F458550

General Info

Members Datasets Scaffolds Average Seq Length
520 282 1040 254

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10357051|Ga0207639_103570512
Length 256
Sequence MFKLDNKIAVITGGGSGIGKAISILFGLQGATVCIIDINDESEMVVEHIRHTSGKAFFYKCNISSQEEVKNIVQEIIQQHASIDILVNNAGVAHVGTAENTSAEDFERLINVNIKGVYNCLHEVLPFMKQKGGNILNMASVAALVGLNDRFAYSATKGAVIAMTLSVAKDFLAYNIRCNSISPGRVHTPFVDGFLAKNYPGKEAEMFDKLSKTQPIGRMGKPEEIAQLALYLCSEEASFITGCDYPIDGGFVKLNT

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
162 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
248 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
249 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
255 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
256 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
259 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
260 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
261 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
264 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
272 2643221556 Massilia sp. Root1485 Isolate Unclassified
273 2643221638 Duganella sp. Root336D2 Isolate Unclassified
274 2643221645 Massilia sp. Root351 Isolate Unclassified
275 2643221664 Massilia sp. Root418 Isolate Unclassified
276 2643221684 Massilia sp. Root133 Isolate Unclassified
277 2738541280 Massilia sp. GV090 Isolate Unclassified
278 2738541300 Massilia sp. GV016 Isolate Unclassified
279 2738543018 Massilia sp. GV045 Isolate Unclassified
280 2738543030 Massilia sp. GV097 Isolate Unclassified
281 2904424332 Duganella sp. 1411 Isolate Rhizosphere
282 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.88
Nodule 0
Rhizoplane 1.54
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10357051 3300026041 Bacteria 1307
2 JGI25158J39367_1000015 3300002739 Bacteria 46164
3 JGI25158J39367_1000072 3300002739 Bacteria 23033
4 JGI25152J39213_1000002 3300002773 Bacteria 219237
5 JGI25150J39212_1000038 3300002774 Bacteria 88070
6 JGI25150J39212_1003391 3300002774 Bacteria 3731
7 JGI25159J45721_1000185 3300002987 Bacteria 28695
8 JGI25159J45721_1000254 3300002987 Bacteria 25167
9 JGI25153J46596_10002426 3300003215 Bacteria 10751
10 JGI25153J46596_10025631 3300003215 Bacteria 2103
11 rootH1_10018661 3300003316 Bacteria 12476
12 rootH2_10104256 3300003320 Bacteria 1223
13 rootH2_10140316 3300003320 Bacteria 3722
14 rootL2_10203852 3300003322 Bacteria 5815
15 rootL2_10213213 3300003322 Bacteria 4021
16 rootH1_10005851 3300003323 Bacteria 85811
17 rootH1_10012383 3300003323 Bacteria 70816
18 rootH1_10029352 3300003323 Bacteria 6133
19 rootH1_10029353 3300003323 Unclassified 3862
20 rootH1_10118678 3300003323 Bacteria 9644
21 rootH1_10156555 3300003323 Bacteria 3461
22 rootH1_10160801 3300003323 Bacteria 4715
23 rootH1_10231546 3300003323 Bacteria 1447
24 JGI25160J50197_1000424 3300003354 Bacteria 26595
25 JGI25160J50197_1007121 3300003354 Bacteria 4412
26 JGI25161J50226_1000062 3300003374 Bacteria 99783
27 JGI25161J50226_1001608 3300003374 Bacteria 6584
28 Ga0055525_1000047 3300003759 Bacteria 261507
29 Ga0055526_1000358 3300003771 Bacteria 37034
30 Ga0055526_1021270 3300003771 Bacteria 2264
31 Ga0055537_1005297 3300003773 Bacteria 3489
32 Ga0055537_1022169 3300003773 Bacteria 931
33 Ga0055524_1000105 3300003775 Bacteria 104121
34 Ga0055524_1000462 3300003775 Bacteria 32912
35 Ga0055524_1001461 3300003775 Bacteria 13487
36 Ga0055534_1000541 3300003784 Bacteria 20168
37 Ga0055530_10000078 3300003791 Bacteria 83740
38 Ga0055530_10002786 3300003791 Bacteria 10778
39 Ga0055530_10005344 3300003791 Bacteria 6145
40 Ga0055531_10000058 3300003794 Bacteria 121538
41 Ga0055531_10002145 3300003794 Bacteria 13491
42 Ga0055531_10004991 3300003794 Bacteria 7872
43 Ga0055543_1000121 3300004625 Bacteria 66082
44 Ga0055543_1005457 3300004625 Bacteria 3237
45 Ga0065165_1000261 3300005262 Bacteria 90816
46 Ga0070658_10077141 3300005327 Bacteria 2733
47 Ga0070658_10336527 3300005327 Bacteria 1290
48 Ga0070658_10504139 3300005327 Bacteria 1046
49 Ga0070658_10505194 3300005327 Bacteria 1044
50 Ga0070676_10025105 3300005328 Bacteria 3366
51 Ga0070683_100527325 3300005329 Bacteria 1129
52 Ga0070677_10225891 3300005333 Bacteria 917
53 Ga0068869_100003584 3300005334 Bacteria 9525
54 Ga0068869_100598366 3300005334 Bacteria 931
55 Ga0070666_10000061 3300005335 Bacteria 84365
56 Ga0070666_10016986 3300005335 Unclassified 4661
57 Ga0070666_10274443 3300005335 Bacteria 1197
58 Ga0070680_100321952 3300005336 Bacteria 1312
59 Ga0070680_100523112 3300005336 Bacteria 1016
60 Ga0068868_100039809 3300005338 Bacteria 3655
61 Ga0070660_100001082 3300005339 Bacteria 18309
62 Ga0070660_100005946 3300005339 Bacteria 8437
63 Ga0070661_100206407 3300005344 Bacteria 1503
64 Ga0070668_100092972 3300005347 Bacteria 2380
65 Ga0070669_100062645 3300005353 Unclassified 2735
66 Ga0070671_100034728 3300005355 Bacteria 4175
67 Ga0070674_100015774 3300005356 Bacteria 4725
68 Ga0070674_100253109 3300005356 Bacteria 1384
