 Bacteria 5661
291 Ga0265338_10050601 3300028800 Bacteria 3753
292 Ga0265324_10005693 3300029957 Bacteria 5318
293 Ga0265332_10057637 3300031238 Bacteria 1663
294 Ga0265320_10007126 3300031240 Bacteria 6970
295 Ga0265320_10057731 3300031240 Bacteria 1861
296 Ga0265325_10145016 3300031241 Bacteria 1127
297 Ga0265340_10004837 3300031247 Bacteria 7489
298 Ga0265339_10261330 3300031249 Bacteria 835
299 Ga0265316_10061473 3300031344 Bacteria 2917
300 Ga0265316_10349726 3300031344 Bacteria 1070
301 Ga0265316_10454885 3300031344 Bacteria 918
302 Ga0265316_10541433 3300031344 Bacteria 829
303 Ga0307408_100081143 3300031548 Bacteria 2424
304 Ga0265313_10017041 3300031595 Bacteria 4149
305 Ga0265314_10001539 3300031711 Bacteria 25417
306 Ga0265314_10216218 3300031711 Bacteria 1122
307 Ga0307405_10023180 3300031731 Bacteria 3524
308 Ga0307413_10237013 3300031824 Bacteria 1344
309 Ga0307410_10048948 3300031852 Bacteria 2835
310 Ga0307410_10791767 3300031852 Bacteria 806
311 Ga0307412_10040146 3300031911 Bacteria 3027
312 Ga0307412_10415778 3300031911 Bacteria 1099
313 Ga0307409_100215416 3300031995 Bacteria 1729
314 Ga0307416_100046184 3300032002 Bacteria 3435
315 Ga0307416_100322414 3300032002 Bacteria 1548
316 Ga0307411_10058081 3300032005 Bacteria 2559
317 Ga0307411_10691864 3300032005 Bacteria 887
318 Ga0307415_100005808 3300032126 Bacteria 6594
319 Ga0307415_100010574 3300032126 Bacteria 5232
320 Ga0307415_100565340 3300032126 Bacteria 1006
321 Ga0373929_0060747 3300035085 Unclassified 884
322 Ga0373941_0099092 3300035115 Bacteria 1012
323 Ga0373941_0100195 3300035115 Bacteria 1007
324 Ga0373962_0052496 3300035242 Bacteria 1178
325 Ga0373931_0367668 3300035691 Bacteria 904
326 Ga0373947_0231234 3300035725 Bacteria 1218
327 Ga0439465_0090390 3300041413 Bacteria 1047
328 Ga0439452_027833 3300042010 Bacteria 1416
329 Ga0450920_024678 3300042122 Bacteria 1169
330 Ga0450910_023731 3300042147 Bacteria 938
331 Ga0439434_0069298 3300042435 Bacteria 1109
332 Ga0439460_0091217 3300042461 Bacteria 969
333 Ga0495641_0110153 3300046461 Bacteria 1229
334 Ga0495641_0288048 3300046461 Bacteria 740
335 Ga0495653_0265910 3300046463 Bacteria 1132
336 Ga0495582_0211043 3300046473 Bacteria 1110
337 Ga0495664_0066390 3300046477 Bacteria 2152
338 Ga0495586_0241043 3300046535 Bacteria 1031
339 Ga0495656_0017374 3300046615 Bacteria 2745
340 Ga0495659_0183860 3300046664 Bacteria 852
341 Ga0495604_0340455 3300047317 Bacteria 999
342 Ga0495674_0139466 3300047319 Bacteria 2039
343 Ga0495680_0466872 3300047322 Bacteria 861
344 Ga0495614_0161165 3300048089 Bacteria 1004
345 Ga0496100_0011616 3300048903 Bacteria 5018
346 Ga0496100_0266385 3300048903 Bacteria 1272
347 Ga0496100_0311953 3300048903 Bacteria 1180
348 Ga0496100_0801904 3300048903 Bacteria 738
349 Ga0496101_0006297 3300048904 Bacteria 7642
350 Ga0496101_0060369 3300048904 Bacteria 2751
351 Ga0496101_0619835 3300048904 Unclassified 855