69 Ga0070673_100250115 3300005364 Bacteria 1545
70 Ga0070659_100047843 3300005366 Bacteria 3357
71 Ga0070659_100171290 3300005366 Bacteria 1778
72 Ga0070667_100044217 3300005367 Bacteria 3739
73 Ga0070667_100118617 3300005367 Bacteria 2300
74 Ga0070678_100094303 3300005456 Bacteria 2304
75 Ga0070662_100272600 3300005457 Bacteria 1367
76 Ga0068867_100044869 3300005459 Bacteria 3240
77 Ga0068867_100067702 3300005459 Bacteria 2663
78 Ga0070685_10099164 3300005466 Bacteria 1776
79 Ga0070679_100020667 3300005530 Bacteria 6421
80 Ga0070684_100019229 3300005535 Bacteria 5647
81 Ga0070684_100328598 3300005535 Bacteria 1405
82 Ga0068853_100066780 3300005539 Bacteria 3124
83 Ga0068853_100519823 3300005539 Bacteria 1125
84 Ga0070672_100012051 3300005543 Bacteria 6051
85 Ga0068855_100028111 3300005563 Bacteria 6726
86 Ga0068855_100186633 3300005563 Bacteria 2341
87 Ga0070664_100464332 3300005564 Bacteria 1163
88 Ga0068852_100001474 3300005616 Bacteria 15932
89 Ga0068852_100566577 3300005616 Bacteria 1137
90 Ga0068859_100000071 3300005617 Bacteria 93613
91 Ga0068859_100010436 3300005617 Bacteria 9347
92 Ga0068864_100006275 3300005618 Bacteria 9751
93 Ga0068851_10139298 3300005834 Unclassified 1318
94 Ga0068870_10185905 3300005840 Bacteria 1251
95 Ga0068863_100004791 3300005841 Bacteria 13329
96 Ga0068863_100559910 3300005841 Bacteria 1129
97 Ga0068858_100013471 3300005842 Bacteria 7715
98 Ga0068858_100397205 3300005842 Bacteria 1324
99 Ga0068860_100004332 3300005843 Bacteria 14506
100 Ga0068860_100011991 3300005843 Bacteria 8538
101 Ga0068860_100525731 3300005843 Bacteria 1183
102 Ga0081539_10004597 3300005985 Bacteria 15067
103 Ga0070716_100254310 3300006173 Bacteria 1199
104 Ga0097621_100003597 3300006237 Bacteria 10709
105 Ga0097621_100007664 3300006237 Bacteria 7739
106 Ga0097621_100282708 3300006237 Bacteria 1461
107 Ga0068871_100005124 3300006358 Bacteria 9154
108 Ga0068865_100031135 3300006881 Unclassified 3555
109 Ga0097620_100000071 3300006931 Bacteria 93613
110 Ga0097620_100010436 3300006931 Bacteria 9347
111 Ga0105244_10146316 3300009036 Bacteria 1134
112 Ga0105240_10318481 3300009093 Bacteria 1773
113 Ga0105245_10246348 3300009098 Bacteria 1735
114 Ga0105247_10004579 3300009101 Bacteria 8809
115 Ga0105243_10100499 3300009148 Bacteria 2400
116 Ga0105241_10003070 3300009174 Bacteria 12451
117 Ga0105241_10261471 3300009174 Bacteria 1471
118 Ga0105241_10907964 3300009174 Bacteria 818
119 Ga0105242_10146839 3300009176 Bacteria 2052
120 Ga0105242_10686148 3300009176 Bacteria 1000
121 Ga0105237_10002673 3300009545 Bacteria 21874
122 Ga0105237_10081179 3300009545 Bacteria 3233
123 Ga0105237_10387428 3300009545 Bacteria 1402
124 Ga0105238_10282185 3300009551 Bacteria 1642
125 Ga0105249_10012351 3300009553 Bacteria 7526
126 Ga0105249_10253918 3300009553 Unclassified 1744
127 Ga0105239_10047867 3300010375 Bacteria 4686
128 Ga0105246_10018729 3300011119 Bacteria 4414
129 Ga0157373_10000327 3300013100 Bacteria 38493
130 Ga0157373_10069633 3300013100 Bacteria 2487
131 Ga0157373_10113087 3300013100 Bacteria 1908
132 Ga0157371_10012612 3300013102 Bacteria 6450
133 Ga0157371_10174539 3300013102 Bacteria 1536
134 Ga0157370_10008258 3300013104 Bacteria 11240
135 Ga0157370_10194462 3300013104 Bacteria 1883
136 Ga0157370_10260626 3300013104 Bacteria 1602
137 Ga0157369_10211426 3300013105 Bacteria 2033
138 Ga0157369_10307118 3300013105 Unclassified 1650
139 Ga0157374_10487130 3300013296 Bacteria 1237
140 Ga0157378_10467189 3300013297 Bacteria 1255
141 Ga0163162_10103144 3300013306 Bacteria 2946
142 Ga0163162_10158780 3300013306 Bacteria 2382
143 Ga0163162_10563375 3300013306 Bacteria 1267
144 Ga0157372_10000980 3300013307 Bacteria 31160
145 Ga0157372_10038946 3300013307 Bacteria 5247
146 Ga0157372_10054131 3300013307 Bacteria 4475
147 Ga0157372_10480226 3300013307 Bacteria 1449
148 Ga0157372_10487586 3300013307 Bacteria 1437
149 Ga0157372_10625677 3300013307 Unclassified 1254
150 Ga0157375_10086477 3300013308 Bacteria 3186
151 Ga0163163_10050905 3300014325 Bacteria 4081
152 Ga0163163_10204410 3300014325 Unclassified 2023
153 Ga0157379_10073792 3300014968 Bacteria 3054
154 Ga0157376_10029603 3300014969 Bacteria 4363
155 Ga0213876_10005376 3300021384 Bacteria 7046
156 Ga0209436_100005 3300025208 Bacteria 151087
157 Ga0209436_100153 3300025208 Bacteria 33091
158 Ga0209563_100003 3300025230 Bacteria 1932942
159 Ga0207425_1000001 3300025245 Bacteria 2525432
160 Ga0207425_1000033 3300025245 Bacteria 245540
161 Ga0207425_1000430 3300025245 Bacteria 27743
162 Ga0209646_1000106 3300025246 Bacteria 163422
163 Ga0209677_101295 3300025253 Bacteria 11132
164 Ga0209148_1000871 3300025254 Bacteria 21034
165 Ga0209129_1000001 3300025258 Bacteria 1452436
166 Ga0209129_1004542 3300025258 Bacteria 5359
167 Ga0209565_1001351 3300025263 Bacteria 11117
168 Ga0209565_1001394 3300025263 Bacteria 10799
169 Ga0209673_1004467 3300025273 Bacteria 7484
170 Ga0209130_1000055 3300025284 Bacteria 211696