352 Ga0496102_0008164 3300048905 Bacteria 8960
353 Ga0496102_0064241 3300048905 Bacteria 3362
354 Ga0496102_0526057 3300048905 Bacteria 1105
355 Ga0496103_0189134 3300048906 Bacteria 1323
356 Ga0496104_0090037 3300048907 Bacteria 2931
357 Ga0496104_0120181 3300048907 Bacteria 2522
358 Ga0496104_0382184 3300048907 Bacteria 1321
359 Ga0496104_0589573 3300048907 Bacteria 1022
360 Ga0496104_1103939 3300048907 Bacteria 697
361 Ga0496105_0007099 3300048908 Bacteria 8639
362 Ga0496105_0188855 3300048908 Bacteria 1685
363 Ga0496106_0115613 3300048909 Bacteria 2092
364 Ga0496106_0127772 3300048909 Bacteria 1991
365 Ga0496106_0419141 3300048909 Bacteria 1076
366 Ga0496106_0510201 3300048909 Bacteria 966
367 Ga0496106_0591881 3300048909 Bacteria 889
368 Ga0496107_0235001 3300048910 Bacteria 1364
369 Ga0496107_0252817 3300048910 Bacteria 1311
370 Ga0496107_0307835 3300048910 Bacteria 1179
371 Ga0496107_0319151 3300048910 Bacteria 1156
372 Ga0496107_0351491 3300048910 Bacteria 1097
373 Ga0496108_0023480 3300048911 Bacteria 5075
374 Ga0496108_0124053 3300048911 Bacteria 2216
375 Ga0496109_0033309 3300048912 Bacteria 4634
376 Ga0496109_0046721 3300048912 Bacteria 3933
377 Ga0496109_0093973 3300048912 Bacteria 2775
378 Ga0496109_0147150 3300048912 Bacteria 2204
379 Ga0496110_0020859 3300048913 Bacteria 5536
380 Ga0496110_0101960 3300048913 Bacteria 2573
381 Ga0496110_0148449 3300048913 Bacteria 2122
382 Ga0496110_0358511 3300048913 Bacteria 1329
383 Ga0496111_0016656 3300048914 Bacteria 5069
384 Ga0496111_0041184 3300048914 Bacteria 3314
385 Ga0496111_0105205 3300048914 Bacteria 2076
386 Ga0496112_0120729 3300048915 Bacteria 2591
387 Ga0496112_0161244 3300048915 Bacteria 2209
388 Ga0496112_0468668 3300048915 Bacteria 1197
389 Ga0496113_0057275 3300048916 Bacteria 2928
390 Ga0496113_0105176 3300048916 Bacteria 2191
391 Ga0496113_0840802 3300048916 Bacteria 728
392 Ga0496114_0007576 3300048917 Bacteria 8584
393 Ga0496114_0114498 3300048917 Bacteria 2313
394 Ga0496114_0126736 3300048917 Bacteria 2201
395 Ga0496114_0207449 3300048917 Bacteria 1718
396 Ga0501031_0081303 3300049568 Bacteria 2112
397 Ga0501031_0259346 3300049568 Bacteria 1130
398 Ga0501032_0065124 3300049569 Bacteria 2438
399 Ga0501032_0241725 3300049569 Bacteria 1173
400 Ga0501033_0100781 3300049570 Bacteria 2107
401 Ga0501036_0705168 3300049572 Bacteria 834
402 Ga0501037_0061429 3300049573 Bacteria 2740
403 Ga0501037_0066956 3300049573 Bacteria 2616
404 Ga0501038_0030618 3300049574 Bacteria 4759
405 Ga0501038_0220341 3300049574 Bacteria 1514
406 Ga0501039_0025857 3300049575 Bacteria 4513
407 Ga0501039_0085078 3300049575 Bacteria 2463
408 Ga0501040_0038183 3300049576 Bacteria 3264
409 Ga0501040_0092654 3300049576 Bacteria 2101
410 Ga0501040_0099953 3300049576 Bacteria 2022
411 Ga0501040_0128552 3300049576 Bacteria 1780
412 Ga0501040_0324532 3300049576 Bacteria 1101
413 Ga0501041_0104230 3300049577 Bacteria 1757
414 Ga0501042_0051323 3300049578 Bacteria 2941
415 Ga0501042_0073550 3300049578 Bacteria 2445
416 Ga0501042_0502104 3300049578 Bacteria 881
417 Ga0501043_0210038 3300049579 Bacteria 1509
418 Ga0501046_0073859 3300049580 Bacteria 2646
419 Ga0501046_0328533 3300049580 Bacteria 1113
420 Ga0501048_0016696 3300049582 Bacteria 5412
421 Ga0501048_0060105 3300049582 Bacteria 2693
422 Ga0501048_0063242 3300049582 Bacteria 2618
423 Ga0501048_0083850 3300049582 Bacteria 2247
424 Ga0501067_0006437 3300049583 Bacteria 6506
425 Ga0501067_0011973 3300049583 Bacteria 4805
426 Ga0501067_0105565 3300049583 Bacteria 1565
427 Ga0501068_0059157 3300049584 Bacteria 2326
428 Ga0501068_0075904 3300049584 Bacteria 2056
429 Ga0501068_0096882 3300049584 Bacteria 1825
430 Ga0501068_0337383 3300049584 Bacteria 968
431 Ga0501070_0183493 3300049586 Bacteria 1721
432 Ga0501070_0281550 3300049586 Bacteria 1357
433 Ga0501070_0300922 3300049586 Bacteria 1307
434 Ga0501071_0020534 3300049587 Bacteria 4591
435 Ga0501071_0102345 3300049587 Bacteria 2112
436 Ga0501071_0308778 3300049587 Bacteria 1200
437 Ga0501071_0397572 3300049587 Bacteria 1052
438 Ga0501071_0615229 3300049587 Bacteria 835
439 Ga0501072_0066288 3300049588 Bacteria 2848
440 Ga0501072_0092310 3300049588 Bacteria 2404
441 Ga0501072_0154241 3300049588 Bacteria 1831
442 Ga0501072_0190329 3300049588 Bacteria 1636
443 Ga0501072_0459156 3300049588 Bacteria 1008
444 Ga0501072_0492727 3300049588 Bacteria 969
445 Ga0501074_0040897 3300049590 Bacteria 3356
446 Ga0501074_0045122 3300049590 Bacteria 3189
447 Ga0501074_0213535 3300049590 Bacteria 1374
448 Ga0501075_0023376 3300049591 Bacteria 4525
449 Ga0501075_0023670 3300049591 Bacteria 4498
450 Ga0501075_0029318 3300049591 Bacteria 4069
451 Ga0501075_0060573 3300049591 Bacteria 2852
452 Ga0501075_0316474 3300049591 Bacteria 1189
453 Ga0501075_0353531 3300049591 Bacteria 1120
454 Ga0501075_0427080 3300049591 Bacteria 1010
455 Ga0501076_0013618 3300049592 Bacteria 6101
456 Ga0501076_0101457 3300049592 Bacteria 2319
457 Ga0501076_0259164 3300049592 Bacteria 1423
458 Ga0501076_0333422 3300049592 Bacteria 1245
459 Ga0501076_0665574 3300049592 Bacteria 859
460 Ga0501077_0027113 3300049593 Bacteria 3637
461 Ga0501077_0469475 3300049593 Bacteria 806
462 Ga0501077_0614162 3300049593 Unclassified 698
463 Ga0501079_0054403 3300049741 Bacteria 3087
464 Ga0501079_0134564 3300049741 Bacteria 1924
465 Ga0501079_0381447 3300049741 Bacteria 1105
466 Ga0501080_0028134 3300049742 Bacteria 5227
467 Ga0501080_0097138 3300049742 Bacteria 2735
468 Ga0501080_0155639 3300049742 Bacteria 2111
469 Ga0501081_0063133 3300049743 Bacteria 2570
470 Ga0501081_0073822 3300049743 Bacteria 2379
471 Ga0501081_0793886 3300049743 Bacteria 712
472 Ga0501083_0505713 3300049744 Bacteria 786
473 Ga0501035_0043910 3300049822 Bacteria 4027
474 Ga0501044_0294123 3300049823 Bacteria 1555
475 Ga0501045_0006736 3300049824 Bacteria 7958