171 Ga0209130_1000592 3300025284 Bacteria 35299
172 Ga0209675_1001604 3300025291 Bacteria 12773
173 Ga0209564_1000124 3300025295 Bacteria 202046
174 Ga0209564_1002012 3300025295 Bacteria 17744
175 Ga0209564_1037786 3300025295 Bacteria 1354
176 Ga0209758_1000020 3300025297 Bacteria 734220
177 Ga0209758_1003711 3300025297 Bacteria 13539
178 Ga0209050_1000011 3300025298 Bacteria 914037
179 Ga0209050_1000313 3300025298 Bacteria 98580
180 Ga0209050_1003773 3300025298 Bacteria 10830
181 Ga0209256_1000028 3300025299 Bacteria 420213
182 Ga0209256_1001270 3300025299 Bacteria 27521
183 Ga0207426_1000023 3300025302 Bacteria 545465
184 Ga0207426_1000818 3300025302 Bacteria 33399
185 Ga0207426_1017083 3300025302 Bacteria 2588
186 Ga0209051_1064223 3300025303 Bacteria 1138
187 Ga0209257_1000003 3300025304 Bacteria 1702593
188 Ga0209257_1000007 3300025304 Bacteria 1564415
189 Ga0209257_1003724 3300025304 Bacteria 12653
190 Ga0207697_10038418 3300025315 Bacteria 1963
191 Ga0207682_10016365 3300025893 Bacteria 2892
192 Ga0207642_10075102 3300025899 Bacteria 1622
193 Ga0207710_10017893 3300025900 Bacteria 3009
194 Ga0207680_10000119 3300025903 Bacteria 36651
195 Ga0207645_10000245 3300025907 Bacteria 45135
196 Ga0207645_10072712 3300025907 Bacteria 2201
197 Ga0207643_10023604 3300025908 Bacteria 3392
198 Ga0207643_10126353 3300025908 Bacteria 1518
199 Ga0207705_10008110 3300025909 Bacteria 7695
200 Ga0207654_10003342 3300025911 Bacteria 8125
201 Ga0207654_10130517 3300025911 Bacteria 1590
202 Ga0207695_10283574 3300025913 Bacteria 1550
203 Ga0207671_10002498 3300025914 Bacteria 19627
204 Ga0207660_10264488 3300025917 Bacteria 1361
205 Ga0207657_10001383 3300025919 Bacteria 25890
206 Ga0207657_10001634 3300025919 Bacteria 24147
207 Ga0207657_10003004 3300025919 Bacteria 18072
208 Ga0207657_10028469 3300025919 Bacteria 5096
209 Ga0207649_10150106 3300025920 Bacteria 1604
210 Ga0207652_10022101 3300025921 Bacteria 5258
211 Ga0207681_10068714 3300025923 Bacteria 2462
212 Ga0207650_10031374 3300025925 Bacteria 3837
213 Ga0207650_10123383 3300025925 Bacteria 2019
214 Ga0207687_10563332 3300025927 Bacteria 957
215 Ga0207690_10035788 3300025932 Bacteria 3210
216 Ga0207690_10050006 3300025932 Bacteria 2788
217 Ga0207686_10096205 3300025934 Bacteria 1967
218 Ga0207709_10087912 3300025935 Bacteria 2022
219 Ga0207669_10298694 3300025937 Bacteria 1223
220 Ga0207691_10011183 3300025940 Bacteria 8613
221 Ga0207691_10155572 3300025940 Bacteria 2008
222 Ga0207689_10004176 3300025942 Bacteria 13129
223 Ga0207689_10004731 3300025942 Bacteria 12272
224 Ga0207661_10486667 3300025944 Bacteria 1127
225 Ga0207667_10003039 3300025949 Bacteria 20823
226 Ga0207667_10093045 3300025949 Bacteria 3113
227 Ga0207712_10009586 3300025961 Bacteria 6132
228 Ga0207712_10061497 3300025961 Bacteria 2665
229 Ga0207640_10430473 3300025981 Bacteria 1082
230 Ga0207677_10014146 3300026023 Bacteria 4649
231 Ga0207703_10011580 3300026035 Bacteria 6857
232 Ga0207639_10027200 3300026041 Bacteria 4164
233 Ga0207641_10000240 3300026088 Bacteria 71036
234 Ga0207648_10007679 3300026089 Bacteria 10553
235 Ga0207648_10045562 3300026089 Bacteria 3847
236 Ga0207648_10095685 3300026089 Bacteria 2598
237 Ga0207648_10608617 3300026089 Bacteria 1007
238 Ga0207676_10019519 3300026095 Bacteria 4947
239 Ga0207674_10130262 3300026116 Unclassified 2479
240 Ga0207683_10001367 3300026121 Bacteria 22059
241 Ga0207683_10346078 3300026121 Bacteria 1364
242 Ga0207698_10001767 3300026142 Bacteria 12614
243 Ga0207698_10163096 3300026142 Bacteria 1952
244 Ga0207698_10566523 3300026142 Bacteria 1116
245 Ga0268266_10063782 3300028379 Bacteria 3181
246 Ga0268265_10104866 3300028380 Bacteria 2293
247 Ga0268264_10107656 3300028381 Bacteria 2435
248 Ga0307515_10000036 3300028794 Bacteria 332188
249 Ga0265338_10310276 3300028800 Bacteria 1144
250 Ga0316182_1029359 3300030745 Bacteria 1246
251 Ga0265327_10000054 3300031251 Bacteria 250337
252 Ga0307509_10010202 3300031507 Bacteria 11554
253 Ga0307408_100000022 3300031548 Bacteria 310242
254 Ga0307408_100001037 3300031548 Bacteria 21346
255 Ga0307408_100001365 3300031548 Bacteria 18206
256 Ga0307408_100013189 3300031548 Bacteria 5486
257 Ga0307408_100131239 3300031548 Bacteria 1954
258 Ga0307414_10054543 3300032004 Bacteria 2794
259 Ga0307414_10286305 3300032004 Bacteria 1387
260 Ga0395899_0005351 3300037312 Bacteria 9972
261 Ga0395899_0016478 3300037312 Bacteria 5635
262 Ga0395900_0000081 3300037418 Bacteria 174128
263 Ga0395900_0000148 3300037418 Bacteria 117889
264 Ga0395900_0001208 3300037418 Bacteria 31966
265 Ga0395900_0011957 3300037418 Bacteria 8874
266 Ga0395900_0057623 3300037418 Bacteria 3999
267 Ga0395900_0126928 3300037418 Bacteria 2616
268 Ga0395900_0294571 3300037418 Bacteria 1610
269 Ga0395900_0300367 3300037418 Bacteria 1592
270 Ga0395898_0005424 3300037466 Bacteria 13774
271 Ga0395898_0072987 3300037466 Bacteria 3314
272 Ga0395898_0296822 3300037466 Bacteria 1541