476 Ga0501045_0013193 3300049824 Bacteria 5828
477 Ga0501045_0075357 3300049824 Bacteria 2485
478 Ga0501045_0141106 3300049824 Bacteria 1792
479 Ga0501045_0278044 3300049824 Bacteria 1246
480 nmdc:mga05p37_274019_c1 3300050507 Bacteria 2015
481 nmdc:mga05p37_674577_c1 3300050507 Bacteria 1153
482 nmdc:mga09592_69120_c1 3300050508 Bacteria 2996
483 nmdc:mga06r32_1060883_c1 3300050510 Unclassified 761
484 nmdc:mga06r32_352388_c1 3300050510 Bacteria 1456
485 nmdc:mga08y16_172005_c1 3300050511 Bacteria 2250
486 nmdc:mga08y16_96426_c1 3300050511 Bacteria 3080
487 nmdc:mga0n895_283515_c1 3300050512 Bacteria 1680
488 nmdc:mga0n895_594944_c1 3300050512 Bacteria 1109
489 nmdc:mga0rr50_190600_c1 3300050513 Bacteria 1241
490 nmdc:mga0rr50_194346_c1 3300050513 Bacteria 1664
491 nmdc:mga08x19_243168_c1 3300050514 Bacteria 1241
492 nmdc:mga0a205_135258_c1 3300050515 Bacteria 2365
493 nmdc:mga0a205_383619_c1 3300050515 Bacteria 1270
494 nmdc:mga0a205_44445_c1 3300050515 Bacteria 4282
495 nmdc:mga0a205_597800_c1 3300050515 Bacteria 956
496 Ga0495601_0063916 3300053077 Bacteria 2339
497 Ga0495601_0637719 3300053077 Unclassified 682
498 Ga0495612_0000050 3300053078 Bacteria 53469
499 Ga0495595_0061497 3300053084 Bacteria 1759
500 Ga0495619_0824286 3300053085 Viruses 627
501 Ga0501084_0018083 3300054114 Bacteria 5871
502 Ga0501084_0116450 3300054114 Bacteria 2246
503 Ga0501084_0302534 3300054114 Bacteria 1351
504 Ga0501084_0505623 3300054114 Bacteria 1021
505 Ga0501084_0696812 3300054114 Bacteria 856
506 Ga0590074_006248 3300059423 Bacteria 1977
507 Ga0590075_003546 3300059424 Bacteria 3704
508 Ga0590077_031485 3300059426 Bacteria 1159
509 Ga0501082_0067644 3300060353 Bacteria 3077
510 Ga0501082_0130844 3300060353 Bacteria 2177
511 Ga0501082_0387549 3300060353 Bacteria 1219
512 Ga0501082_0467421 3300060353 Bacteria 1102
513 Ga0501082_0567085 3300060353 Bacteria 993
514 Ga0501082_0752724 3300060353 Bacteria 853
515 Ga0530510_0004148 3300061734 Bacteria 10003
516 Ga0530510_0094077 3300061734 Bacteria 2189
517 Ga0530510_0133291 3300061734 Bacteria 1828
518 Ga0530510_0148157 3300061734 Bacteria 1732
519 Ga0530510_0182510 3300061734 Bacteria 1556
520 Ga0530510_0563723 3300061734 Bacteria 865
521 Ga0207658_10771518
522 JGI25406J46586_10019513
523 rootH2_10091441
524 Ga0070676_10310814
525 Ga0070683_100009778
526 Ga0070690_100083193
527 Ga0070690_100142887
528 Ga0070670_100060876
529 Ga0070680_100000082
530 Ga0070680_100335323
531 Ga0070680_100584110
532 Ga0070682_100041451
533 Ga0068868_100154379
534 Ga0068868_100423886
535 Ga0070689_100036636
536 Ga0070687_100001421
537 Ga0070687_100154610
538 Ga0070661_100128456
539 Ga0070692_10108223
540 Ga0070668_100099763
541 Ga0070669_100193444
542 Ga0070669_100337273
543 Ga0070675_101036469
544 Ga0070674_100004710
545 Ga0070673_100361460
546 Ga0070688_100021328
547 Ga0070688_100116778
548 Ga0070659_100005140