273 Ga0395905_0053774 3300037471 Bacteria 3768
274 Ga0395905_0066777 3300037471 Bacteria 3368
275 Ga0395905_0134076 3300037471 Bacteria 2329
276 Ga0395905_0159158 3300037471 Bacteria 2123
277 Ga0395905_0174622 3300037471 Bacteria 2017
278 Ga0395901_0000237 3300038443 Bacteria 69208
279 Ga0395901_0001388 3300038443 Bacteria 25312
280 Ga0395901_0052529 3300038443 Bacteria 4235
281 Ga0395901_0080042 3300038443 Bacteria 3410
282 Ga0395901_0212115 3300038443 Bacteria 2026
283 Ga0395901_0219711 3300038443 Bacteria 1986
284 Ga0436365_0058655 3300039437 Bacteria 2308
285 Ga0436365_0462204 3300039437 Bacteria 13240
286 Ga0439448_0000555 3300042005 Bacteria 8742
287 Ga0439450_001256 3300042008 Bacteria 3671
288 Ga0439455_0001607 3300042012 Bacteria 3850
289 Ga0450897_002410 3300042128 Bacteria 1401
290 Ga0450906_016501 3300042145 Bacteria 1336
291 Ga0439458_0075100 3300042157 Bacteria 857
292 Ga0450893_0006968 3300042532 Bacteria 1832
293 Ga0451577_0100543 3300042876 Bacteria 2583
294 Ga0466972_0000568 3300044658 Bacteria 18002
295 Ga0466965_0005218 3300044683 Bacteria 5839
296 Ga0466965_0074694 3300044683 Bacteria 1708
297 Ga0466966_0002106 3300044684 Bacteria 12927
298 Ga0466966_0005887 3300044684 Bacteria 8086
299 Ga0466966_0009166 3300044684 Bacteria 6552
300 Ga0466966_0063373 3300044684 Bacteria 2329
301 Ga0466966_0103168 3300044684 Bacteria 1762
302 Ga0466961_0032393 3300044693 Bacteria 3358
303 Ga0466961_0033989 3300044693 Bacteria 3275
304 Ga0466961_0065607 3300044693 Bacteria 2307
305 Ga0466964_0000492 3300044706 Bacteria 12242
306 Ga0466964_0002109 3300044706 Bacteria 7004
307 Ga0466964_0054164 3300044706 Bacteria 1653
308 Ga0466964_0139401 3300044706 Bacteria 1113
309 Ga0466971_0038620 3300044719 Bacteria 2142
310 Ga0466971_0087578 3300044719 Bacteria 1424
311 Ga0466971_0093707 3300044719 Bacteria 1376
312 Ga0466968_0000879 3300044735 Bacteria 10556
313 Ga0466968_0055123 3300044735 Bacteria 1705
314 Ga0466957_0000337 3300044842 Bacteria 22931
315 Ga0466957_0146113 3300044842 Bacteria 1526
316 Ga0466959_0033273 3300045049 Bacteria 3813
317 Ga0466959_0065055 3300045049 Bacteria 2646
318 Ga0451576_0015622 3300045051 Bacteria 8403
319 Ga0466958_0031251 3300045836 Bacteria 3164
320 Ga0466958_0059887 3300045836 Bacteria 2317
321 Ga0466958_0083789 3300045836 Bacteria 1965
322 Ga0466958_0171637 3300045836 Bacteria 1373
323 Ga0466967_0022979 3300045976 Bacteria 5101
324 Ga0466967_0335773 3300045976 Bacteria 1460
325 Ga0495590_0027213 3300046457 Bacteria 2007
326 Ga0495638_0197051 3300046460 Bacteria 1139
327 Ga0495653_0000634 3300046463 Bacteria 26792
328 Ga0495653_0003297 3300046463 Bacteria 12950
329 Ga0495653_0157635 3300046463 Bacteria 1579
330 Ga0495580_0070836 3300046472 Bacteria 2435
331 Ga0495582_0002079 3300046473 Bacteria 11198
332 Ga0495605_0003913 3300046474 Bacteria 8818
333 Ga0495605_0039913 3300046474 Bacteria 2348
334 Ga0495584_0000026 3300046491 Bacteria 114028
335 Ga0495584_0003323 3300046491 Bacteria 8900
336 Ga0495584_0009328 3300046491 Bacteria 5055
337 Ga0495584_0067210 3300046491 Bacteria 1802
338 Ga0495584_0100948 3300046491 Bacteria 1458
339 Ga0495585_0015518 3300046492 Bacteria 4428
340 Ga0495585_0063423 3300046492 Bacteria 2028
341 Ga0495596_0000156 3300046500 Bacteria 47560
342 Ga0495596_0000833 3300046500 Bacteria 18653
343 Ga0495596_0003244 3300046500 Bacteria 8321
344 Ga0495607_0000316 3300046501 Bacteria 50215
345 Ga0495607_0001702 3300046501 Bacteria 18913
346 Ga0495607_0002001 3300046501 Bacteria 17120
347 Ga0495607_0003182 3300046501 Bacteria 12691
348 Ga0495607_0003268 3300046501 Bacteria 12466
349 Ga0495607_0014829 3300046501 Bacteria 5065
350 Ga0495607_0023955 3300046501 Bacteria 3814
351 Ga0495583_0000655 3300046506 Bacteria 45614
352 Ga0495583_0002721 3300046506 Bacteria 14634
353 Ga0495583_0018052 3300046506 Bacteria 3726
354 Ga0495606_0000210 3300046507 Bacteria 103488
355 Ga0495606_0003081 3300046507 Bacteria 18174
356 Ga0495606_0008190 3300046507 Bacteria 9145
357 Ga0495616_0001668 3300046513 Bacteria 15169
358 Ga0495616_0004757 3300046513 Bacteria 8507
359 Ga0495616_0024677 3300046513 Bacteria 3222
360 Ga0495616_0029393 3300046513 Bacteria 2902
361 Ga0495616_0029524 3300046513 Bacteria 2893
362 Ga0495630_0211983 3300046517 Bacteria 1478
363 Ga0495631_0004965 3300046518 Bacteria 7009
364 Ga0495631_0066518 3300046518 Bacteria 1559
365 Ga0495632_0000118 3300046519 Bacteria 81183
366 Ga0495632_0000321 3300046519 Bacteria 46253
367 Ga0495632_0001878 3300046519 Bacteria 16853
368 Ga0495632_0129242 3300046519 Bacteria 1176
369 Ga0495643_0058578 3300046522 Bacteria 2050
370 Ga0495643_0094534 3300046522 Bacteria 1538
371 Ga0495644_0005809 3300046523 Bacteria 4820
372 Ga0495644_0027163 3300046523 Bacteria 2169
373 Ga0495648_0007546 3300046524 Bacteria 8693
374 Ga0495666_0012757 3300046526 Bacteria 4188
375 Ga0495642_0000673 3300046528 Bacteria 17015
376 Ga0495642_0006892 3300046528 Bacteria 4357
377 Ga0495642_0044574 3300046528 Bacteria 1811
378 Ga0495652_0010208 3300046529 Bacteria 8515
379 Ga0495654_0126334 3300046530 Bacteria 1152
380 Ga0495665_0008314 3300046531 Bacteria 5626
381 Ga0495640_0082876 3300046533 Bacteria 2129
382 Ga0495587_0039675 3300046536 Bacteria 2816
383 Ga0495587_0046834 3300046536 Bacteria 2565
384 Ga0495609_0000001 3300046538 Bacteria 1060094
385 Ga0495609_0000084 3300046538 Bacteria 113497
386 Ga0495645_0192161 3300046543 Bacteria 1390
387 Ga0495633_0007798 3300046558 Bacteria 6117
388 Ga0495633_0050301 3300046558 Bacteria 1965
389 Ga0495656_0004909 3300046615 Bacteria 4605
390 Ga0495656_0007073 3300046615 Bacteria 3957
391 Ga0495656_0026833 3300046615 Bacteria 2296
392 Ga0495656_0049562 3300046615 Bacteria 1789
393 Ga0495668_0000006 3300046616 Bacteria 553404
394 Ga0495668_0040419 3300046616 Bacteria 2600
395 Ga0495668_0063407 3300046616 Bacteria 2035
396 Ga0495668_0074332 3300046616 Bacteria 1866
397 Ga0495668_0247477 3300046616 Bacteria 976
398 Ga0495634_0011863 3300046642 Bacteria 6332
399 Ga0495625_0001203 3300046660 Bacteria 32899
400 Ga0495625_0010429 3300046660 Bacteria 7690
401 Ga0495625_0119734 3300046660 Bacteria 1793
402 Ga0495659_0000185 3300046664 Bacteria 27168
403 Ga0495659_0004106 3300046664 Bacteria 4597
404 Ga0495661_0000053 3300046665 Bacteria 140234
405 Ga0495661_0000170 3300046665 Bacteria 77754
406 Ga0495661_0006188 3300046665 Bacteria 8425
407 Ga0495661_0084055 3300046665 Bacteria 1828
408 Ga0495661_0084921 3300046665 Bacteria 1815
409 Ga0495661_0197048 3300046665 Bacteria 1057
410 Ga0495588_0000062 3300046674 Bacteria 253674
411 Ga0495623_0005447 3300046679 Bacteria 8317
412 Ga0495646_0100350 3300046680 Bacteria 1661
413 Ga0495669_0001533 3300046684 Bacteria 9505
414 Ga0495669_0007765 3300046684 Bacteria 4504
415 Ga0495669_0086927 3300046684 Bacteria 1440
416 Ga0495624_0141108 3300046690 Bacteria 1476
417 Ga0495670_0080259 3300046691 Bacteria 1661
418 Ga0495671_0000088 3300046692 Bacteria 87282
419 Ga0495671_0131759 3300046692 Bacteria 1219
420 Ga0495649_0001312 3300046694 Bacteria 18988
421 Ga0495649_0038336 3300046694 Bacteria 2630
422 Ga0495649_0086178 3300046694 Bacteria 1676
423 Ga0495649_0139019 3300046694 Bacteria 1279
424 Ga0495589_0000103 3300046794 Bacteria 81696
425 Ga0495589_0004437 3300046794 Bacteria 7466
426 Ga0495600_0117527 3300046809 Bacteria 1730
427 Ga0495660_0000057 3300046810 Bacteria 133310
428 Ga0495660_0000208 3300046810 Bacteria 60381
429 Ga0495660_0006497 3300046810 Bacteria 6907
430 Ga0495660_0158719 3300046810 Bacteria 1111
431 Ga0495636_0018567 3300047318 Bacteria 2791
432 Ga0495636_0062023 3300047318 Bacteria 1582
433 Ga0495672_0000262 3300047320 Bacteria 73028
434 Ga0495672_0012409 3300047320 Bacteria 5947
435 Ga0495672_0029922 3300047320 Bacteria 3423
436 Ga0495680_0134949 3300047322 Bacteria 1810
437 Ga0495683_0005944 3300047323 Bacteria 6701
438 Ga0495683_0019185 3300047323 Bacteria 3530
439 Ga0495683_0137678 3300047323 Bacteria 1146
440 Ga0495687_000019 3300047443 Bacteria 341756
441 Ga0495687_000036 3300047443 Bacteria 255427
442 Ga0495687_000740 3300047443 Bacteria 35582
443 Ga0495687_001604 3300047443 Bacteria 20397
444 Ga0495687_003773 3300047443 Bacteria 10707
445 Ga0495675_0009884 3300047444 Bacteria 5947
446 Ga0495677_0000009 3300047445 Bacteria 170927
447 Ga0495677_0000217 3300047445 Bacteria 26216
448 Ga0495677_0000873 3300047445 Bacteria 12174
449 Ga0495677_0002104 3300047445 Bacteria 7919
450 Ga0495677_0003892 3300047445 Bacteria 5773
451 Ga0495677_0004159 3300047445 Bacteria 5584
452 Ga0495677_0028737 3300047445 Bacteria 2021
453 Ga0495677_0054243 3300047445 Bacteria 1478
454 Ga0495679_018009 3300047446 Bacteria 2516
455 Ga0495679_019164 3300047446 Bacteria 2411
456 Ga0495681_0000907 3300047470 Bacteria 22863
457 Ga0495681_0008872 3300047470 Bacteria 6249
458 Ga0495681_0060535 3300047470 Bacteria 1747
459 Ga0495593_0102372 3300047673 Bacteria 1468
460 Ga0495593_0121059 3300047673 Bacteria 1332
461 Ga0495602_0027594 3300048088 Bacteria 5454
462 Ga0495602_0251500 3300048088 Bacteria 1317
463 Ga0495626_0000011 3300048091 Bacteria 260928
464 Ga0495626_0000290 3300048091 Bacteria 54140
465 Ga0495626_0019871 3300048091 Bacteria 3352
466 Ga0495626_0085939 3300048091 Bacteria 1390
467 Ga0495626_0091995 3300048091 Bacteria 1332
468 Ga0496102_0114622 3300048905 Bacteria 2515
469 Ga0496102_0133221 3300048905 Bacteria 2327
470 Ga0496103_0027559 3300048906 Bacteria 3443
471 Ga0496104_0461292 3300048907 Bacteria 1182
472 Ga0496106_0012017 3300048909 Bacteria 6389
473 Ga0496107_0056619 3300048910 Bacteria 2833
474 Ga0496112_0565148 3300048915 Bacteria 1071
475 Ga0496113_0014394 3300048916 Bacteria 5395
476 Ga0496122_0001042 3300048925 Bacteria 48555
477 Ga0496122_0054502 3300048925 Bacteria 3002
478 Ga0496123_0001273 3300048926 Bacteria 36130
479 Ga0496123_0060667 3300048926 Bacteria 2437
480 Ga0496124_0018875 3300048927 Bacteria 6440
481 Ga0496124_0094183 3300048927 Bacteria 2436