549 Ga0070701_10002065
550 Ga0070701_10701670
551 Ga0070705_100024632
552 Ga0070705_100242337
553 Ga0070700_100010904
554 Ga0070700_100064864
555 Ga0070694_100032048
556 Ga0070694_100096656
557 Ga0070694_100627903
558 Ga0070708_100001680
559 Ga0070708_100003100
560 Ga0070708_100010936
561 Ga0070708_100235420
562 Ga0070708_100512591
563 Ga0070708_100669403
564 Ga0070708_100688614
565 Ga0070663_100010643
566 Ga0070663_100879047
567 Ga0070678_100073416
568 Ga0070678_100223014
569 Ga0070678_100292380
570 Ga0070678_101008142
571 Ga0070662_100089422
572 Ga0070681_10528132
573 Ga0070681_10664994
574 Ga0070706_100000401
575 Ga0070706_100038259
576 Ga0070706_100043090
577 Ga0070706_100051925
578 Ga0070706_100206837
579 Ga0070707_100000698
580 Ga0070707_100005010
581 Ga0070707_100235161
582 Ga0070707_100242919
583 Ga0070707_100254566
584 Ga0070707_100345374
585 Ga0070707_100668249
586 Ga0070707_100829264
587 Ga0070698_100478298
588 Ga0070698_100915258
589 Ga0070699_100063171
590 Ga0070699_100122204
591 Ga0070679_100679133
592 Ga0070684_100064749
593 Ga0070684_101067547
594 Ga0070697_100015181
595 Ga0070697_100508869
596 Ga0070686_100001586
597 Ga0070686_100200346
598 Ga0070686_100466485
599 Ga0070695_100003708
600 Ga0070695_100008360
601 Ga0070695_100017368
602 Ga0070695_100335246
603 Ga0070696_100002686
604 Ga0070696_100053307
605 Ga0070696_100057861
606 Ga0070693_100079475
607 Ga0070693_100418678
608 Ga0070704_100052128
609 Ga0070704_100328498
610 Ga0070704_100394906
611 Ga0070704_100506224
612 Ga0070704_100587146
613 Ga0068855_100133286
614 Ga0068855_100282463
615 Ga0068855_100596423
616 Ga0070664_100089694
617 Ga0070664_100910436
618 Ga0068854_100076327
619 Ga0068854_100188990
620 Ga0068854_100427353
621 Ga0070702_100007386
622 Ga0068852_100080321
623 Ga0068852_100564269
624 Ga0068859_100221073
625 Ga0068859_101498353
626 Ga0068864_100014991
627 Ga0068864_100021366
628 Ga0068861_100028924
629 Ga0068861_100391496
630 Ga0068863_100101317
631 Ga0068863_100584342
632 Ga0068858_100017193
633 Ga0068860_100313112
634 Ga0081455_10133196
635 Ga0081455_10134952
636 Ga0081538_10111149
637 Ga0081539_10004686
638 Ga0081539_10114402
639 Ga0075365_10115711
640 Ga0097621_100256896
641 Ga0068871_100144902
642 Ga0075428_100000172
643 Ga0075428_100157449
644 Ga0075428_100462885
645 Ga0075431_100155602
646 Ga0075431_100370654
647 Ga0075433_10073074
648 Ga0075433_10477218
649 Ga0075434_100435178
650 Ga0075436_100441291
651 Ga0097620_100221057
652 Ga0097620_101498343
653 Ga0075435_100124011
654 Ga0075435_100367913
655 Ga0111539_10063564
656 Ga0111539_10119194
657 Ga0111539_10467512
658 Ga0105245_10282337
659 Ga0105245_10463053
660 Ga0105247_10107798
661 Ga0114129_10247639
662 Ga0114129_10260409
663 Ga0114129_10330450
664 Ga0114129_10550361
665 Ga0105243_10032373
666 Ga0105243_10446389
667 Ga0105243_10483211
668 Ga0105243_10803511
669 Ga0105242_10202930
670 Ga0105242_10296236