482 Ga0496125_0034167 3300048928 Bacteria 4486
483 Ga0495678_006635 3300049459 Bacteria 6129
484 Ga0501292_016024 3300049515 Bacteria 1176
485 Ga0501298_000487 3300049521 Bacteria 5356
486 Ga0501034_0013881 3300049571 Bacteria 8294
487 Ga0501034_0239398 3300049571 Bacteria 1761
488 Ga0501036_0163379 3300049572 Bacteria 1877
489 Ga0501070_0041682 3300049586 Bacteria 3824
490 Ga0501202_000022 3300049652 Bacteria 16472
491 Ga0501206_009295 3300049653 Unclassified 1305
492 Ga0501217_018396 3300049661 Bacteria 1622
493 Ga0501223_001069 3300049663 Bacteria 6476
494 Ga0501235_003884 3300049669 Bacteria 3231
495 Ga0501246_007180 3300049676 Unclassified 968
496 Ga0501261_000251 3300049690 Bacteria 7363
497 Ga0501234_000168 3300049707 Bacteria 8998
498 Ga0501245_001736 3300049708 Bacteria 2854
499 Ga0501080_0095108 3300049742 Bacteria 2767
500 Ga0501269_000203 3300049766 Bacteria 17659
501 Ga0501279_015710 3300049775 Bacteria 1050
502 Ga0501279_029121 3300049775 Bacteria 814
503 Ga0501035_0000292 3300049822 Bacteria 59353
504 Ga0501044_0126964 3300049823 Unclassified 2547
505 Ga0500616_0049782 3300053153 Bacteria 2215
506 Ga0500622_0001946 3300053156 Bacteria 15545
507 Ga0500584_100378 3300053726 Bacteria 1194
508 Ga0466962_0039412 3300061719 Bacteria 2262
509 2643791700 2643221554 Bacteria 6603920
510 2643798794 2643221556 Bacteria 7251154
511 2644211329 2643221638 Bacteria 6579467
512 2644253120 2643221645 Bacteria 7207331
513 2644354980 2643221664 Bacteria 7272945
514 2644471111 2643221684 Bacteria 7145183
515 2738741758 2738541280 Bacteria 6630198
516 2738843922 2738541300 Bacteria 6675882
517 2739274517 2738543018 Bacteria 6718814
518 2739343561 2738543030 Bacteria 6719714
519 2904430443 2904424332 Bacteria 7633521
520 8047678353 8047673197 Bacteria 7395230
521 Ga0207639_10357051
522 JGI25158J39367_1000015
523 JGI25158J39367_1000072
524 JGI25152J39213_1000002
525 JGI25150J39212_1000038
526 JGI25150J39212_1003391
527 JGI25159J45721_1000185
528 JGI25159J45721_1000254
529 JGI25153J46596_10002426
530 JGI25153J46596_10025631
531 rootH1_10018661
532 rootH2_10104256
533 rootH2_10140316
534 rootL2_10203852
535 rootL2_10213213
536 rootH1_10005851
537 rootH1_10012383
538 rootH1_10029352
539 rootH1_10029353
540 rootH1_10118678
541 rootH1_10156555
542 rootH1_10160801
543 rootH1_10231546
544 JGI25160J50197_1000424
545 JGI25160J50197_1007121
546 JGI25161J50226_1000062
547 JGI25161J50226_1001608
548 Ga0055525_1000047
549 Ga0055526_1000358
550 Ga0055526_1021270
551 Ga0055537_1005297
552 Ga0055537_1022169
553 Ga0055524_1000105
554 Ga0055524_1000462
555 Ga0055524_1001461
556 Ga0055534_1000541
557 Ga0055530_10000078
558 Ga0055530_10002786
559 Ga0055530_10005344
560 Ga0055531_10000058
561 Ga0055531_10002145
562 Ga0055531_10004991
563 Ga0055543_1000121
564 Ga0055543_1005457
565 Ga0065165_1000261
566 Ga0070658_10077141
567 Ga0070658_10336527
568 Ga0070658_10504139
569 Ga0070658_10505194
570 Ga0070676_10025105
571 Ga0070683_100527325
572 Ga0070677_10225891
573 Ga0068869_100003584
574 Ga0068869_100598366
575 Ga0070666_10000061
576 Ga0070666_10016986
577 Ga0070666_10274443
578 Ga0070680_100321952
579 Ga0070680_100523112
580 Ga0068868_100039809
581 Ga0070660_100001082
582 Ga0070660_100005946
583 Ga0070661_100206407
584 Ga0070668_100092972
585 Ga0070669_100062645
586 Ga0070671_100034728
587 Ga0070674_100015774
588 Ga0070674_100253109
589 Ga0070673_100250115
590 Ga0070659_100047843
591 Ga0070659_100171290
592 Ga0070667_100044217
593 Ga0070667_100118617
594 Ga0070678_100094303
595 Ga0070662_100272600
596 Ga0068867_100044869
597 Ga0068867_100067702
598 Ga0070685_10099164
599 Ga0070679_100020667
600 Ga0070684_100019229
601 Ga0070684_100328598
602 Ga0068853_100066780
603 Ga0068853_100519823
604 Ga0070672_100012051
605 Ga0068855_100028111
606 Ga0068855_100186633
607 Ga0070664_100464332
608 Ga0068852_100001474
609 Ga0068852_100566577
610 Ga0068859_100000071
611 Ga0068859_100010436
612 Ga0068864_100006275
613 Ga0068851_10139298
614 Ga0068870_10185905
615 Ga0068863_100004791
616 Ga0068863_100559910
617 Ga0068858_100013471
618 Ga0068858_100397205
619 Ga0068860_100004332
620 Ga0068860_100011991
621 Ga0068860_100525731
622 Ga0081539_10004597
623 Ga0070716_100254310
624 Ga0097621_100003597
625 Ga0097621_100007664
626 Ga0097621_100282708
627 Ga0068871_100005124
628 Ga0068865_100031135
629 Ga0097620_100000071
630 Ga0097620_100010436
631 Ga0105244_10146316
632 Ga0105240_10318481
633 Ga0105245_10246348
634 Ga0105247_10004579
635 Ga0105243_10100499
636 Ga0105241_10003070
637 Ga0105241_10261471
638 Ga0105241_10907964
639 Ga0105242_10146839
640 Ga0105242_10686148
641 Ga0105237_10002673
642 Ga0105237_10081179
643 Ga0105237_10387428
644 Ga0105238_10282185
645 Ga0105249_10012351
646 Ga0105249_10253918
647 Ga0105239_10047867
648 Ga0105246_10018729
649 Ga0157373_10000327
650 Ga0157373_10069633
651 Ga0157373_10113087
652 Ga0157371_10012612
653 Ga0157371_10174539
654 Ga0157370_10008258
655 Ga0157370_10194462
656 Ga0157370_10260626
657 Ga0157369_10211426
658 Ga0157369_10307118
659 Ga0157374_10487130
660 Ga0157378_10467189
661 Ga0163162_10103144
662 Ga0163162_10158780
663 Ga0163162_10563375
664 Ga0157372_10000980
665 Ga0157372_10038946
666 Ga0157372_10054131
667 Ga0157372_10480226
668 Ga0157372_10487586
669 Ga0157372_10625677
670 Ga0157375_10086477
671 Ga0163163_10050905
672 Ga0163163_10204410
673 Ga0157379_10073792
674 Ga0157376_10029603
675 Ga0213876_10005376
676 Ga0209436_100005
677 Ga0209436_100153
678 Ga0209563_100003
679 Ga0207425_1000001
680 Ga0207425_1000033
681 Ga0207425_1000430
682 Ga0209646_1000106
683 Ga0209677_101295
684 Ga0209148_1000871
685 Ga0209129_1000001
686 Ga0209129_1004542
687 Ga0209565_1001351
688 Ga0209565_1001394
689 Ga0209673_1004467
690 Ga0209130_1000055
691 Ga0209130_1000592
692 Ga0209675_1001604
693 Ga0209564_1000124
694 Ga0209564_1002012
695 Ga0209564_1037786
696 Ga0209758_1000020
697 Ga0209758_1003711
698 Ga0209050_1000011
699 Ga0209050_1000313
700 Ga0209050_1003773
701 Ga0209256_1000028
702 Ga0209256_1001270
703 Ga0207426_1000023
704 Ga0207426_1000818
705 Ga0207426_1017083
706 Ga0209051_1064223
707 Ga0209257_1000003
708 Ga0209257_1000007
709 Ga0209257_1003724
710 Ga0207697_10038418
711 Ga0207682_10016365
712 Ga0207642_10075102
713 Ga0207710_10017893
714 Ga0207680_10000119
715 Ga0207645_10000245
716 Ga0207645_10072712
717 Ga0207643_10023604
718 Ga0207643_10126353
719 Ga0207705_10008110
720 Ga0207654_10003342
721 Ga0207654_10130517
722 Ga0207695_10283574
723 Ga0207671_10002498
724 Ga0207660_10264488
725 Ga0207657_10001383
726 Ga0207657_10001634
727 Ga0207657_10003004
728 Ga0207657_10028469
729 Ga0207649_10150106
730 Ga0207652_10022101
731 Ga0207681_10068714
732 Ga0207650_10031374
733 Ga0207650_10123383
734 Ga0207687_10563332
735 Ga0207690_10035788
736 Ga0207690_10050006
737 Ga0207686_10096205
738 Ga0207709_10087912
739 Ga0207669_10298694
740 Ga0207691_10011183
741 Ga0207691_10155572
742 Ga0207689_10004176
743 Ga0207689_10004731
744 Ga0207661_10486667
745 Ga0207667_10003039
746 Ga0207667_10093045
747 Ga0207712_10009586
748 Ga0207712_10061497
749 Ga0207640_10430473
750 Ga0207677_10014146
751 Ga0207703_10011580
752 Ga0207639_10027200
753 Ga0207641_10000240
754 Ga0207648_10007679
755 Ga0207648_10045562
756 Ga0207648_10095685
757 Ga0207648_10608617
758 Ga0207676_10019519
759 Ga0207674_10130262
760 Ga0207683_10001367
761 Ga0207683_10346078
762 Ga0207698_10001767
763 Ga0207698_10163096
764 Ga0207698_10566523
765 Ga0268266_10063782
766 Ga0268265_10104866
767 Ga0268264_10107656
768 Ga0307515_10000036
769 Ga0265338_10310276
770 Ga0316182_1029359
771 Ga0265327_10000054
772 Ga0307509_10010202
773 Ga0307408_100000022
774 Ga0307408_100001037
775 Ga0307408_100001365
776 Ga0307408_100013189
777 Ga0307408_100131239
778 Ga0307414_10054543
779 Ga0307414_10286305
780 Ga0395899_0005351
781 Ga0395899_0016478
782 Ga0395900_0000081
783 Ga0395900_0000148
784 Ga0395900_0001208
785 Ga0395900_0011957
786 Ga0395900_0057623
787 Ga0395900_0126928
788 Ga0395900_0294571
789 Ga0395900_0300367
790 Ga0395898_0005424
791 Ga0395898_0072987
792 Ga0395898_0296822
793 Ga0395905_0053774
794 Ga0395905_0066777
795 Ga0395905_0134076
796 Ga0395905_0159158
797 Ga0395905_0174622
798 Ga0395901_0000237
799 Ga0395901_0001388
800 Ga0395901_0052529
801 Ga0395901_0080042
802 Ga0395901_0212115
803 Ga0395901_0219711
804 Ga0436365_0058655
805 Ga0436365_0462204
806 Ga0439448_0000555
807 Ga0439450_001256
808 Ga0439455_0001607
809 Ga0450897_002410
810 Ga0450906_016501
811 Ga0439458_0075100
812 Ga0450893_0006968
813 Ga0451577_0100543
814 Ga0466972_0000568
815 Ga0466965_0005218
816 Ga0466965_0074694
817 Ga0466966_0002106
818 Ga0466966_0005887
819 Ga0466966_0009166
820 Ga0466966_0063373
821 Ga0466966_0103168
822 Ga0466961_0032393
823 Ga0466961_0033989
824 Ga0466961_0065607
825 Ga0466964_0000492
826 Ga0466964_0002109
827 Ga0466964_0054164
828 Ga0466964_0139401
829 Ga0466971_0038620
830 Ga0466971_0087578
831 Ga0466971_0093707
832 Ga0466968_0000879
833 Ga0466968_0055123
834 Ga0466957_0000337
835 Ga0466957_0146113
836 Ga0466959_0033273
837 Ga0466959_0065055
838 Ga0451576_0015622
839 Ga0466958_0031251
840 Ga0466958_0059887
841 Ga0466958_0083789
842 Ga0466958_0171637
843 Ga0466967_0022979
844 Ga0466967_0335773
845 Ga0495590_0027213
846 Ga0495638_0197051
847 Ga0495653_0000634
848 Ga0495653_0003297
849 Ga0495653_0157635
850 Ga0495580_0070836
851 Ga0495582_0002079
852 Ga0495605_0003913
853 Ga0495605_0039913
854 Ga0495584_0000026
855 Ga0495584_0003323
856 Ga0495584_0009328
857 Ga0495584_0067210
858 Ga0495584_0100948
859 Ga0495585_0015518
860 Ga0495585_0063423
861 Ga0495596_0000156
862 Ga0495596_0000833
863 Ga0495596_0003244
864 Ga0495607_0000316
865 Ga0495607_0001702
866 Ga0495607_0002001
867 Ga0495607_0003182
868 Ga0495607_0003268
869 Ga0495607_0014829
870 Ga0495607_0023955
871 Ga0495583_0000655
872 Ga0495583_0002721
873 Ga0495583_0018052
874 Ga0495606_0000210
875 Ga0495606_0003081
876 Ga0495606_0008190