671 Ga0105242_10411738
672 Ga0105242_10419046
673 Ga0105242_10583603
674 Ga0105248_10342423
675 Ga0105248_10425330
676 Ga0105248_10594221
677 Ga0105238_10407861
678 Ga0105249_10083350
679 Ga0105249_10885935
680 Ga0105249_10999407
681 Ga0105249_11791039
682 Ga0099796_10147050
683 Ga0105239_10019677
684 Ga0105239_10049266
685 Ga0105239_10055394
686 Ga0105239_10855479
687 Ga0105246_10438475
688 Ga0157374_10212492
689 Ga0157378_10103976
690 Ga0157378_10282257
691 Ga0157378_10353450
692 Ga0157378_10414413
693 Ga0163162_11124771
694 Ga0157375_10011630
695 Ga0157375_10318283
696 Ga0157375_10379414
697 Ga0163163_10031002
698 Ga0163163_10063075
699 Ga0163163_10127126
700 Ga0163163_10306940
701 Ga0157380_10005741
702 Ga0157380_10096472
703 Ga0157380_10494365
704 Ga0157380_11186883
705 Ga0157377_10054638
706 Ga0157377_10434169
707 Ga0157379_10064742
708 Ga0157379_10126460
709 Ga0157379_10254842
710 Ga0157379_10459966
711 Ga0157376_10114734
712 Ga0157376_10281890
713 Ga0163161_10239054
714 Ga0163161_10326667
715 Ga0207688_10003570
716 Ga0207680_10211803
717 Ga0207680_10419458
718 Ga0207647_10315844
719 Ga0207645_10064877
720 Ga0207684_10000381
721 Ga0207684_10001682
722 Ga0207684_10016310
723 Ga0207684_10019148
724 Ga0207684_10076964
725 Ga0207684_10349236
726 Ga0207654_10580779
727 Ga0207707_10429604
728 Ga0207671_10411038
729 Ga0207693_10369896
730 Ga0207660_10000004
731 Ga0207660_10246027
732 Ga0207660_10388473
733 Ga0207662_10021411
734 Ga0207662_10039436
735 Ga0207662_10258080
736 Ga0207657_10285882
737 Ga0207649_10280492
738 Ga0207652_10241778
739 Ga0207652_10665653
740 Ga0207646_10001103
741 Ga0207646_10002110
742 Ga0207646_10006521
743 Ga0207646_10020069
744 Ga0207646_10068959
745 Ga0207646_10237783
746 Ga0207681_10855630
747 Ga0207687_10008896
748 Ga0207687_10302924
749 Ga0207687_10771948
750 Ga0207644_10572757
751 Ga0207706_10116723
752 Ga0207709_10348246
753 Ga0207670_10206815
754 Ga0207669_10113480
755 Ga0207704_10307829
756 Ga0207711_10427293
757 Ga0207689_10105977
758 Ga0207689_10447208
759 Ga0207689_10602322
760 Ga0207661_10102997
761 Ga0207661_10155791
762 Ga0207661_10717008
763 Ga0207679_10388155
764 Ga0207667_10386095
765 Ga0207651_10303160
766 Ga0207712_10072390
767 Ga0207712_10334644
768 Ga0207668_10125067
769 Ga0207668_10668976
770 Ga0207640_10214872
771 Ga0207640_10653468
772 Ga0207640_10750675
773 Ga0207658_10707387
774 Ga0207677_10136673
775 Ga0207677_10186889
776 Ga0207703_10470294
777 Ga0207678_10423293
778 Ga0207678_10682949
779 Ga0207708_10023487
780 Ga0207708_10041762
781 Ga0207708_10063624
782 Ga0207708_10185783
783 Ga0207708_10223984
784 Ga0207641_10489840
785 Ga0207648_10027016
786 Ga0207648_10446351
787 Ga0207676_10032104
788 Ga0207676_10464807
789 Ga0207674_10001587
790 Ga0207674_10296481
791 Ga0207675_100031936
792 Ga0207675_101091440
793 Ga0207683_10027680
794 Ga0207683_10038780
795 Ga0207683_10690773
796 Ga0207698_10155692
797 Ga0207428_10066227