877 Ga0495616_0001668
878 Ga0495616_0004757
879 Ga0495616_0024677
880 Ga0495616_0029393
881 Ga0495616_0029524
882 Ga0495630_0211983
883 Ga0495631_0004965
884 Ga0495631_0066518
885 Ga0495632_0000118
886 Ga0495632_0000321
887 Ga0495632_0001878
888 Ga0495632_0129242
889 Ga0495643_0058578
890 Ga0495643_0094534
891 Ga0495644_0005809
892 Ga0495644_0027163
893 Ga0495648_0007546
894 Ga0495666_0012757
895 Ga0495642_0000673
896 Ga0495642_0006892
897 Ga0495642_0044574
898 Ga0495652_0010208
899 Ga0495654_0126334
900 Ga0495665_0008314
901 Ga0495640_0082876
902 Ga0495587_0039675
903 Ga0495587_0046834
904 Ga0495609_0000001
905 Ga0495609_0000084
906 Ga0495645_0192161
907 Ga0495633_0007798
908 Ga0495633_0050301
909 Ga0495656_0004909
910 Ga0495656_0007073
911 Ga0495656_0026833
912 Ga0495656_0049562
913 Ga0495668_0000006
914 Ga0495668_0040419
915 Ga0495668_0063407
916 Ga0495668_0074332
917 Ga0495668_0247477
918 Ga0495634_0011863
919 Ga0495625_0001203
920 Ga0495625_0010429
921 Ga0495625_0119734
922 Ga0495659_0000185
923 Ga0495659_0004106
924 Ga0495661_0000053
925 Ga0495661_0000170
926 Ga0495661_0006188
927 Ga0495661_0084055
928 Ga0495661_0084921
929 Ga0495661_0197048
930 Ga0495588_0000062
931 Ga0495623_0005447
932 Ga0495646_0100350
933 Ga0495669_0001533
934 Ga0495669_0007765
935 Ga0495669_0086927
936 Ga0495624_0141108
937 Ga0495670_0080259
938 Ga0495671_0000088
939 Ga0495671_0131759
940 Ga0495649_0001312
941 Ga0495649_0038336
942 Ga0495649_0086178
943 Ga0495649_0139019
944 Ga0495589_0000103
945 Ga0495589_0004437
946 Ga0495600_0117527
947 Ga0495660_0000057
948 Ga0495660_0000208
949 Ga0495660_0006497
950 Ga0495660_0158719
951 Ga0495636_0018567
952 Ga0495636_0062023
953 Ga0495672_0000262
954 Ga0495672_0012409
955 Ga0495672_0029922
956 Ga0495680_0134949
957 Ga0495683_0005944
958 Ga0495683_0019185
959 Ga0495683_0137678
960 Ga0495687_000019
961 Ga0495687_000036
962 Ga0495687_000740
963 Ga0495687_001604
964 Ga0495687_003773
965 Ga0495675_0009884
966 Ga0495677_0000009
967 Ga0495677_0000217
968 Ga0495677_0000873
969 Ga0495677_0002104
970 Ga0495677_0003892
971 Ga0495677_0004159
972 Ga0495677_0028737
973 Ga0495677_0054243
974 Ga0495679_018009
975 Ga0495679_019164
976 Ga0495681_0000907
977 Ga0495681_0008872
978 Ga0495681_0060535
979 Ga0495593_0102372
980 Ga0495593_0121059
981 Ga0495602_0027594
982 Ga0495602_0251500
983 Ga0495626_0000011
984 Ga0495626_0000290
985 Ga0495626_0019871
986 Ga0495626_0085939
987 Ga0495626_0091995
988 Ga0496102_0114622
989 Ga0496102_0133221
990 Ga0496103_0027559
991 Ga0496104_0461292
992 Ga0496106_0012017
993 Ga0496107_0056619
994 Ga0496112_0565148
995 Ga0496113_0014394
996 Ga0496122_0001042
997 Ga0496122_0054502
998 Ga0496123_0001273
999 Ga0496123_0060667
1000 Ga0496124_0018875
1001 Ga0496124_0094183
1002 Ga0496125_0034167
1003 Ga0495678_006635
1004 Ga0501292_016024
1005 Ga0501298_000487
1006 Ga0501034_0013881
1007 Ga0501034_0239398
1008 Ga0501036_0163379
1009 Ga0501070_0041682
1010 Ga0501202_000022
1011 Ga0501206_009295
1012 Ga0501217_018396
1013 Ga0501223_001069
1014 Ga0501235_003884
1015 Ga0501246_007180
1016 Ga0501261_000251
1017 Ga0501234_000168
1018 Ga0501245_001736
1019 Ga0501080_0095108
1020 Ga0501269_000203
1021 Ga0501279_015710
1022 Ga0501279_029121
1023 Ga0501035_0000292
1024 Ga0501044_0126964
1025 Ga0500616_0049782
1026 Ga0500622_0001946
1027 Ga0500584_100378
1028 Ga0466962_0039412
1029 2643791700
1030 2643798794
1031 2644211329
1032 2644253120
1033 2644354980
1034 2644471111
1035 2738741758
1036 2738843922
1037 2739274517
1038 2739343561
1039 2904430443
1040 8047678353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

198

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

252

0.95

PF08659

KR

KR domain

8

170

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

9

214

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9526 3 181
6qhe-assembly2.cif.gz_B alcohol dehydrogenase from arthrobacter sp. ts-15 in complex with nad+ 0.941 1 249
1iy8-assembly1.cif.gz_B crystal structure of levodione reductase 0.9391 5 248
6zzo-assembly2.cif.gz_D-3 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.937 3 250
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9365 3 248
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 5 76 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 7 53 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 4 178 3.40.50.720
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 3 181 3.40.50.720
af_P37440_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 1 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3BUZ2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9804 1 165 GO:0016491
AF-A0A6J4HTS7-F1-model_v4 Short-chain alcohol dehydrogenase 0.9782 1 190 GO:0016491
AF-A0A2V8AGD4-F1-model_v4 Short-chain dehydrogenase 0.9732 1 227 GO:0016491
AF-A0A3D4CS62-F1-model_v4 Short-chain dehydrogenase 0.9728 6 191 GO:0016491
AF-A0A2R7KCB6-F1-model_v4 Short-chain dehydrogenase 0.9714 1 152 GO:0016491

Map