798 Ga0207428_10203650
799 Ga0268266_11279746
800 Ga0268265_10159076
801 Ga0268264_10311976
802 Ga0265319_1006972
803 Ga0265319_1013860
804 Ga0265334_10018827
805 Ga0265334_10126804
806 Ga0265318_10009499
807 Ga0265318_10010354
808 Ga0265318_10011680
809 Ga0265322_10028875
810 Ga0265336_10003977
811 Ga0265338_10050601
812 Ga0265324_10005693
813 Ga0265332_10057637
814 Ga0265320_10007126
815 Ga0265320_10057731
816 Ga0265325_10145016
817 Ga0265340_10004837
818 Ga0265339_10261330
819 Ga0265316_10061473
820 Ga0265316_10349726
821 Ga0265316_10454885
822 Ga0265316_10541433
823 Ga0307408_100081143
824 Ga0265313_10017041
825 Ga0265314_10001539
826 Ga0265314_10216218
827 Ga0307405_10023180
828 Ga0307413_10237013
829 Ga0307410_10048948
830 Ga0307410_10791767
831 Ga0307412_10040146
832 Ga0307412_10415778
833 Ga0307409_100215416
834 Ga0307416_100046184
835 Ga0307416_100322414
836 Ga0307411_10058081
837 Ga0307411_10691864
838 Ga0307415_100005808
839 Ga0307415_100010574
840 Ga0307415_100565340
841 Ga0373929_0060747
842 Ga0373941_0099092
843 Ga0373941_0100195
844 Ga0373962_0052496
845 Ga0373931_0367668
846 Ga0373947_0231234
847 Ga0439465_0090390
848 Ga0439452_027833
849 Ga0450920_024678
850 Ga0450910_023731
851 Ga0439434_0069298
852 Ga0439460_0091217
853 Ga0495641_0110153
854 Ga0495641_0288048
855 Ga0495653_0265910
856 Ga0495582_0211043
857 Ga0495664_0066390
858 Ga0495586_0241043
859 Ga0495656_0017374
860 Ga0495659_0183860
861 Ga0495604_0340455
862 Ga0495674_0139466
863 Ga0495680_0466872
864 Ga0495614_0161165
865 Ga0496100_0011616
866 Ga0496100_0266385
867 Ga0496100_0311953
868 Ga0496100_0801904
869 Ga0496101_0006297
870 Ga0496101_0060369
871 Ga0496101_0619835
872 Ga0496102_0008164
873 Ga0496102_0064241
874 Ga0496102_0526057
875 Ga0496103_0189134
876 Ga0496104_0090037
877 Ga0496104_0120181
878 Ga0496104_0382184
879 Ga0496104_0589573
880 Ga0496104_1103939
881 Ga0496105_0007099
882 Ga0496105_0188855
883 Ga0496106_0115613
884 Ga0496106_0127772
885 Ga0496106_0419141
886 Ga0496106_0510201
887 Ga0496106_0591881
888 Ga0496107_0235001
889 Ga0496107_0252817
890 Ga0496107_0307835
891 Ga0496107_0319151
892 Ga0496107_0351491
893 Ga0496108_0023480
894 Ga0496108_0124053
895 Ga0496109_0033309
896 Ga0496109_0046721
897 Ga0496109_0093973
898 Ga0496109_0147150
899 Ga0496110_0020859
900 Ga0496110_0101960
901 Ga0496110_0148449
902 Ga0496110_0358511
903 Ga0496111_0016656
904 Ga0496111_0041184
905 Ga0496111_0105205
906 Ga0496112_0120729
907 Ga0496112_0161244
908 Ga0496112_0468668
909 Ga0496113_0057275
910 Ga0496113_0105176
911 Ga0496113_0840802
912 Ga0496114_0007576
913 Ga0496114_0114498
914 Ga0496114_0126736
915 Ga0496114_0207449
916 Ga0501031_0081303
917 Ga0501031_0259346
918 Ga0501032_0065124
919 Ga0501032_0241725
920 Ga0501033_0100781
921 Ga0501036_0705168
922 Ga0501037_0061429
923 Ga0501037_0066956
924 Ga0501038_0030618
925 Ga0501038_0220341
926 Ga0501039_0025857
927 Ga0501039_0085078
928 Ga0501040_0038183
929 Ga0501040_0092654
930 Ga0501040_0099953
931 Ga0501040_0128552
932 Ga0501040_0324532
933 Ga0501041_0104230
934 Ga0501042_0051323
935 Ga0501042_0073550
936 Ga0501042_0502104
937 Ga0501043_0210038
938 Ga0501046_0073859
939 Ga0501046_0328533
940 Ga0501048_0016696
941 Ga0501048_0060105
942 Ga0501048_0063242
943 Ga0501048_0083850
944 Ga0501067_0006437
945 Ga0501067_0011973
946 Ga0501067_0105565
947 Ga0501068_0059157
948 Ga0501068_0075904
949 Ga0501068_0096882
950 Ga0501068_0337383
951 Ga0501070_0183493
952 Ga0501070_0281550
953 Ga0501070_0300922
954 Ga0501071_0020534
955 Ga0501071_0102345
956 Ga0501071_0308778
957 Ga0501071_0397572
958 Ga0501071_0615229
959 Ga0501072_0066288
960 Ga0501072_0092310
961 Ga0501072_0154241
962 Ga0501072_0190329
963 Ga0501072_0459156
964 Ga0501072_0492727
965 Ga0501074_0040897
966 Ga0501074_0045122
967 Ga0501074_0213535
968 Ga0501075_0023376
969 Ga0501075_0023670
970 Ga0501075_0029318
971 Ga0501075_0060573
972 Ga0501075_0316474
973 Ga0501075_0353531
974 Ga0501075_0427080
975 Ga0501076_0013618
976 Ga0501076_0101457
977 Ga0501076_0259164
978 Ga0501076_0333422
979 Ga0501076_0665574
980 Ga0501077_0027113
981 Ga0501077_0469475
982 Ga0501077_0614162
983 Ga0501079_0054403
984 Ga0501079_0134564
985 Ga0501079_0381447
986 Ga0501080_0028134
987 Ga0501080_0097138
988 Ga0501080_0155639
989 Ga0501081_0063133
990 Ga0501081_0073822
991 Ga0501081_0793886
992 Ga0501083_0505713
993 Ga0501035_0043910
994 Ga0501044_0294123
995 Ga0501045_0006736
996 Ga0501045_0013193
997 Ga0501045_0075357
998 Ga0501045_0141106
999 Ga0501045_0278044
1000 nmdc:mga05p37_274019_c1
1001 nmdc:mga05p37_674577_c1
1002 nmdc:mga09592_69120_c1
1003 nmdc:mga06r32_1060883_c1
1004 nmdc:mga06r32_352388_c1
1005 nmdc:mga08y16_172005_c1
1006 nmdc:mga08y16_96426_c1
1007 nmdc:mga0n895_283515_c1
1008 nmdc:mga0n895_594944_c1
1009 nmdc:mga0rr50_190600_c1
1010 nmdc:mga0rr50_194346_c1
1011 nmdc:mga08x19_243168_c1
1012 nmdc:mga0a205_135258_c1
1013 nmdc:mga0a205_383619_c1
1014 nmdc:mga0a205_44445_c1
1015 nmdc:mga0a205_597800_c1
1016 Ga0495601_0063916
1017 Ga0495601_0637719
1018 Ga0495612_0000050
1019 Ga0495595_0061497
1020 Ga0495619_0824286
1021 Ga0501084_0018083
1022 Ga0501084_0116450
1023 Ga0501084_0302534
1024 Ga0501084_0505623
1025 Ga0501084_0696812
1026 Ga0590074_006248
1027 Ga0590075_003546
1028 Ga0590077_031485
1029 Ga0501082_0067644
1030 Ga0501082_0130844
1031 Ga0501082_0387549
1032 Ga0501082_0467421
1033 Ga0501082_0567085
1034 Ga0501082_0752724
1035 Ga0530510_0004148
1036 Ga0530510_0094077
1037 Ga0530510_0133291
1038 Ga0530510_0148157
1039 Ga0530510_0182510
1040 Ga0530510_0563723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10369

ALS_ss_C

Small subunit of acetolactate synthase

132

205

0.99

PF13710

ACT_5

ACT domain

69

131

0.98

PF22629

AHAS-like_ACT

AHAS-like ACT domain

63

130

0.96

PF01842

ACT

ACT domain

61

127

0.94

Map